Immunological characterization of a recombinant tropomyosin from a new indoor source, Lepisma saccharina
|
|
- Cuthbert Hunter
- 6 years ago
- Views:
Transcription
1 Clin Exp Allergy ; 35: doi:1.1111/j x Immunological characterization of a recombinant tropomyosin from a new indoor source, Lepisma saccharina B. Barletta*, C. Butteroni*, E. M. R. Puggioni*, P. Iacovacci*, C. Afferni*, R. Tinghino*, R. Arianow, R. C. Panzaniz, C. Pini* and G. Di Felice* *Department of Infectious, Parasitic and Immune-mediated Diseases, Istituto Superiore di Sanita`, Rome, Italy, wusl 1 Imperiese, Department Allergology, Bordighera (IM), Italy and zcentre de Recherche en Allergologie, Marseille, France Summary Background The presence of specific IgE antibodies to invertebrates is common among patients with rhinitis and asthma. Tropomyosin has been described as an invertebrate cross-reactive allergen. We have recently characterized an allergenic extract from silverfish (Lepisma saccharina). Since this insect could be a new source of tropomyosin in the indoor environment, we have thought important to clone and characterize the tropomyosin from it. Methods Recombinant tropomyosin was cloned and characterized by means of immunoblotting with tropomyosin-specific monoclonal antibodies, rabbit polyclonal antibodies and IgE from allergic patients. Its allergenic activity was investigated in histamine release assays. Immunoblotting and ELISA inhibition were carried out to identify the natural tropomyosin in the silverfish extract and to study the cross-reactivity among other arthropod tropomyosins. Results Tropomyosin-specific antibodies recognized in immunoblotting the natural tropomyosin in the insoluble fraction of silverfish extract. The silverfish tropomyosin (Lep s 1) was cloned and fully expressed. It shared high homology with other arthropod tropomyosins. rlep s 1 was recognized by tropomyosin-specific monoclonal and polyclonal antibodies and by IgE of allergic patients. It was able to inhibit the IgE binding to the insoluble fraction of silverfish extract, and to induce histamine release by an arthropod-allergic serum. Inhibition experiments revealed IgE cross-reactivity between rlep s 1 and other arthropod tropomyosins. Conclusion rlep s 1 is the first allergen cloned and characterized from silverfish extract. It enabled us to identify the natural counterpart in the insoluble fraction of silverfish extract, suggesting that the tropomyosin is not readily extractable with a classic aqueous extraction procedure. rlep s 1 displayed biological activity, suggesting that it could be regarded as a useful tool to study the role of silverfish tropomyosin in the sensitization to invertebrate allergic sources. Keywords insect allergy, silverfish, tropomyosin Submitted 3 May 24; revised 26 July 24; accepted 2 December 24 Introduction Insects represent about 8% of all animal kingdom, since more than one million of species are known and this number increases day by day with the progress of the entomological research. Many groups of insects have been identified as environmental triggers for asthma [1, 2]. Exposure can occur indoor or outdoor and in occupational or nonoccupational settings. During the last decades, insects other than those already known as allergenic have been investigated for their potential role in inducing and triggering IgE immune response [3]. Among these, the silverfish, an insect belonging to the Thysanura order, appeared of particular interest [4]. In Correspondence: Bianca Barletta, Department of Infectious, Parasitic and Immunomediated Diseases, Istituto Superiore di Sanita`, Rome, Italy. Viale Regina Elena, Rome, Italy. barletta@iss.it spite of its antiquity, silverfish has succeeded in exploiting the new opportunity created by man. In southern Europe and in some regions of Asia these insects live out in the open, under stones and in crevices, but elsewhere they are almost exclusively associated with human houses, stables, outhouses and so on. Silverfish is not easily seen by dwellers because it is nocturnal and can run very swiftly. However, it is considered a pest, or at least a nuisance, by homeowners. These insects prefer vegetable matter with a high carbohydrate and protein content. However, when living indoors they will feed on almost anything. A partial list includes flour, starch, paper, gum, glue, cotton, linen, rayon, silk, sugar, moulds, dried beef and breakfast cereals. Recently, we have prepared and characterized a silverfish extract and our findings indicated that classic aqueous extraction procedure could be not completely satisfactory, since important allergenic components are lost at a ph close to neutrality. In fact, we found an allergenic component with r Blackwell Publishing Ltd 483
2 484 B. Barletta et al. MW of kda, presents only in the insoluble material, which is normally discarded. This component was recognized by out out of the 19 sera (21%) reactive in IgE immunoblotting to silverfish extract [4]. Some evidences suggested that such component could be silverfish tropomyosin [4]. Tropomyosin has been recognized as a cross-reactive inhalant/food allergen, and its pivotal role in cross-reactivity between foods and aeroallergens of animal origin has been described [5 11]. The aim of the present paper was to identify and characterize an important allergenic component represented in the insoluble fraction of silverfish extract, starting from the finding that tropomyosin specific antibodies recognized a component of kda in this fraction. This issue has been addressed by the molecular cloning and the characterization of tropomyosin from silverfish. In fact, we have identified its natural counterpart in the insoluble fraction of the extract. Moreover, we evaluated the biological activity of recombinant silverfish tropomyosin by means of histamine release assay and carried out studies on the cross-reactivity among invertebrate tropomyosins. Materials and Methods Antisera Human sera Since a diagnostic preparation of Lepisma saccharina was not available, 133 patients allergic to arthropods were selected on the basis of clinical history, skin prick test (SPT) and RAST reactivity. The panel of allergens used in SPT included shrimp, house fly, household insects, mosquito, cockroach, spider and mites (Dermatophagoides pteronyssinus or D. farinae), whereas RAST analysis was performed by using shrimp, mosquito, cockroach and mites (D. pteronyssinus or D. farinae). Nine out of these 133 sera were selected for their IgE reactivity in immunoblotting to a diffuse component with a MW of kd present in the insoluble fraction of silverfish extract, identified in our previous paper [4] as natural silverfish tropomyosin. Clinical features of these nine patients are reported in Table 1. The three sera showing the highest immunoblotting reactivity (sera n. 1 3) were chosen for the characterization of recombinant silverfish tropomyosin. Serum from one nonatopic subject was used as control. Informed consent was obtained from all subjects. Rabbit antisera One New Zealand rabbit was immunized three times at 2-week intervals with shrimp tropomyosin, purified according to the method of Smillie [12], by intramuscular injection of 1 2 mg of protein dissolved in.5 ml phosphate-buffered saline (PBS) and mixed with an equal volume of Freund s adjuvant. Serum was aliquoted and stored at 2 1C until use. The animal was maintained in the Animal Care Unit of the Istituto Superiore di Sanità according to the local guidelines for animal care. Monoclonal antibody Monoclonal antibody 1A/6 specific to D. pteronyssinus tropomyosin, and able to recognize also other arthropod tropomyosins [5, 8], was kindly