Expression constructs
|
|
- Ashlee Peters
- 5 years ago
- Views:
Transcription
1 Gene expressed in bebe3 ZmBEa Expression constructs 35S ZmBEa Pnos:Hygromycin r 35S Pnos:Hygromycin r 35S ctp YFP Pnos:Hygromycin r B -1 Chl YFP- Merge Supplemental Figure S1: Constructs Used for the Expression of Different Branching Enzyme Types in the rabidopsis bebe3 Double Mutant (), and the Correct Localization of E. coli GLGB (B). () Cartoon of the constructs used for the constitutive expression of different branching enzyme types. (B) Confocal laser scanning fluorescence microscopy of plants expressing YFP-tagged. The left-hand panel shows the chlorophyll auto-fluorescence. The middle panel shows YFP fluorescence. The right-hand panel shows the merged images confirming chloroplastic localization of the recombinant protein. White Bar = um
2 DP bebe3 DP3 B DP ZmBEa-1 DP3 ZmBEa C DP -1 DP3 D DP DP3-1 Retention time (min) Supplemental Figure S. MOS Composition From bebe3 Mutants Expressing Different Branching Enzyme Types. Neutralized soluble fractions of the - replicate plants of each line were analyzed by HPEC-PD. Maltose (DP ) and other linear glucans (DP 3-7) were identified by their retention time. Individual chromatograph for each line are shown. The peaks for DP 3-7 are show in the inset in each panel. Replicates for each line yielded comparable results. () Chromatographs of wild type (blue) and bebe3 mutant (black) (B) Chromatographs of bebe3 mutant expressing ZmBEa. ZmBEa-1 (pink), ZmBEa (blue), and (black) (C) Chromatographs of bebe3 mutant expressing. -1 (pink), (blue), and (black) (D) Chromatographs of bebe3 mutant expressing. -1(pink), (blue), and (black)
3 PHS bebe3 IS1-IS PHS1 tbe3 tbe Supplemental Figure S3. Native PGE (Zymograms) of Wild-Type rabidopsis () and bebe3 Mutants to Detect BE ctivities Soluble proteins were extracted from the indicated lines and separated by native PGE in gels containing.% (w/v) glycogen. Branching enzyme activity was detected by incubating the gels in a medium containing phosphorlyase a and its substrate, glucose-1-phosphate. Dark bands represent the endogenous α-glucan phosphorylases (PHS) in the cytosol (PHS) and plastid (PHS1). In this gel, BE3 is resolved from PHS1. pale band corresponds to the heteromultimeric IS1-IS debranching enzyme.
4 be be3 ZmBEa -1 ZmBEa ZmBEa -1 be be3-1 SS3 SS1 Supplemental Figure S. Native PGE (Zymograms) of Wild-Type rabidopsis () and bebe3 Mutants Expressing Different Branching Enzyme Types to Detect SS ctivities. Extracts of soluble protein from each line was loaded on native PGE gel containing.3% (w/v) glycogen. fter electrophoresis, the gels were incubated overnight in a solution containing. mm DP-glucose. Dark bands represent starch synthase activities SS1 and SS3. Pale bands represented glucan hydrolytic activities such as α- and β-amylases.
5 B E ZmBEa Degree of polymerization(dp) C F ZmBEa D G H I J Supplemental Figure S5. Chain Length Distribution of mylopectin from Wild-Type rabidopsis () and bebe3 Mutants Expressing Different Branching Enzyme Types. mylopectin fractions from the given lines were debranched and the resultant linear chains analyzed using HPEC-PD. Peak areas from DP 3 to DP 5 were summed and the relative peak area for each chain length was calculated. Values are the means ± SE from or 3 technical replicates. () CLD of amylopectin from the wild type (). (B-D) CLD of amylopectin from independent transgenic lines expressing ZmBEa (E-G) CLD of amylopectin from independent transgenic lines expressing (H-J) CLD of amylopectin from independent transgenic lines expressing
6 be ZmBEa ZmBEa ZmBEa be starch gbss deficient starch 7kDa 55kDa GBSS (7kDa) 55kDa Rubisco (5kDa) Supplemental Figure S. GBSS bundance in Total Protein Extracts of Wild-Type rabidopsis () and bebe3 Mutants Expressing Different Branching Enzyme Types. Total proteins were extracted from rosette leaves of each genotype harvested in the middle of day, by homogenization in a solution containing % SDS and subsequent boiled for 5 min. 1 mg of purified starch from and a mutant lacking GBSS were dissolved in 1 ml extraction solution and used as positive and negative controls. Protein extracts were loaded on a SDS-PGE gel, and subject to immunoblotting with GBSS-specific antibodies, as described in Seung et al. (15). Subsequently, the blots were stained with Coomassie blue to visualize the large subunit of the Rubisco protein, confirming equal protein loading for each lane, except those with proteins derived from pure starch samples (lower panel).