supplied by Prof. Aalberse. Sodium dodecylsulfate-polyacrilamide gel electrophoresis and immunoblotting The silverfish extract was prepared according to Barletta et al. [4], and two fractions were obtained and named Ppt and Sup. SDS-PAGE and immunoblotting were carried out as previously described [13, 14] in 15% poliacrylamide gels. The blotted nitrocellulose strips were incubated at room temperature overnight (o. n.) with either individual human sera diluted 1 : 1 in PBS-Tween, or 1 h with the monoclonal antibody 1A/6 diluted 1 : 2 or 1 h with the rabbit polyclonal antibody diluted 1 : 1. The strips were developed with either 1 I-labelled anti-human IgE (Bioallergy, Rome, Italy), or peroxidase-labelled goat anti-mouse IgG (Bio-Rad, Richmond, CA) or peroxidase-labelled goat anti-rabbit IgG (Bio-Rad). Molecular cloning of tropomyosin Total RNA was isolated from adult insect bodies by using RNAzolTM B (BiothechItalia, Rome, Italy), in a ratio of 2 ml/mg of insect according to the Manufacturer s instructions. cdna was amplified from 5 mg of total RNA by using the Takara PCR synthesis kit (Takara Biochemical Inc., Berkeley, CA). Degenerated oligodeoxynucleotide primers for cdna amplification were designed as already described by Asturias et al. [9]. Trop 1: 5 -CTGGATCCATGGA(G/T) GC(C/T)ATCAAGAA(A/G)AA (sense primer) and trop 2: 5 -GGCCGAATTCT(T/C)A(A/G)TA(G/A/T)ACCAG(T/ A/C)(A/C)A(G/A)(T/C)TCGG (antisense primer), restriction sites are underlined. The PCR was carried out in the following conditions: after denaturation at 94 1C for 7 min, the sample was subjected to five cycles at 94 1C for 1 min, 42 1C for 1 min, 72 1C for 1 min, followed by 3 cycles at 94 1C for 1 min, 58 1C for 1 min, 72 1C 1 min, and a final step at 72 1C for 1 min. A product of about 85 bp was obtained and cloned in pbsii KS (Stratagene, La Jolla, CA). Several clones were obtained and some of the positive ones underwent sequence analysis. Expression and purification of recombinant tropomyosin One of the tropomyosin-encoding cdna was cloned into p-gex-6p to obtain a recombinant Lep s 1 (rlep s 1) as a Table 1. Clinical symptoms, positive skin prick test (SPT) and positive RAST in patients recognizing natural and recombinant silverfish tropomyosin Clinical symptoms Positive SPT* Positive RASTw Serum n. 1 Asthma SH, HF, MO, MI SH, CO, MO, MI Serum n. 2 Asthma CO, HF SH, CO, MO, MI Serum n. 3 Allergic rhinitis SH SH, CO, MO, MI Serum n. 4 Asthma HF, CO, SP ND Serum n. 5 Asthma HF, HI ND Serum n. 6 Asthma SH, MO, MI SH, MO, MI Serum n. 7 Allergic rhinitis SH, MO SH, MO Serum n. 8 Allergic rhinitis SH, MO, MI SH, MO, MI Serum n. 9 Allergic rhinitis SH, MO, MI SH, MO, MI *Panel of allergens used in SPT: SH, shrimp; HF, house fly; HI, household insects; MO, mosquito; CO, cockroach; MI, mites (Dermatophagoides pteronyssinus or D. farinae); SP, spider. wpanel of allergens used in RAST: SH, shrimp; MO, mosquito; CO, cockroach; MI, mites (D. pteronyssinus or D. farinae); ND, not determined.
3 Recombinant silverfish tropomyosin 485 fusion protein to GST. The expression of rleps 1 was obtained in E. coli BL 21 bacterial strain. Bacteria were grown in Luria Bertami media with 2 mg/ml of ampicillin at 37 1C up to OD6.6 when.5 mm IPTG was added and the cells were harvested after 2 h by centrifugation. The pellet was resuspended in phosphate buffer (ph 8) containing 1 mg/ml lysozyme, 5 ml Triton X-1, 1 U/mL DNAse, 1 mg/ml RNAse, incubated for 1 min on ice and lysed by sonication. The recombinant molecule was purified on a glutathione Sepharose 4B column (Amersham Pharmacia Biotec, Uppsala, Sweden) according to the Manufacturer s instructions and was recovered from the resin after an oncolumn cleavage with 8 U of PreScission Protease (Amersham Pharmacia Biotec) for ml of washed glutathione Sepharose bed volume, o. n. at 4 1C. The purity of the protein was tested by SDS-PAGE gel and the protein concentration by method of Bradford [15]. rleps 1 was aliquoted and stored to 2 1C until use. Nucleotide and protein sequencing analysis Nucleotide sequences were determined using ABI PRISM Dye Terminator Cycle Sequencing Ready reaction kit and run on ABI 31 DNA sequencer. The analysis of the sequences was achieved using the BLAST program. The deduced protein sequence and its analysis were performed by PROSITE database [16]. The alignment of Lep s 1 sequence and homologous protein sequences from other species was obtained by Clustal W (1.74 and 1.81) program. Immunoblotting inhibition Inhibition was carried out as previously described [14]. Inhibition of specific IgE binding on blotted insoluble fraction of silverfish extract (Ppt) was performed by preincubating serum n. 1 diluted 1 : 1 with increasing concentrations (2 and 5 mg/ml) of recombinant rlep s 1. were used as inhibitors. Amount of inhibitors ranged from 1 to.64 mg protein/ml. Results Identification of natural tropomyosin in the silverfish extract To better identify the IgE reactivity of silverfish extract components not readily extractable in classical aqueous buffer, three human sera reactive to the kda component only in IgE-immunoblotting were selected. Figure 1a shows the IgE reactivity of one representative serum to the two fractions of silverfish extract. A restricted reactivity to the kda component of the insoluble fraction was detected and no bands of reactivity were found in aqueous fraction. The monoclonal antibody 1A6, specific for mite tropomyosin, reacted with the insoluble fraction only, where it was able to identify a component of kda (Fig. 1b). The reactivity of rabbit antibody specific for the natural purified shrimp tropomyosin, confirmed the presence of tropomyosin in the insoluble fraction of the silverfish extract (Fig. 1c). Molecular cloning, expression, purification and characterization of tropomyosin Using two degenerated primers, already employed for the cloning of American Cockroach tropomyosin [9], the cdna of Lep s 1 was obtained. The cdna nucleotide sequence corresponds to a 855 bp open reading frame (EMBL accession number: AJ3922). The analysis of the sequence by BLAST showed the higher homology with tropomyosins from Homarus americanus (69%). The cdna encoded for a protein of 284 aa designed rlep s 1 with an estimated molecular mass of 32.4 kda and a pi of 4.88 The analysis of the protein sequence showed one potential N-linked glycosy- Histamine release assay from passively sensitized basophils The histamine release assay was performed as reported by Iacovacci et al. [17]. One representative serum out of tropomyosin-positive patients (serum n. 2) and one control serum, both diluted 1 : 2, were used in this test. Histamine release from the passively sensitized basophils was measured by using the Immunotech Pharmaceuticals kit (San Diego, CA), according to the Manufacturer s instructions. The rlep s 1 was used in the test at the final concentrations of 1, 1,.1 and.1 mg/ml (a) (b) (c) ELISA inhibition ELISA inhibition experiments were carried out essentially as reported in Barletta et al. [14]. The amount of rlep s 1 coated on the ELISA plates (polystyrene microtitre, Greiner, Frickenhausen, Germany) was.1 mg/ml. Human sera were diluted 1 : 1 or 1 : 5 in PBS-Tween 2% and 1% wt/vol gelatin. Recombinant tropomyosins from D. pteronyssinus and Periplaneta americana, rder p 1 and rper a 7, respectively, purchased from BIAL (Bilbao, Spain) and natural shrimp tropomyosin, purified according to the method of Smillie [12], Ppt Sup Ppt Sup Ppt Sup Fig. 1. Two fractions of silverfish, aqueous (Sup) and insoluble (Ppt), were probed in immunoblotting with a representative allergic serum (a), monoclonal antibody 1A6 (b) and anti shrimp tropomyosin rabbit antiserum (c).
4 486 B. Barletta et al. Lep s 1 MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT D. mel. *D****************I****TC*N**K***SR***LN***R**E**FV*****LV*A Hom a 1 *D******************R**T**Q*NKE**IR*E*TE**IRITH**MQ***NELDQV Per a 7 *D******************C*LLC*Q******LR*E*AE**ARS*Q**IQ*I*N*LDQ* Der p 1 *E***N************I*R*EIA*QK*****LR*E*SE***RA*Q**IQ*I*NELDQV Lep s 1 KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA D. mel **Q*EK**TE**E***L**A******TQ*****Q***D**K****ST**QQ**L**TQS* Hom a 1 Q*Q*SL**TK**E***A*Q*A*G***A***RI*LL**D********N**T***A***QA* Per a 7 M*Q*MQV*AK*DE*D*A*Q*A*****A***RI*LL**D********A**TA**A***QAV Der p 1 Q*Q*SA**TK**E***A*QTA*GD**A***RI*LI**D********KI*TA**E***QS* E3 E6 E2 Lep s 1 DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE D. mel **NN***********************************T********L*F***E***** Hom a 1 **SE**R*******LS******A*E*******F***E**R*Y***A**L*M**A***R** Per a 7 **SE*AR*I**SKGLA******A*E*******FM**E**K*Y***A**L*M**A***R** Der p 1 **SE**R*M**H**IT*****EG*E********M*****R*Y***A**L*M**A***R** Lep s 1 DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE D. mel ******E*********************************F**EM***SI******Q*** Hom a 1 E*AET*E***V******R****N**************E*A**E*****AN***A****** Per a 7 E*AE**E***V******R****N************L*E****Q******TR********* Der p 1 E*AET*E***V******R****N***********Q**E*AHEQ**RIM*T********** E4 Lep s 1 YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY [1%] D. mel ***Q**R**********R*FNE*EK*K*IC*DL*******T** [ 76%] Hom a 1 F**RS*Q*************VNE*EK*KSIT**L****S***** [ 67%] Per a 7 F**RS*Q*************VHE*EK*KFIC*DL*M**T**A** [ 65%] Der p 1 F**RS*Q******G******VHE*EK*KSIS**L*******T** [ 64%] Fig. 2. Sequence alignment of rlep s 1 with other tropomyosins: Lep s 1 (Lepisma saccharina, CAC8459), Drosophila melanogaster (P9491), Hom a 1 (Homarus americanus, O44119), Per a 7 (Periplaneta americana, Q9UB83),Derp1(Dermatophagoides pteronissinus, O18416). The percentage of each sequence homology is given in parentheses. Regions corresponding to the four IgE-binding epitopes identified on Penaeus aztecus tropomyosin (E2, E3, E4, E6) are marked in grey Fig. 3. SDS-PAGE and Immunoblotting analysis of rlep s 1 detected with Coomassie Brilliant Blue staining (lane 1) and incubated with three allergic human sera selected for following experiments (lanes 2 4), a nonatopic human serum (lane 5), mouse monoclonal antibody 1A6 (lane 6), and antishrimp tropomyosin rabbit serum (lane 7). lation site (NRSQ ). Both the EAIKKK N-terminal motif and the LKEAExRAE signature sequences, highly conserved in tropomyosin molecules, were present in rlep s 1. Search of protein sequence similarity revealed the highest degree of homology with tropomyosin from Drosophila melanogaster (74%) (Fig. 2). The sequences of the IgE reactive epitopes E2 (RKLAMVEADLERA ), E Fig. 4. Immunoblotting inhibition pattern of IgE binding to insoluble fraction of silverfish extract (Ppt) inhibited with 5 and 2 mg/ml of recombinant tropomyosin, rlep s 1 (lanes 1 2), no inhibitor added (lane 3). (SDEERMDALENQ ), E4 (NEKEKYKSIT- DELDQTFSELS 2 272), and E6 (EADRKYDEVARKL
5 Recombinant silverfish tropomyosin ), obtained from Penaeus aztecus tropomyosin [18], showed a degree of identity of 69%, 76%, 52% and 61%, respectively, to the corresponding regions identified on the rlep s 1 sequence. The cdna obtained was cloned into p-gex-6p expression vector. The MW of the purified recombinant protein was about 36 kda, as calculated by Rf analysis after SDS-PAGE (Fig. 3 lane 1). The yield of the purified protein was 2 mg/l of bacterial culture, as measured by the Bradford assay [15]. To evaluate the IgE reactivity of the recombinant molecule, the three human sera recognising the above described component Histamine release (%) Allergen: rlep s 1 Serum n Amount of allergen (µg/ml) Fig. 5. Basophil histamine release tests performed with IgE from serum n. 2 Dose-related release curves obtained after stimulation with rlep s 1. Allergen was used at concentration of 1, 1,.1 and.1 mg/ml. of kda were tested in immunoblotting (Fig. 3, lanes 2 4). All sera recognized the recombinant tropomyosin. The recombinant molecule did not react with a nonallergic human sera used as negative control (Fig. 3, lane 5). Specific IgE did not recognize notinduced cell lysate (data not shown). The monoclonal antibody specific to mite tropomyosin and the rabbit serum, raised against shrimp tropomyosin, recognized rlep s 1 (Fig. 3, lanes 6 and 7). Inhibition of specific IgE binding to insoluble fraction of silverfish extract To further elucidate whether the natural counterpart of rlep s 1 was really present in the insoluble fraction of silverfish extract, IgE immunoblotting inhibition experiments were carried out with serum n. 1 (Fig. 4). rlep s 1 was able to inhibit the IgE binding to the blotted insoluble fraction at a concentration of 5 mg/ml, confirming that the natural tropomyosin corresponds to the allergenic component with MW of kda identified in the insoluble fraction. Histamine release from basophils The allergenic activity of recombinant tropomyosin was demonstrated by the histamine release assay, using basophils from a nonatopic donor passively sensitized with IgE from one representative allergic patient (serum n. 2). The doserelated release curve obtained after stimulation with rlep s 1 is shown in Fig. 5. Specific IgE induced a histamine release up to 54% at the highest amount of allergen. Serum from one nonatopic subject, used as negative control, did not induce (a) 1 ELISA inhibition Antigen: rlep s 1 Serum n. 1 Serum n. 2 Serum n. 3 Inhibitor: rper a 7 (b) Inhibitor: rder p % of inhibition (c) Inhibitor: shrimp tropomyosin (d) Inhibitor: rlep s Amount of inhibitor (µg/ml) Fig. 6. ELISA inhibition of serum n. 1 (diamond), serum n. 2 (circle) and serum n. 3 (triangle) against rlep s 1 with rper a 7 (panel a), rder p 1 (panel b), purified shrimp tropomyosin (panel c) and rlep s 1 (panel d) as inhibitors.