7 E 1 µm B F -1 C G D H Supplemental Figure S7. Various Granule Morphology in Line (-D), and in Different Expressing Lines (E-H). See Fig. and Materials and Methods for further details. Bar = 1µm.
Supplemental Figure S1.
53 kda- WT TPS29.2 (ethanol) TPS29.2 (water) Supplemental Figure S1. Inducible expression of E. coli otsa (TPS) in Arabidopsis. Immunoblot of leaf proteins (20 µg per lane) extracted from: (i) WT Col-0,
More informationSupporting Information
Supporting Information Dauvillée et al. 10.1073/pnas.0907424106 Fig. S1. Iodine screening of the C. cohnii mutant bank. Each single colony was grown on rich-medium agar plates then vaporized with iodine.
More informationAnalyses of starch biosynthetic protein complexes and starch properties from developing mutant rice seeds with minimal starch synthase activities
Hayashi et al. BMC Plant Biology (2018) 18:59 https://doi.org/10.1186/s12870-018-1270-0 RESEARCH ARTICLE Open Access Analyses of starch biosynthetic protein complexes and starch properties from developing
More informationSupplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.
More informationHenrike Brust 1 *, Tanja Lehmann 1, Christophe D Hulst 2, Joerg Fettke 1. Abstract. Introduction
Analysis of the Functional Interaction of Arabidopsis Starch Synthase and Branching Enzyme Isoforms Reveals that the Cooperative Action of SSI and BEs Results in Glucans with Polymodal Chain Length Distribution
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Krenn et al., http://www.jcb.org/cgi/content/full/jcb.201110013/dc1 Figure S1. Levels of expressed proteins and demonstration that C-terminal
More informationSupplemental Data. Wang et al. (2013). Plant Cell /tpc
Supplemental Data. Wang et al. (2013). Plant Cell 10.1105/tpc.112.108993 Supplemental Figure 1. 3-MA Treatment Reduces the Growth of Seedlings. Two-week-old Nicotiana benthamiana seedlings germinated on
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:1.138/nature9814 a A SHARPIN FL B SHARPIN ΔNZF C SHARPIN T38L, F39V b His-SHARPIN FL -1xUb -2xUb -4xUb α-his c Linear 4xUb -SHARPIN FL -SHARPIN TF_LV -SHARPINΔNZF -SHARPIN
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Mutational analysis of the SA2-Scc1 interaction in vitro and in human cells. (a) Autoradiograph (top) and Coomassie stained gel (bottom) of 35 S-labeled Myc-SA2 proteins (input)
More informationCharacterization of Starch Polysaccharides in Aqueous Systems: de facto molar masses vs supermolecular structures
Characterization of Starch Polysaccharides in Aqueous Systems: de facto molar masses vs supermolecular structures Werner Praznik and Anton uber Department of Chemistry BKU - University of Natural Resourses
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationProject Title: Development of GEM line starch to improve nutritional value and biofuel production
Project Title: Development of GEM line starch to improve nutritional value and biofuel production Prepared by Jay-lin Jane and Hanyu Yangcheng, Department of Food Science and Human Nutrition, Iowa State
More informationHuman SH-SY5Y neuroblastoma cells (A.T.C.C., Manassas, VA) were cultured in DMEM, F-12
SUPPLEMENTARY METHODS Cell cultures Human SH-SY5Y neuroblastoma cells (A.T.C.C., Manassas, VA) were cultured in DMEM, F-12 Ham with 25 mm HEPES and NaHCO 3 (1:1) and supplemented with 10% (v/v) FBS, 1.0
More informationStarch Molecular Characteristics and Digestion Properties
Starch Molecular Characteristics and Digestion Properties B.R. Hamaker, G. Zhang, Z. Ao, M. Benmoussa and S. Maghaydah Whistler Center for Carbohydrate Research Purdue University, Indiana, USA Presentation
More informationSupplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis
Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis of PD-L1 in ovarian cancer cells. (c) Western blot analysis
More informationa b G75 G60 Sw-2 Sw-1 Supplementary Figure 1. Structure predictions by I-TASSER Server.
a b G75 2 2 G60 Sw-2 Sw-1 Supplementary Figure 1. Structure predictions by I-TASSER Server. a. Overlay of top 10 models generated by I-TASSER illustrates the potential effect of 7 amino acid insertion
More informationSupplementary Figures
Supplementary Figures a miel1-2 (SALK_41369).1kb miel1-1 (SALK_978) b TUB MIEL1 Supplementary Figure 1. MIEL1 expression in miel1 mutant and S:MIEL1-MYC transgenic plants. (a) Mapping of the T-DNA insertion
More informationSupplementary Figure 1. Comparative analysis of thermal denaturation of enzymatically
Supplementary Figures Supplementary Figure 1. Comparative analysis of thermal denaturation of enzymatically synthesized polyubiquitin chains of different length. a, Differential scanning calorimetry traces
More informationSupplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or
Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or 3xflag-CagA expression vector were wounded using a pipette
More informationSPECIFICATION CONTINUED Glucose has two isomers, α-glucose and β-glucose, with structures:
alevelbiology.co.uk SPECIFICATION Monosaccharides are the monomers from which larger carbohydrates are made. Glucose, galactose and fructose are common monosaccharides. A condensation reaction between
More informationSUPPLEMENTARY INFORMATION
Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11429 S1a 6 7 8 9 Nlrc4 allele S1b Nlrc4 +/+ Nlrc4 +/F Nlrc4 F/F 9 Targeting construct 422 bp 273 bp FRT-neo-gb-PGK-FRT 3x.STOP S1c Nlrc4 +/+ Nlrc4 F/F casp1
More informationThe Pennsylvania State University. The Graduate School. College of Agricultural Sciences STRUCTURE AND FUNCTION OF ENDOSPERM STARCH FROM MAIZE
The Pennsylvania State University The Graduate School College of Agricultural Sciences STRUCTURE AND FUNCTION OF ENDOSPERM STARCH FROM MAIZE MUTANTS DEFICIENT IN ONE OR MORE STARCH-BRANCHING ENZYME ISOFORM
More informationProject Title: Value-added Utilization of GEM Normal and High-amylose Line Starch
Project Title: Value-added Utilization of GEM Normal and High-amylose Line Starch Prepared by Jay-lin Jane, Hongxin Jiang, and Li Li, Department of Food Science and Human Nutrition, Iowa State University,
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Jewell et al., http://www.jcb.org/cgi/content/full/jcb.201007176/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. IR Munc18c association is independent of IRS-1. (A and
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationMolecular Structure and Function Polysaccharides as Energy Storage. Biochemistry
1 1.Objectives Dr. Vijaya Khader Dr. MC Varadaraj To understand how polysaccharides act as energy source To understand the structure and energy generation process from glycogen To understand the structure
More informationSUPPLEMENTARY MATERIAL
SUPPLEMENTARY MATERIAL Purification and biochemical properties of SDS-stable low molecular weight alkaline serine protease from Citrullus Colocynthis Muhammad Bashir Khan, 1,3 Hidayatullah khan, 2 Muhammad
More informationFigure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR
Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR and LRRK2 WD40 GST fusion proteins (5 µg) were loaded
More informationSupplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS)
Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS) and their exosomes (EXO) in resting (REST) and activated
More informationMutational Analysis of the Pullulanase-Type Debranching Enzyme of Maize Indicates Multiple Functions in Starch Metabolism
The Plant Cell, Vol. 15, 666 680, March 2003, www.plantcell.org 2003 American Society of Plant Biologists Mutational Analysis of the Pullulanase-Type Debranching Enzyme of Maize Indicates Multiple Functions
More informationDramatic increase in SHP2 binding activity of Helicobacter. pylori Western CagA by EPIYA-C duplication: its
Supplementary Information Dramatic increase in SHP2 binding activity of Helicobacter pylori Western CagA by EPIYA-C duplication: its implications in gastric carcinogenesis Lisa Nagase, Takeru Hayashi,
More informationFigure legends of supplementary figures
Figure legends of supplementary figures Figure 1. Phenotypic analysis of rice early flowering1 () plants and enhanced expression of floral identity genes in.. Leaf emergence of,, and plants with complementary
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 Subcellular segregation of VGluT2-IR and TH-IR within the same VGluT2-TH axon (wild type rats). (a-e) Serial sections of a dual VGluT2-TH labeled axon. This axon (blue outline) has
More informationTRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
More informationSupplementary Figure 1: Co-localization of reconstituted L-PTC and dendritic cells
a CD11c Na + K + ATPase Na + K + ATPase CD11c x-y CD11c Na + K + ATPase Na + K + ATPase CD11c x-z c b x-y view BoNT NAPs CD11c BoNT CD11c NAPs BoNT NAPs CD11c 90 x-z view Apical Basolateral Supplementary
More informationCell wall components:
Main differences between plant and animal cells: Plant cells have: cell walls, a large central vacuole, plastids and turgor pressure. The Cell Wall The primary cell wall is capable of rapid expansion during
More informationMain differences between plant and animal cells: Plant cells have: cell walls, a large central vacuole, plastids and turgor pressure.