6 488 B. Barletta et al. histamine release when tested with the highest allergen amount (data not shown). Cross-reactivity among tropomyosins from different allergenic sources The presence on the recombinant tropomyosin of crossreactive IgE epitopes with tropomyosins from different sources was studied by ELISA inhibition assays, performed with the three sera positive to silverfish tropomyosin (Fig. 6). The results were expressed as percent inhibition of the total specific binding. As shown in Fig. 6, recombinant tropomyosins from P. Americana (Per a 7) (Fig. 6a), and D. pteronissinus (Der p 1) (Fig. 6b) as well as natural shrimp tropomyosin (Fig. 6c), were able to inhibit IgE binding to recombinant silverfish tropomyosin up to %, 89% and 99%, respectively, at the highest inhibitor concentration tested. IgE reactivity of the three patients shows similar inhibition curves. Discussion Although previous studies demonstrated that house dust contains significant silverfish antigens [19], and reported that silverfish could be regarded as a significant source of many allergenic components [4], a commercial silverfish extract is not available so far. In a previous study, we have prepared and characterized a silverfish extract and investigated the IgE reactivity of its components [4]. An evaluation of IgE reactivity indicated a proportion of sera (21%) recognising a diffuse and intense component with MW of kda, present in the insoluble fraction of silverfish extract only. Results obtained suggested that such component could be the silverfish tropomyosin that could be missed with a classic aqueous extraction. This finding suggests that a dedicated extraction procedure may be needed for some insect sources, since tropomyosin does not appear to be readily extractable in classic aqueous buffer. Because of common features between silverfish and other insects, this last issue could be extended to all allergenic extract preparations from insect sources, since lack of important allergenic components in an extract could affect several aspects, such as exposure assessment, diagnosis sensitivity and therapy efficacy. To further investigate this important aspect, in the present paper we have analysed the two fractions of the silverfish extract in immunoblotting developed with monoclonal and polyclonal antibodies raised against mite and shrimp tropomyosin, respectively. The use of these specific antibodies allowed us to identify the tropomyosin in a new allergenic source present in indoor environment that could give a possible contribution to increase tropomyosin indoor levels. This is in line with that previously evidenced by other authors reporting that some dust samples have too high concentration of tropomyosin if compared with mite presence, indicating the contribution of additional tropomyosin sources other than mites [19]. Tropomyosin belongs to a family of highly conserved proteins, some of which have allergenic activity. In fact, in contrast to vertebrate tropomyosins, invertebrate tropomyosins have been demonstrated to be allergenic [11]. Molecular cloning of tropomyosin from different sources could provide useful tools to investigate their allergenicity. To this aim, we have cloned and characterized a silverfish tropomyosin, named rlep s 1, by means of immunoblotting with specific tropomyosin antibodies and IgE from crustacean-and house insect-allergic patients. The nucleotide sequence shows 69% of homology with tropomyosin from Homarus americanus, and the deduced amino-acid sequence shows the highest degree of homology with tropomyosin from Drosophila melanogaster. Moreover, a significant homology with the IgE-binding epitopes E2, E3, E4, E6 described on P. aztecus tropomyosin by Reese et al. [18] has been found in the corresponding regions identified in the Lep s 1 sequence. These significant homologies found within regions identified as critical for IgE-binding could contribute to the wide crossreactivity among tropomyosins from different sources. rlep s 1 is able to inhibit the IgE binding to the insoluble fraction of silverfish extract suggesting that the IgE epitopes are shared by recombinant and natural tropomyosin. A strong IgE crossreactivity among inhalant and edible invertebrates allergenic sources, because of tropomyosin molecule, has been extensively investigated also at level of IgE epitopes [2]. In order to investigate whether silverfish tropomyosin shared IgE epitopes with tropomyosins from other sources, ELISA inhibitions were performed. Tropomyosins from three arthropod sources were used as inhibitors and three human sera from patients allergic to arthropods were selected as IgE sources. The highest inhibiting capacity is displayed by natural shrimp tropomyosin; this result could be because of the fact that the purified preparation contains a wide range of isoforms. However, significant inhibition of IgE binding to rlep s 1 was also obtained with rper a 7 and rder p 1, suggesting that IgE crossreactive epitopes shared by tropomyosins from different sources were represented on the rlep s 1 molecule. Interestingly, when we used the homologous inhibitor rlep s 1 we found different behaviours by the three sera. These differences could reflect different causes of primary sensitization. In fact, serum n. 3, which is unable to reach plateau inhibition, was selected on the basis of SPT reactivity to shrimp allergens only (Table 1). This widespread cross-reactivity may result in clinical consequences. In fact, several studies indicate that the exposure and sensitization to a particular food allergen may ultimately lead to sensitization to certain aeroallergens [5] and vice versa [21, 22]. Several authors have attempted to identify the primary source and consequently the initial route of sensitization (ingestion or inhalation) by means of inhibition experiments. Recently, an interesting study has indirectly suggested that sensitization to shrimp tropomyosin could occur by inhalation route, on the basis of the observation of a group of Ortodox Jews who strictly observe Kosher dietary laws that prohibit eating shellfish, so excluding the exposure by ingestion route [23]. It was also suggested that immunotherapy for house dust mite allergy may lead to sensitization to cross-reacting seafood tropomyosin [21, 24], adding a possible third sensitization route involved in tropomyosin sensitization. We have evaluated the capability of rlep s 1 to trigger histamine release from basophils passively sensitized with a
7 Recombinant silverfish tropomyosin 489 representative insect allergic patient. The results obtained demonstrated that rlep s 1 was able to induce histamine release up to 54%, confirming its allergen activity. In conclusion, Lep s 1 represents the first allergen identified in silverfish extract or rather in its insoluble fraction that, in a standard extraction procedure, is normally discarded. Recombinant silverfish tropomyosin, rlep s 1, can be regarded as an allergenic molecule cross-reactive with tropomyosins from inhalant and food sources. Moreover, since tropomyosin molecules can elicits hypersensitivity reactions by sensitising through three different routes [inhalation, ingestion and parenteral administration], rlep s 1 could be an useful tool to evaluate the role that the sensitization route plays in the development of allergy disease. Acknowledgements We thank Dr A. Orlandi for her helpful assistance and Prof. R.C. Aalberse of Central Laboratory of the Netherlands Red Cross Blood Transfusion Service, for providing monoclonal antibody 1A6 specific to D. pteronyssinus tropomyosin. References 1 Panzani RC. Inhalant allergy to arthropods (to the exclusion of mites] (PartI]. Allergol et Immunopathol 1994; 22: Panzani RC. Inhalant allergy to arthropods (to the exclusion of mites) (Part II). Allergol et Immunopathol 1994; 22: Baldo BA, Panzani RC. Detection of IgE antibodies to a wide range of insect species in subjects with suspected inhalant allergies to insects. Int Archs Allergy Appl Immun 1988; 85: Barletta B, Puggioni EMR, Afferni C et al. Preparation and characterization of silverfish (Lepisma saccarina) extract and identification of allergenic components. Int Arch Allergy Immunol 22; 128: Witteman AM, Akkerdaas JH, van Leeuwen J, van der Zee J, Aalberse RC. Identification of a cross-reactive allergen (presumably tropomyosin] in shrimp, mite and insects. In Arch Allergy Immunol 1994; 15: Leung PSC, Chow WK, Duffey A, Kwan HS, Gershwin E, Chu KH. IgE reactivity against a cross-reactive allergen in crustacea and mollusca: evidence for tropomyosin as the common allergen. J Allergy Clin Immunol 1996; 98: Martinez A, Martinez J, Palacios R, Panzani R. Importance of tropomyosin in the allergy to household arthropods. Crossreactivity with other invertebrate extracts. Allergol et Immunopathol 1997; : Santos ABR, Chapman MD, Aaalberse RC et al. Cockroach allergens and asthma in Brazil: identification of tropomyosin as a major allergen with potential cross-reactivity with mite and shrimp allergens. J Allergy Clin Immunol 1999; 14: Asturias JA, Go` mez-bayòn N, Arilla MC et al. Molecular characterization of american cockroach tropomyosin (Periplaneta americana Allergen 7), a cross-reactive allergen. J Immunol 1999; 162: Sidenius KE, Hallas TE, Poulsen LK, Mosbech H. Allergen crossreactivity between house-dust mites and other invertebrates. Allergy 21; 56: Reese G, Ayuso R, Leher SB. Tropomyosin: an invertebrate panallergen. Int Arch Allergy Immunol 1999; 119: Smillie LB. Preparation and identification of a- and b-tropomyosins. Methods Enzymol 1982; 85: Di Felice G, Caiaffa MF, Bariletto G et al. Allergens of Arizona cypress (Cupressus arizonica) pollen: Characterization of the pollen extract and identification of the allergenic components. J Allergy Clin Immunol 1994; 94: Barletta B, Afferni C, Tinghino R, Mari A, Di Felice G, Pini C. Cross-reactivity between Cupressus arizonica and Cupressus sempervirens pollen extract. J Allergy Clin Immunol 1996; 98: Bradford MM. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Annal Biochem 1976; 72: Bairoch A, Bucher P, Hofmann K. The PROSITE database, its status in Nucl Acids Res 1997; : Iacovacci P, Afferni C, Butteroni C et al. Comparison between the native glycosylated and recombinant Cup a 1 allergen: role of carbohydrates in the histamine release from basophils. Clin Exp Allergy 22; 32: Reese G, Jeung BJ, Daul CB, Lehrer SB. Characterization of recombinant shrimp allergen Pen a 1 (tropomyosin). Int Arch Allergy Immunol 1997; 113: Witteman AM, Voorneman R, van den Oudenrijn S et al. Silverfish protein in house dust in relation to mite and total arthropod level. Clin Exp Allergy 1996; 26: Ayuso R, Reese G, Leong-Kee S, Plante M, Lehrer SB. Molecular basis of arthropod cross-reactivity: IgE-binding cross-reactive epitopes of shrimp, hose dust mite and cockroach tropomyosins. Int Arch Allergy Immunol 22; 129: Van Ree R, Antonicelli L, Akkrdaas JH, Garritani MS, Aalberse RC, Bonifazi F. Possible induction of food allergy during mite immunotherapy. Allergy 1996; 51: De Maat-Bleeker F, Akkerdaas JH, van Ree R, Aaalberse RC. Vineyard snail allergy possibly induced by sensitization to house-dust mite (Dermatophagoides farinae]. Allergy 1995; 5: Fernandes J, Reshef A, Patton L, Ayuso R, Reese G, Lehrer. Immunoglobulin E antibody reactivity to the major shrimp allergen, tropomyosin, in unexposed Ortodox Jews. Clin Exp Allergy 23; 33: Pajno GB, La Grutta S, Barberio G, Canonica GW, Passalacqua G. Harmful effect of immunotherapy in children with combined snail and mite allergy. J Allergy Clin Immunol 22; 19:627 9.