Main differences between plant and animal cells: Plant cells have: cell walls, a large central vacuole, plastids and turgor pressure. Animal cells have a lysosome (related to vacuole) and centrioles (function
More informationSupplementary Figure 1. Supernatants electrophoresis from CD14+ and dendritic cells. Supernatants were resolved by SDS-PAGE and stained with
Supplementary Figure 1. Supernatants electrophoresis from CD14+ and dendritic cells. Supernatants were resolved by SDS-PAGE and stained with Coomassie brilliant blue. One µg/ml recombinant human (rh) apo-e
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationCarbohydrates suga. AP Biology
Carbohydrates suga Carbohydrates energyo molecules C 2 O O O O O *4 Cal/gram Carbohydrates Carbohydrates are composed of C,, O carbo - hydr - ate C 2 O (C 12 2 O) x C 6 12 O 6 Function: energy energy storage
More informationStatement Starch Cellulose Glycogen glycosidic bonds present polymer of α-glucose unbranched chains only only found in plants
1 The statements in the table below refer to three polysaccharide molecules. Complete the table. If the statement is correct, place a tick ( ) in the box and if the statement is incorrect place a cross
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3076 Supplementary Figure 1 btrcp targets Cep68 for degradation during mitosis. a) Cep68 immunofluorescence in interphase and metaphase. U-2OS cells were transfected with control sirna
More informationSupplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS
Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS nucleotide sequences (a, b) or amino acid sequences (c) from
More informationSUPPLEMENTARY INFORMATION
doi: 10.1038/nature05732 SUPPLEMENTARY INFORMATION Supplemental Data Supplement Figure Legends Figure S1. RIG-I 2CARD undergo robust ubiquitination a, (top) At 48 h posttransfection with a GST, GST-RIG-I-2CARD
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationEFFECTS OF HEMATURIA ON THE PROTEOMIC PROFILE OF URINARY
Supporting Information EFFECTS OF HEMATURIA ON THE PROTEOMIC PROFILE OF URINARY EXTRACELLULAR VESICLES: TECHNICAL CHALLENGES. #Francesca Raimondo 1*, #Clizia Chinello 1, Martina Stella 1, Lucia Santorelli
More informationProcaspase-3. Cleaved caspase-3. actin. Cytochrome C (10 M) Z-VAD-fmk. Procaspase-3. Cleaved caspase-3. actin. Z-VAD-fmk
A HeLa actin - + + - - + Cytochrome C (1 M) Z-VAD-fmk PMN - + + - - + actin Cytochrome C (1 M) Z-VAD-fmk Figure S1. (A) Pan-caspase inhibitor z-vad-fmk inhibits cytochrome c- mediated procaspase-3 cleavage.
More informationSupplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained
Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained with MitoTracker (red), then were immunostained with
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1 Schematic depiction of the tandem Fc GDF15. Supplementary Figure 2 Supplementary Figure 2 Gfral mrna levels in the brains of both wild-type and knockout Gfral
More informationGLYCOGEN BEFORE THE LAB YOU HAVE TO READ ABOUT:
GLYCGEN BEFRE THE LAB YU HAVE T READ ABUT:. Glycogen structure. 2. Glycogen synthesis and degradation (reactions with structural formulas and enzymes). 3. The role of glycogen in liver and muscles. INTRDUCTIN
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationRescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al
Supplementary Material Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Figure 1. AICAR improves P23H rod opsin
More informationSupplementary information. The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic. Spindle Orientation
Supplementary information The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic Spindle Orientation Running title: Dynein LICs distribute mitotic functions. Sagar Mahale a, d, *, Megha
More informationSupplementary Figure 1
Supplementary Figure 1 6 HE-50 HE-116 E-1 HE-108 Supplementary Figure 1. Targeted drug response curves of endometrial cancer cells. Endometrial cancer cell lines were incubated with serial dilutions of
More informationSupplementary legends
Supplementary legends Supplemental figure S1. Apelin-TAMRA is functional and induces apelin receptor internalization. HEK-293T cells transiently expressing YFP tagged APJ were incubated for 1 hour with:
More informationRelative SOD1 activity. Relative SOD2 activity. Relative SOD activity (Infected:Mock) + CP + DDC
Supplementary Figure 1. SOD1 activity is significantly increased relative to SOD1 levels. SOD1 and SOD2 activities in the infected mork13 cells are shown normalised to their corresponding levels and relative
More informationStructure and Physiological Function of
Structure and hysiological Function of Starch The hosphorylase Untold Story for from Starch Sweet hosphorylase otato Roots - Regulation by roteolytic Modification & hosphorylation 莊榮輝 Rong-Huay Juang Department
More informationSupplemental Data. Hao et al. (2014). Plant Cell /tpc
Supplemental Figure 1. Confocal Images and VA-TIRFM Analysis of GFP-RbohD in Arabidopsis Seedlings. (A) RbohD expression in whole Arabidopsis seedlings. RbohD was expressed in the leaves, hypocotyl, and
More informationStructural Characterization of Prion-like Conformational Changes of the Neuronal Isoform of Aplysia CPEB
Structural Characterization of Prion-like Conformational Changes of the Neuronal Isoform of Aplysia CPEB Bindu L. Raveendra, 1,5 Ansgar B. Siemer, 2,6 Sathyanarayanan V. Puthanveettil, 1,3,7 Wayne A. Hendrickson,
More informationThis chapter deals with the evaluation of alpha amylase inhibitory
This chapter deals with the evaluation of alpha amylase inhibitory activity of different extracts isolated from leaves of Aloe vera L. and leaves of Azadiracta indica A Juss. collected from Bharatpur and
More informationEnzymatic Removal of N- and O-glycans using PNGase F or the Protein Deglycosylation Mix
be INSPIRED drive DISCOVERY stay GENUINE APPLICATION NOTE Enzymatic Removal of N- and O-glycans using PNGase F or the Protein Deglycosylation Mix Alicia Bielik and Paula Magnelli, New England Biolabs,
More informationDo Now Makeups. 4. In which organelle would water and dissolved materials be stored? A. 1 B. 2 C. 3 D. 5. A. mitochondria B.
Do Now Makeups Name: Date: 1. Which organelle is primarily concerned with the conversion of potential energy of organic compounds into suitable form for immediate use by the cell? A. mitochondria B. centrosomes
More informationSupplementary Fig. S1. Schematic diagram of minigenome segments.
open reading frame 1565 (segment 5) 47 (-) 3 5 (+) 76 101 125 149 173 197 221 246 287 open reading frame 890 (segment 8) 60 (-) 3 5 (+) 172 Supplementary Fig. S1. Schematic diagram of minigenome segments.
More informationLoss of protein association causes cardiolipin degradation in Barth syndrome
SUPPLEMENTARY INFORMATION Loss of protein association causes cardiolipin degradation in Barth syndrome Yang Xu 1, Colin K.L. Phoon 2, Bob Berno 5, Kenneth D Souza 6, Esthelle Hoedt 4, Guoan Zhang 4, Thomas
More informationThe amylose extender mutant of maize conditions novel protein protein interactions between starch biosynthetic enzymes in amyloplasts
Journal of Experimental Botany Advance Access published October 4, 2009 Journal of Experimental Botany, Page 1 of 18 doi:10.1093/jxb/erp297 This paper is available online free of all access charges (see
More informationSupplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )
770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/9/439/ra78/dc1 Supplementary Materials for Small heterodimer partner mediates liver X receptor (LXR) dependent suppression of inflammatory signaling by promoting
More informationAtg5 flox/flox ; CAG-Cre, 19M brain heart lung. spleen stomach colon. Takamura_Fig. S1
Takamura_Fig. S1 brain heart lung spleen stomach colon kidney SM Supplemental Figure 1 Histological findings of tg5 flox/flox ;CG-Cre mouse tissues. H&E staining of the brain, heart, lung, spleen, stomach,
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Chairoungdua et al., http://www.jcb.org/cgi/content/full/jcb.201002049/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Expression of CD9 and CD82 inhibits Wnt/ -catenin
More informationThe Structure and Function of Large Biological Molecules. Chapter 5
The Structure and Function of Large Biological Molecules Chapter 5 The Molecules of Life Living things made up of 4 classes of large biological molecules (macromolecules) : 1. Carbohydrates 2. Lipids 3.