Sensitisation to Lepisma saccharina (silverfish) in children with respiratory allergy
Sensitisation to Lepisma saccharina (silverfish) in children with respiratory allergy M. Boquete a, F. Pineda b, A. Mazon c, A. Garcia a, F. Oliver c, N. Colomer c, R. Pamies c, C. Millan d, C. Millan
More informationDetermination of Storage Conditions for Shrimp Extracts: Analysis of Specific IgE-Allergen Profiles
ASIAN PACIFIC JOURNAL OF ALLERGY AND IMMUNOLOGY (2010) 28: 47-52 Determination of Storage Conditions for Shrimp Extracts: Analysis of Specific IgE-Allergen Profiles Surapon Piboonpocanun 1, Siribangon
More informationCONTENTS. STUDY DESIGN METHODS ELISA protocol for quantitation of mite (Dermatophagoides spp.) Der p 1 or Der f 1
CONTENTS STUDY DESIGN METHODS ELISA protocol for quantitation of mite (Dermatophagoides spp.) Der p 1 or Der f 1 ELISA protocol for mite (Dermatophagoides spp.) Group 2 ALLERGENS RESULTS (SUMMARY) TABLE
More informationThe Allergens of Cladosporium herbarum and Alternaria alternata
Breitenbach M, Crameri R, Lehrer SB (eds): Fungal Allergy and Pathogenicity. Chem Immunol. Basel, Karger, 2002, vol 81, pp 48 72 The Allergens of Cladosporium herbarum and Alternaria alternata Michael
More informationMouse Anti-HDM IgG Antibody Assay Kit
Mouse Anti-HDM IgG Antibody Assay Kit Catalog # 3030 For Research Use Only - Not Human or Therapeutic Use INTRODUCTION Asthma is a common chronic inflammatory disease that affects 300 million people of
More informationShort Comm. ISOLATION AND CHARACTERIZATION OF TROPOMYOSIN FROM MACROBRACHIUM ROSENBERGII (GIANT FRESHWATER PRAWN) 50588, Kuala Lumpur, Malaysia
International Journal of Science, Environment and Technology, Vol. 5, No 2, 2016, 717 721 ISSN 2278-3687 (O) 2277-663X (P) Short Comm. ISOLATION AND CHARACTERIZATION OF TROPOMYOSIN FROM MACROBRACHIUM ROSENBERGII
More informationCOMPLEXITY OF MOLD ALLERGIES ACAAI Presentation # P175
2004 ACAAI Presentation # P175 MOLD EXTRACT COMPARABILITY, STABILITY AND COMPATIBILITY : COMPOSITIONAL AND IMMUNOCHEMICAL INVESTIGATIONS Thomas J. Grier, Ph.D. Dawn M. LeFevre, B.S. Elizabeth A. Duncan,
More informationMouse Serum Anti-HDM IgE Antibody Assay Kit
Mouse Serum Anti-HDM IgE Antibody Assay Kit Catalog # 3037 For Research Use Only - Not Human or Therapeutic Use INTRODUCTION Asthma is a common chronic inflammatory disease that affects 300 million people
More informationMouse Anti-OVA IgM Antibody Assay Kit
Mouse Anti-OVA IgM Antibody Assay Kit Catalog # 3017 For Research Use Only - Not Human or Therapeutic Use INTRODUCTION Ovalbumin (OVA) is a widely used antigen for inducing allergic reactions in experimental
More informationImproved Diagnosis of the Polysensitized Allergic Rhinitis Patients Using Component Resolved Diagnosis Method
BRIEF COMMUNICATIONS Iran J Allergy Asthma Immunol April 2016; 15(2):156-160. Improved Diagnosis of the Polysensitized Allergic Rhinitis Patients Using Component Resolved Diagnosis Method Zailatul Hani
More informationInsects as a Potential Food Allergens. Phil Johnson
Insects as a Potential Food Allergens Phil Johnson Overview Food Allergy Cross-reactivity Current evidence for cross-reactivity Opinions on handling food insects as allergens Gaps in our knowledge Cross-reactivity:
More informationCross-reactivity between Cupressus arizonica and Cupressus sempervirens pollen extracts
Cross-reactivity between Cupressus arizonica and Cupressus sempervirens pollen extracts Bianca Barletta, BSc, Claudia Afferni, BSc, Raffaella Tinghino, BSc, Adriano Marl, MD, Gabriella Di Felice, BSc,
More informationHuman Allergen Specific IgE ELISA Kits
Intended Use Human Allergen Specific IgE ELISA Kits These kits are in vitro assays for the qualitative or quantitative detection of allergen-specific IgE antibodies in human serum. They are intended for
More informationAnti-Lamin B1/LMNB1 Picoband Antibody
Anti-Lamin B1/LMNB1 Picoband Antibody Catalog Number:PB9611 About LMNB1 Lamin-B1 is a protein that in humans is encoded by the LMNB1 gene. The nuclear lamina consists of a two-dimensional matrix of proteins
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding
More informationFood Allergy. Soheila J. Maleki. Food Allergy Research USDA-ARS-Southern Regional Research Center
Food Allergy Soheila J. Maleki Food Allergy Research USDA-ARS-Southern Regional Research Center The prevalence of food allergy has increased and in some cases doubled since 1997: Better diagnosis New cases/increased
More informationDocumentation, Codebook, and Frequencies
Documentation, Codebook, and Frequencies Laboratory Component: Allergen Specific IgE(s) and Total IgE in Serum Survey Years: 2005 to 2006 SAS Export File: AL_IGE_D.XPT First Published: June 2008 Last Revised:
More informationFor the rapid, sensitive and accurate quantification of Ras in various samples
ab128504 Ras Assay Kit Instructions for Use For the rapid, sensitive and accurate quantification of Ras in various samples This product is for research use only and is not intended for diagnostic use.