More information9.A compare the structures and functions of different types of biomolecules, including carbohydrates, lipids, proteins, and nucleic acids
9.A compare the structures and functions of different types of biomolecules, including carbohydrates, lipids, proteins, and nucleic acids o o o Food is a good source of one or more of the following: protein,
More informationbio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM.
bio-mof-1 Transmittance bio-mof-1 DMASM DMASMI 2000 1500 1000 500 Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. Intensity (a.u.) bio-mof-1 DMASM as
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Chen et al., http://www.jcb.org/cgi/content/full/jcb.201210119/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Lack of fast reversibility of UVR8 dissociation. (A) HEK293T
More informationTable I: PHT1 transporter family comparison at the amino acid level. BLAST program was used to obtain percentage of similarity and identity (in bold).
Supplemental Tables Table I: PHT1 transporter family comparison at the amino acid level. BLAST program was used to obtain percentage of similarity and identity (in bold). PHT1;1 PHT1;2 PHT1;3 PHT1;4 PHT1;5
More information6. TNF-α regulates oxidative stress, mitochondrial function and autophagy in neuronal cells
6. TNF-α regulates oxidative stress, mitochondrial function and autophagy in neuronal cells 6.1 TNF-α induces mitochondrial oxidative stress in SH-SY5Y cells. The dysregulation of mitochondria and oxidative
More informationSupplemental Data. Candat et al. Plant Cell (2014) /tpc Cytosol. Nucleus. Mitochondria. Plastid. Peroxisome. Endomembrane system
Cytosol Nucleus 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 PSORT MultiLoc YLoc SubLoc BaCelLo WoLF PSORT
More informationcrossmark Ca V subunits interact with the voltage-gated calcium channel
crossmark THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 291, NO. 39, pp. 20402 20416, September 23, 2016 Author s Choice 2016 by The American Society for Biochemistry and Molecular Biology, Inc. Published in
More informationSupplementary Figure S1. Distinct compartmentalization of proinsulin in obese db/db mouse islet ß- cells.
Supplementary Figure S1. Distinct compartmentalization of proinsulin in obese db/db mouse islet ß- cells. Pancreata from 16-weeks-old 6J +/+, 6J db/db, KS +/+ and KS db/db mice were harvested, fixed with
More informationExperiment 1. Isolation of Glycogen from rat Liver
Experiment 1 Isolation of Glycogen from rat Liver Figure 35: FIG-2, Liver, PAS, 100x. Note the presence of a few scattered glycogen granules (GG). Objective To illustrate the method for isolating glycogen.
More informationsfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL
sfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL LTL staining Negative control Fluorescence microscopy of normal (CL-11 +/+ ) mouse renal tissue after staining with
More informationExpression of acid base transporters in the kidney collecting duct in Slc2a7 -/-
Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.
More informationNantes. Morphologies de grains d amidon
Morphologies de grains d amidon Spherulitic organization of the starch granule Positive birefringence, average radial orientation Amylose C 2 C 2 C 2 α(1-4)linkages Mw ~10 6-10 7 Amylopectin Ø cluster
More informationFig. S1. Subcellular localization of overexpressed LPP3wt-GFP in COS-7 and HeLa cells. Cos7 (top) and HeLa (bottom) cells expressing for 24 h human
Fig. S1. Subcellular localization of overexpressed LPP3wt-GFP in COS-7 and HeLa cells. Cos7 (top) and HeLa (bottom) cells expressing for 24 h human LPP3wt-GFP, fixed and stained for GM130 (A) or Golgi97
More informationtom tom 24hpf tom tom 48hpf tom 60hpf tom tom 72hpf tom
a 24hpf c 48hpf d e 60hpf f g 72hpf h i j k ISV ISV Figure 1. Vascular integrity defects and endothelial regression in mutant emryos. (a,c,e,g,i) Bright-field and (,d,f,h,j) corresponding fluorescent micrographs
More informationSupplemental Data. Wu et al. (2010). Plant Cell /tpc
Supplemental Figure 1. FIM5 is preferentially expressed in stamen and mature pollen. The expression data of FIM5 was extracted from Arabidopsis efp browser (http://www.bar.utoronto.ca/efp/development/),
More information2-2 Properties of Water
2-2 Properties of Water 1 A. The Water Molecule o o o Water is polar Hydrogen bonds form between water molecules Properties of Water: cohesion adhesion capillary action high specific heat ice floats good
More informationDirect Interaction of Ligand-Receptor Pairs Specifying Stomatal Patterning
Lee_Jin Suk 1 Direct Interaction of Ligand-Receptor Pairs Specifying Stomatal Patterning Jin Suk Lee, Takeshi Kuroha, Marketa Hnilova, Dmitriy Khatayevich, Masahiro M. Kanaoka, Jessica M. McAbee, Mehmet
More informationSUPPLEMENTARY INFORMATION
Figure S1 Treatment with both Sema6D and Plexin-A1 sirnas induces the phenotype essentially identical to that induced by treatment with Sema6D sirna alone or Plexin-A1 sirna alone. (a,b) The cardiac tube
More informationPurification of Glucagon3 Interleukin-2 Fusion Protein Derived from E. coli
Purification of Glucagon3 Interleukin-2 Fusion Protein Derived from E. coli Hye Soon Won Dept. of Chem. Eng. Chungnam National University INTRODUCTION Human interleukin-2(hil-2) - known as T Cell Growth
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Design of isolated protein and RNC constructs, and homogeneity of purified RNCs. (a) Schematic depicting the design and nomenclature used for all the isolated proteins and RNCs used
More informationDiscrete Forms of Amylose Are Synthesized by Isoforms of GBSSI in Pea
The Plant Cell, Vol. 14, 1767 1785, August 2002, www.plantcell.org 2002 American Society of Plant Biologists Discrete Forms of Amylose Are Synthesized by Isoforms of GBSSI in Pea Anne Edwards, a Jean-Paul
More informationSTUDIES ON MUSTARD-STIMULATED PROTEASES AND INHIBITORS IN HUMAN EPIDERMAL KERATINOCYTES (HEK): DEVELOPMENT OF ANTIVESICANT DRUGS
STUDIES ON MUSTARD-STIMULATED PROTEASES AND INHIBITORS IN HUMAN EPIDERMAL KERATINOCYTES (HEK): DEVELOPMENT OF ANTIVESICANT DRUGS Xiannu Jin 1, Radharaman Ray 2, Guang Xu 1 and Prabhati Ray 1 1 Department
More informationMIT Invitational Tournament Cell Biology Exam ANSWER KEY
MIT Invitational Tournament Cell Biology Exam ANSWER KEY NAMES: MIT Invitational Tournament 2015 Cell Biology ANSWER KEY ANSWER KEY TEAM ID SCHOOL: 1/2 pt for each row fully correct. Part Plant Animal
More informationSupplementary Figure 1
Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains
More informations -1 (A) and (B) 2 s 1 in WT, riq1, and the riq1 mutant complemented by
A 250-2 s -1 B 250-2 s -1 Supplemental Figure 1. The NPQ Phenotype in riq Mutants Was Complemented by Introduction of RIQ Genes. (A) and (B) 2 s 1 in, riq1, and the riq1 mutant complemented by the RIQ1
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Stelter et al., http://www.jcb.org/cgi/content/full/jcb.201105042/dc1 S1 Figure S1. Dyn2 recruitment to edid-labeled FG domain Nups.
More informationSupplementary Materials
Supplementary Materials Figure S1. MTT Cell viability assay. To measure the cytotoxic potential of the oxidative treatment, the MTT [3-(4,5-dimethylthiazol- 2-yl)-2,5-diphenyl tetrazolium bromide] assay
More informationERK1/2/MAPK pathway-dependent regulation of the telomeric factor TRF2
ERK1/2/MAPK pathway-dependent regulation of the telomeric factor TRF2 SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Conservation of the D domain throughout evolution. Alignment of TRF2 sequences
More information