More informationEstablishment of Two Novel ELISA Methods for Dermatophagoides farinae-specific IgE Detection with Recombinant Group 2 Allergen
392 Establishment of Two Novel ELISA Methods for Dermatophagoides farinae-specific IgE Detection with Recombinant Group 2 Allergen Yubao Cui, Ying Zhou, Guifang Ma, Weihong Shi, Li Yang, and Yungang Wang
More informationAnimal model for testing human Ascaris allergens
J. Biosci., Vol. 3 Number 1, March 1981, pp. 77-82. Printed in India. Animal model for testing human Ascaris allergens KRISHNA MUKERJI*, R. P. SAXENA, S. N. GHATAK and K. C. SAXENA Division of Biochemistry,
More informationTSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet Details
More informationLuminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the
More informationIslet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot
Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter
More informationAperto Cell Lysis and Protein Solubilization Users Manual
Aperto Cell Lysis and Protein Solubilization Users Manual Revision 2 THIS MANUAL APPLIES TO THE FOLLOWING PRODUCTS: 3A8600 Aperto, 5X Cell Lysis Buffer. 20mL 3A8610 Aperto, 5X Cell Lysis Buffer. 100mL
More informationHypersensitivity Reactions and Peanut Component Testing 4/17/ Mayo Foundation for Medical Education and Research. All rights reserved.
1 Hello everyone. My name is Melissa Snyder, and I am the director of the Antibody Immunology Lab at the Mayo Clinic in Rochester, MN. I m so glad you are able to join me for a brief discussion about the
More informationraed a 4: A New 67-kDa Aedes aegypti Mosquito Salivary Allergen for the Diagnosis of Mosquito Allergy
Short Communication Int Arch Allergy Immunol 26;7:26 2 DOI:.59/448587 Received: March 6, 26 Accepted after revision: July 9, 26 Published online: September 8, 26 raed a 4: A New 67-kDa Aedes aegypti Mosquito
More informationJoint FAO/WHO Expert Consultation on Foods Derived from Biotechnology
Food and Agriculture Organization of the United Nations World Health Organization Biotech 01/03 Joint FAO/WHO Expert Consultation on Foods Derived from Biotechnology Headquarters of the Food and Agriculture
More informationChromatin IP (Isw2) Fix soln: 11% formaldehyde, 0.1 M NaCl, 1 mm EDTA, 50 mm Hepes-KOH ph 7.6. Freshly prepared. Do not store in glass bottles.
Chromatin IP (Isw2) 7/01 Toshi last update: 06/15 Reagents Fix soln: 11% formaldehyde, 0.1 M NaCl, 1 mm EDTA, 50 mm Hepes-KOH ph 7.6. Freshly prepared. Do not store in glass bottles. 2.5 M glycine. TBS:
More informationDiscover the connection
Emma is worried about having a systemic reaction, so she avoids all nuts Walnuts FOOD ALLERGY Hazelnuts Peanuts Systemic reactions and underlying proteins Discover the connection ImmunoCAP Complete Allergens
More informationIdentification of Major and Minor Allergens of Black Tiger Prawn (Penaeus monodon) and King Prawn (Penaeus latisulcatus)
Original Article Identification of Major and Minor Allergens of Black Tiger Prawn (Penaeus monodon) and King Prawn (Penaeus latisulcatus) Syuhaidah Sahabudin 1, Rosmilah Misnan 2, Zailatul Hani Mohammad
More informationMouse Total IgA Antibody Detection Kit
Mouse Total IgA Antibody Detection Kit Catalog # 3019 For Research Use Only - Not Human or Therapeutic Use INTRODUCTION The total IgA levels in specimens are often determined in mouse disease models involving
More informationThe use of components in allergy diagnostics. Dr. Sc. E. Van Hoeyveld Laboratory Medicine
The use of components in allergy diagnostics Dr. Sc. Laboratory Medicine Use of components in the clinic Basics of allergen components and their clinical implications I. Allergen component names II. Properties
More informationGeneral Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:
General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems
More informationLe diagnostic de l allergie aux dermatophages: Un défi mondial. Dr.Alain Jacquet Chulalongkorn University Thailand
Le diagnostic de l allergie aux dermatophages: Un défi mondial Dr.Alain Jacquet Chulalongkorn University Thailand Prevalence of asthma symptoms among 13-14 year olds (ISAAC). Thorax 2009;64:476 483 Geographical
More informationIgE Antibody Responses to Recombinant Allergens of Blomia tropicalis and Dermatophagoides pteronyssinus in a Tropical Environment
Research Trends 233 IgE Antibody Responses to Recombinant Allergens of Blomia tropicalis and Dermatophagoides pteronyssinus in a Tropical Environment by Silvia Jiménez, Leonardo Puerta, Dary Mendoza, Kaw
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Nair S, Branagan AR, Liu J, Boddupalli CS, Mistry PK, Dhodapkar
More informationClinical and Molecular Allergy
Clinical and Molecular Allergy BioMed Central Research Skin testing versus radioallergosorbent testing for indoor allergens Birjis Chinoy, Edgar Yee and Sami L Bahna* Open Access Address: Allergy and Immunology
More informationCell Lysis Buffer. Catalog number: AR0103
Cell Lysis Buffer Catalog number: AR0103 Boster s Cell Lysis Buffer is a ready-to-use Western blot related reagent solution used for efficient extraction of total soluble protein in nondenatured state
More informationP O S S I B L E A N A P H Y L A X I S T O M O S Q U I T O B I T E
P O S S I B L E A N A P H Y L A X I S T O M O S Q U I T O B I T E S E A R C H A G A I N Q: 8/25/2014 8 month old female had an allergic reaction to mosquito which possibly caused anaphylaxis. She had hives
More informationIn our outpatient department we routinely test new patients who display respiratory symptoms with the skin prick test (SPT) and the RAST.
False-positive skin prick test responses to commercially available dog dander extracts caused by contamination with house dust mite (Dermatophagoides pteronyssinus) allergens Maurits J. van der Veen, MD,
More informationOxiSelect MDA Adduct ELISA Kit
Revised Protocol Product Manual OxiSelect MDA Adduct ELISA Kit Catalog Number STA-332 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipid peroxidation is a well-defined
More informationOxiSelect HNE-His Adduct ELISA Kit
Product Manual OxiSelect HNE-His Adduct ELISA Kit Catalog Number STA-334 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipid peroxidation is a well-defined mechanism
More informationAllergy overview. Mike Levin Division of Asthma and Allergy Department of Paediatrics University of Cape Town Red Cross Hospital
Allergy overview Mike Levin Division of Asthma and Allergy Department of Paediatrics University of Cape Town Red Cross Hospital Adaptive Immune Responses Adaptive immune responses allow responses against
More informationImproving allergy outcomes. Allergen Component Testing. Jay Weiss Ph.D and Gary Kitos, Ph.D. H.C.L.D.
Improving allergy outcomes Allergen Component Testing Jay Weiss Ph.D and Gary Kitos, Ph.D. H.C.L.D. Allergen Component Testing Allergic disease is an immunologic response to an allergen or allergens that
More informationSkin prick testing: Guidelines for GPs
INDEX Summary Offered testing but where Allergens precautions are taken Skin prick testing Other concerns Caution Skin testing is not useful in these following conditions When skin testing is uninterpretable
More informationCHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000)
CHAPTER 4 RESULTS 4.1 Growth Characterization of C. vulgaris 4.1.1 Optical Density Growth study of Chlorella vulgaris based on optical density at 620 nm (OD 620 ) showed that all three replicates had similar
More informationEpithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive
Online Data Supplement: Epithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive asthma Dan Cheng, Zheng Xue, Lingling Yi, Huimin Shi, Kan Zhang, Xiaorong Huo, Luke R. Bonser,
More informationGrass pollen immunotherapy induces Foxp3 expressing CD4 + CD25 + cells. in the nasal mucosa. Suzana Radulovic MD, Mikila R Jacobson PhD,
Radulovic 1 1 2 3 Grass pollen immunotherapy induces Foxp3 expressing CD4 + CD25 + cells in the nasal mucosa 4 5 6 7 Suzana Radulovic MD, Mikila R Jacobson PhD, Stephen R Durham MD, Kayhan T Nouri-Aria
More informationThe Role of Anti-CCD Antibodies in Grape Allergy Diagnosis
Reports of Biochemistry & Molecular Biology Vol. 1, No. 2, Apr 2013 Original article www.rbmb.net The Role of Anti-CCD Antibodies in Grape Allergy Diagnosis Reza Falak 1, Mojtaba Sankian 2, Hanieh Ketabdar
More informationThe stability of house dust mite allergens in glycerinated extracts
The stability of house dust mite allergens in glycerinated extracts Lyudmila N. Soldatova, PhD, a Elizabeth J. Paupore, BS, a Suzann H. Burk, BA, a Richard W. Pastor, PhD, b and Jay E. Slater, MD a Bethesda,
More informationRayBio KinaseSTAR TM Akt Activity Assay Kit
Activity Assay Kit User Manual Version 1.0 March 13, 2015 RayBio KinaseSTAR TM Akt Activity Kit Protocol (Cat#: 68AT-Akt-S40) RayBiotech, Inc. We Provide You With Excellent Support And Service Tel:(Toll
More informationAllergic potency of recombinant Fel d 1 is reduced by low concentrations of chlorine bleach
Allergic potency of recombinant Fel d 1 is reduced by low concentrations of chlorine bleach Elizabeth Matsui, MD, a Anne Kagey-Sobotka, PhD b,kristin Chichester, MS, b and Peyton A. Eggleston, MD a Baltimore,
More informationMitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit
PROTOCOL Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit DESCRIPTION Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit Sufficient materials
More informationApplication of an immunoproteomic approach to detect anti-profilin antibodies in sera of
Application of an immunoproteomic approach to detect anti-profilin antibodies in sera of Parietaria judaica allergic patients Marilisa Barranca, Simona Fontana, Simona Taverna, Giacomo De Leo and Riccardo
More informationMolecular Allergy Diagnostics Recombinant or native Allergens in Type I Allergy Diagnostics
Molecular Allergy Diagnostics Recombinant or native Allergens in Type I Allergy Diagnostics Dr. Fooke Achterrath Laboratorien GmbH Habichtweg 16 41468 Neuss Germany Tel.: +49 2131 29840 Fax: +49 2131 2984184
More informationMitochondrial DNA Isolation Kit
Mitochondrial DNA Isolation Kit Catalog Number KA0895 50 assays Version: 01 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials
More informationSupplementary data Supplementary Figure 1 Supplementary Figure 2
Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna
More informationProf. Rosangela Marchelli University of Parma WG on Novel Foods NDA Panel ( )
Guidance on Novel Foods Allergenicity Assessment Prof. Rosangela Marchelli University of Parma WG on Novel Foods NDA Panel (2006-2015) Info-Session 06 March 2017 Parma OUTLINE The Guidance Comments made
More informationNew Test ANNOUNCEMENT
March 2003 W New Test ANNOUNCEMENT A Mayo Reference Services Publication Pediatric Allergy Screen
More informationMolecular diagnosis and the Italian Board for ISAC
R E V I E W Eur Ann Allergy Clin Immunol Vol 46, N 2, 68-73, 2014 E. Nettis 1, F. Bonifazi 2, S. Bonini 3, E. Di Leo 1,4, E. Maggi 5, G. Melioli 6, G. Passalacqua 7, G. Senna 8, M. Triggiani 9, A. Vacca
More informationPNGase F Instruction Manual
PNGase F Instruction Manual Catalog Number 170-6883 Bio-Rad Laboratories, 2000 Alfred Nobel Dr., Hercules, CA 94547 4006094 Rev A Table of Contents Section 1 Introduction...1 Section 2 Kit Components and
More informationGladstone Institutes, University of California (UCSF), San Francisco, USA
Fluorescence-linked Antigen Quantification (FLAQ) Assay for Fast Quantification of HIV-1 p24 Gag Marianne Gesner, Mekhala Maiti, Robert Grant and Marielle Cavrois * Gladstone Institutes, University of
More informationIndoor allergens and asthma: Report of the Third International Workshop
Indoor allergens and asthma: Report of the Third International Workshop Thomas A. E. Platts-Mills, MD, PhD, Daniel Vervloet, MD, Wayne R. Thomas, PhD, Robert C. Aalberse, PhD, and Martin D. Chapman, PhD
More informationPhosphate buffered saline (PBS) for washing the cells TE buffer (nuclease-free) ph 7.5 for use with the PrimePCR Reverse Transcription Control Assay
Catalog # Description 172-5080 SingleShot Cell Lysis Kit, 100 x 50 µl reactions 172-5081 SingleShot Cell Lysis Kit, 500 x 50 µl reactions For research purposes only. Introduction The SingleShot Cell Lysis
More informationSupplementary material: Materials and suppliers
Supplementary material: Materials and suppliers Electrophoresis consumables including tris-glycine, acrylamide, SDS buffer and Coomassie Brilliant Blue G-2 dye (CBB) were purchased from Ameresco (Solon,
More informationab65336 Triglyceride Quantification Assay Kit (Colorimetric/ Fluorometric)
Version 10 Last updated 19 December 2017 ab65336 Triglyceride Quantification Assay Kit (Colorimetric/ Fluorometric) For the measurement of triglycerides in various samples. This product is for research
More informationSupplemental Figure 1 ELISA scheme to measure plasma total, mature and furin-cleaved
1 Supplemental Figure Legends Supplemental Figure 1 ELISA scheme to measure plasma total, mature and furin-cleaved PCSK9 concentrations. 4 Plasma mature and furin-cleaved PCSK9s were measured by a sandwich
More informationProduct Contents. 1 Specifications 1 Product Description. 2 Buffer Preparation... 3 Protocol. 3 Ordering Information 4 Related Products..
INSTRUCTION MANUAL Quick-RNA MidiPrep Catalog No. R1056 Highlights 10 minute method for isolating RNA (up to 1 mg) from a wide range of cell types and tissue samples. Clean-Spin column technology allows
More informationFood and Respiratory Allergy in Ghana Insights from population studies among children
Food and Respiratory Allergy in Ghana Insights from population studies among children Abena S. Amoah Parasitology Department, Noguchi Memorial Institute for Medical Research, Accra, Ghana Parasitology
More informationStability and potency of raw and boiled shrimp extracts for skin prick test
Original article Stability and potency of raw and boiled shrimp extracts for skin prick test Wipada Pariyaprasert, 1 Surapon Piboonpocanun, 2 Orathai Jirapongsananuruk 1 and Nualanong Visitsunthorn 1 Summary
More informationCross-reactive carbohydrate determinants (CCDs)
Dr. rer. nat, Mediwiss Analytic GmbH, Uerdingerstrasse 3, 47441 Moers Cross-reactive carbohydrate (CCDs) Introduction: Most of the proteins in all species are glycoproteins and often found on the outer
More informationStudies of allergen extract stability: The effects of dilution and mixing
Studies of allergen extract stability: The effects of dilution and mixing Harold S. Nelson, MD, David Ikle, PhD, and Andrea Buchmeier Denver, Colo. Background: However potent the allergy extracts provided
More informationslge112 Molecular Allergology Product Characteristics ImmunoCAP ISAC slge 112
slge112 Molecular Allergology Product Characteristics ImmunoCAP ISAC slge 112 IMMUNOCAP ISAC 112 Contents Intended Use 1 Principle of test procedure 1 Clinical utility 1 Sample information 2 Measuring
More informationCan dog allergen immunotherapy reduce concomitant allergic sensitization to other furry animals? A preliminary experience
L E T T ER T O T H E E D I T O R Eur Ann Allergy Clin Immunol Vol 49, N 2, 92-96, 2017 G. Liccardi 1,2, L. Calzetta 2,3, A. Salzillo 1, L. Billeri 4, G. Lucà 3, P. Rogliani 2,3 Can dog allergen immunotherapy
More informationIgG antibody responses in early experimental sparganosis and IgG subclass responses in human sparganosis
145 The Korean Journal of Parasitology Vol. 38, No. 3, 145-150, September 2000 IgG antibody responses in early experimental sparganosis and IgG subclass responses in human sparganosis Young Bae CHUNG 2),
More informationPrevalence of Blomia tropicalis in wheezing children in central Taiwan
J Microbiol Immunol Infect. 2008;41:68-73 Prevalence of Blomia tropicalis in wheezing children in central Taiwan Meng-Kung Yu 1, Ching-Yuang Lin 1,2, Woan-Ling Chen 3, Ching-Tung Chen 3 1 Department of
More informationThe Quest for Clinical Relevance
Allergy Testing in Laboratory The Quest for Clinical Relevance 1989 20130 3 1989 A Good Year Current Concepts Lecture Allergy 1989 a good year WHY ME? Current Concepts Lecturers 1989 Andrew Wootton David
More informationAllergy The diagnostic process Main examinations and interpretation
Brochure for healthcare professionals Allergy The diagnostic process Main examinations and interpretation Physical examination and medical interview As symptoms are not always typical and specific to allergic
More informationFinTest IgG4 Screen 20 ELISA KIT
FinTest IgG4 Screen 20 ELISA KIT Cat. No.:DEIA6196 Pkg.Size:96T Intended use Enzyme immunoassay (microtiter strips) for the detection and the quantitative determination of IgG4 antibodies against 20 Food
More informationOCCUPATIONAL ASTHMA INDUCED BY INHALED CARMINE AMONG BUTCHERS
International Journal of Occupational Medicine and Environmental Health, 2003; 16(2): 133 137 OCCUPATIONAL ASTHMA INDUCED BY INHALED CARMINE AMONG BUTCHERS BELÉN AÑÍBARRO 1, JAVIER SEOANE 1, CONCEPCIÓN
More informationAmaranthus Pollen Allergens: Protein Diversity and Impact on Allergy Diagnosis
Amaranthus Pollen Allergens: Protein Diversity and Impact on Allergy Diagnosis Syed Mohammed Hasnain, Halima Alsini, Abdulrahman Al-Frayh, Mohamed Osman Gad-El-Rab, Ayodele A. Alaiya Abstract Allergenic
More informationMouse Cathepsin B ELISA Kit
GenWay Biotech, Inc. 6777 Nancy Ridge Drive San Diego, CA 92121 Phone: 858.458.0866 Fax: 858.458.0833 Email: techline@genwaybio.com http://www.genwaybio.com Mouse Cathepsin B ELISA Kit Catalog No. GWB-ZZD154
More informationProtein Safety Assessments Toxicity and Allergenicity
Protein Safety Assessments Toxicity and Allergenicity Laura Privalle, Ph.D. BAYER CropScience HESI PATC ILSI IFBiC September 20, 2013 Biotechnology is an Extension of Traditional Plant Breeding TRADITIONAL
More informationAllergy Skin Prick Testing
Allergy Skin Prick Testing What is allergy? The term allergy is often applied erroneously to a variety of symptoms induced by exposure to a wide range of environmental or ingested agents. True allergy
More informationHIV-1 p24 Antigen ELISA Catalog Number:
INTENDED USE The RETRO-TEK HIV-1 p24 Antigen ELISA is supplied for research purposes only. It is not intended for use in the diagnosis or prognosis of disease, or for screening and may not be used as a
More informationFood Allergies A Challenge for Current and Emerging Proteins
Food Allergies A Challenge for Current and Emerging Proteins Steve L. Taylor, Ph.D. Food Allergy Research & Resource Program University of Nebraska 2018 Protein Trends & Technologies Seminar Itasca, IL
More informationab Human Citrate Synthase (CS) Activity Assay Kit
ab119692 Human Citrate Synthase (CS) Activity Assay Kit Instructions for Use For the measurement of mitochondrial citrate synthase (CS) activity in Human samples This product is for research use only and
More informationFigure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.
Figure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.129-Gt(ROSA)26Sor tm1(cre/ert2)tyj /J mice. To induce deletion of the Pten locus,
More informationLearning Objective. Conflicts of Interest 11/28/13
Learning Objective Understand the value of allergy diagnostic testing in everyday practice Learn the advantages and disadvantages of in vivo and in vitro testing Be familiar with component testing; its
More informationProduct Datasheet. EMMPRIN/CD147 Antibody (MEM-M6/1) NB Unit Size: 0.1 mg. Store at 4C. Do not freeze. Publications: 2
Product Datasheet EMMPRIN/CD147 Antibody (MEM-M6/1) NB500-430 Unit Size: 0.1 mg Store at 4C. Do not freeze. Publications: 2 Protocols, Publications, Related Products, Reviews, Research Tools and Images
More informationBackground: Anaphylactic shock causes an estimated 1,500 deaths every year in the
Alina Lorant and Kenneth Smith ABSTRACT Background: Anaphylactic shock causes an estimated 1,500 deaths every year in the United States alone and millions suffer from allergic rhinitis. Despite the documentation
More informationSEASONAL FLUCTUATIONS OF DERMATOPHAGOIDES MITE POPULATION IN HOUSE DUST
Jpn. J. Med. Sci. Biol., 48, 103-115, 1995. SEASONAL FLUCTUATIONS OF DERMATOPHAGOIDES MITE POPULATION IN HOUSE DUST Hiroyuki MATSUOKA, Noriko MAEDA, Yutaka ATSUTA1, Katsuhiko ANDO and Yasuo CHINZEI Department
More informationRHINOLOGY. Presentation of rhinosinugenic intracranial abscesses 99 A. Berghaus, S. Jovanovic
RHINOLOGY Vol. 29 - No. 2 June 1991 CONTENTS FREE CONTRIBUTIONS Hiroshi Moriyama, Masashi Ozawa, Yoshio Honda Endoscopic endonasal sinus surgery. Approaches and post-operative evaluation 93 Desmond A.
More informationOccupational asthma induced by garlic dust
Occupational asthma induced by garlic dust Belen Afiibarro, MD, a Jose L. Fontela, MD, a and Francisco De La Hoz, PhD b Cuenca and Madrid, Spain Background: Garlic dust has not been a frequently encountered
More informationby nexttec TM 1 -Step
Protocol DNA Isolation from Bacteria by nexttec TM 1 -Step - nexttec cleancolumns - Cat. No. 20N.010 Cat. No. 20N.050 Cat. No. 20N.250 Version 1.0 For research only Principle nexttec 1 -Step is the easiest
More informationIndoor Allergens and Allergen Avoidance. Dennis R. Ownby, MD Georgia Regents University Augusta, GA
Indoor Allergens and Allergen Avoidance Dennis R. Ownby, MD Georgia Regents University Augusta, GA downby@gru.edu Disclosure Employment Georgia Regents University Financial Interests Nothing to disclose
More informationEuropium Labeling Kit
Europium Labeling Kit Catalog Number KA2096 100ug *1 Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...
More information