PERFORMANCE MEASURES
|
|
- Griffin Rich
- 6 years ago
- Views:
Transcription
1 PERFORMANCE MEASURES Of predictive systems
2 DATA TYPES Binary Data point Value A FALSE B TRUE C TRUE D FALSE E FALSE F TRUE G FALSE Real Value Data Point Value a 32.3 b.2 b 2. d. e 33 f.65 g 72.8
3 ACCURACY 46% 54% Category A Category B % 99%
4 MATTHEWS CORRELATION COEFFICIENT Accuracy 2/25= 84% PPV 2/23 = 87% FP A TP A Not A Experimental Assignment A Not A TN Prediction FN Not A
5 MATTHEWS CORRELATION COEFFICIENT Accuracy 2/25= 84% PPV 2/23 = 87% FP TP Sens = TP AP Spec = TN AN TP TN FN FP CC = PP AN AP PN A A Not A Experimental Assignment A Not A Prediction TN FN Not A
6 MATTHEWS CORRELATION COEFFICIENT Accuracy 2/25= 84% PPV 2/23 = 87% FP TP Sens = TP AP Spec = TN AN TP TN FN FP CC = PP AN AP PN A A =.95 =.25 =.39 Not A Experimental Assignment A Not A Prediction TN FN Not A
7 SENSITIVITY/SPECIFICITY FP Sens = TP AP Spec = TN AN TP TN FN FP CC = PP AN AP PN A TP A =.95 =.25 =.39 Not A A Not A TN Not A FN =
8 SENSITIVITY/SPECIFICITY FP Sens = TP AP Spec = TN AN TP TN FN FP CC = PP AN AP PN A TP A =.43 =.75 =.37 Not A A Not A TN Not A FN =
9 FROM REAL LIFE
10 REAL VALUE Measured affinity Predicted affinity
11 REAL VALUE Measured affinity Predicted affinity PCC = i (a i ā)(p i p) i (a i ā) 2 i (p i p) 2
12 ROC CURVES Measured affinity Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
13 ROC CURVES Measured affinity Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
14 ROC CURVES Measured affinity Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
15 ROC CURVES Measured affinity TP Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
16 ROC CURVES Measured affinity AP TP Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
17 ROC CURVES Measured affinity TN AP TP Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
18 ROC CURVES Measured affinity TN AP AN TP Predicted affinity Sens = TP AP AUC = Spec = TN AN f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
19 Sens ROC CURVES Measured affinity TN AP AN TP Predicted affinity Sens = TP AP AUC = Spec = TN AN - spec f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
20 Sens ROC CURVES Measured affinity TN AP AN TP Predicted affinity Sens = TP AP AUC = Spec = TN AN AUC=.5 - spec f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
21 Sens ROC CURVES Measured affinity TN AP AN TP Predicted affinity Sens = TP AP AUC = Spec = TN AN AUC=.8 AUC=.5 - spec f(x)dx x = - specificity (false positive rate) and f(x) is sensitivity (true positive rate)
22 CALCULATING A ROC CURVE True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
23 CALCULATING A ROC CURVE True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
24 CALCULATING A ROC CURVE 4 True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
25 CALCULATING A ROC CURVE 4 True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
26 CALCULATING A ROC CURVE 4 True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
27 CALCULATING A ROC CURVE 4 2 True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
28 CALCULATING A ROC CURVE 4 2 True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
29 CALCULATING A ROC CURVE True positive False negative False positive True negative ECCB/ISMB-29 - Immunological Bioinformatics Tutorial
30 AUC = f(x)dx Threshold TP FN TP/(TP+FN) FP TN FP/(FP+TN) >,8 4,29 2,8 >,6 8 6,57 3,23 >,4 3,79 6 7,46 >,2 3,93 9 4,69 > 4 3 True positives rate AUC =.5 AUC =. AUC = False positives rate
31 DEALING WITH SEQUENCE REDUNDANCY
32 OUTLINE
33 OUTLINE What is data redundancy?
34 OUTLINE What is data redundancy? Why is it a problem?
35 OUTLINE What is data redundancy? Why is it a problem? How can we deal with it?
36 DATABASES ARE REDUNDANT CENTER Biological reasons Some protein functions, or sequence motifs are more common than others Laboratory artifacts Some protein families have been heavily investigated, others not FOR BIOLOGICAL SEQUENCE ANALYSIS Mutagenesis studies makes large and almost identical replica
37 DATA REDUNDANCY MHC restricted peptides ALAKAAAAM ALAKAAAAN ALAKAAAAR ALAKAAAAT ALAKAAAAV GMNERPILT GILGFVFTM TLNAWVKVV KLNEPVLLL AVVPFIVSV
38 Sequence identity? ACDFG ACEFG Blast e-values Often too conservative Other 8% ID versus 24% ID What is similarity? DFLKKVPDDHLEFIPYLILGEVFPEWDERELGVGEKLLIKAVA MATGIDAKEIEESVKDTGDL-GE DVLLGADDGSLAFVP SEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGE
39 OLE LUND ET AL. %ID = 29/sqrt(alen) (PROTEIN ENGINEERING 997) Alen=; %ID=29 Alen=3: %ID=53 DSSP secondary structure identity in alignments as a function of the alignment length and the percent sequence identity
40 MHC BINDING PEPTIDES 9mer :%id = 29 9 = 97% 5mer :%id = 29 5 = 75% = 89% < 97% = 73% < 75%
IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology
Bioinformatics 1 -- Lecture 22 IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology Most slides courtesy of Julia Ponomarenko, San Diego Supercomputer Center or Oliver Kohlbacher, WSI/ZBIT, Eberhard-Karls-
More informationStatistics, Probability and Diagnostic Medicine
Statistics, Probability and Diagnostic Medicine Jennifer Le-Rademacher, PhD Sponsored by the Clinical and Translational Science Institute (CTSI) and the Department of Population Health / Division of Biostatistics
More informationINTRODUCTION TO MACHINE LEARNING. Decision tree learning
INTRODUCTION TO MACHINE LEARNING Decision tree learning Task of classification Automatically assign class to observations with features Observation: vector of features, with a class Automatically assign
More informationVarious performance measures in Binary classification An Overview of ROC study
Various performance measures in Binary classification An Overview of ROC study Suresh Babu. Nellore Department of Statistics, S.V. University, Tirupati, India E-mail: sureshbabu.nellore@gmail.com Abstract
More informationKnowledge Discovery and Data Mining. Testing. Performance Measures. Notes. Lecture 15 - ROC, AUC & Lift. Tom Kelsey. Notes
Knowledge Discovery and Data Mining Lecture 15 - ROC, AUC & Lift Tom Kelsey School of Computer Science University of St Andrews http://tom.home.cs.st-andrews.ac.uk twk@st-andrews.ac.uk Tom Kelsey ID5059-17-AUC
More informationReview. Imagine the following table being obtained as a random. Decision Test Diseased Not Diseased Positive TP FP Negative FN TN
Outline 1. Review sensitivity and specificity 2. Define an ROC curve 3. Define AUC 4. Non-parametric tests for whether or not the test is informative 5. Introduce the binormal ROC model 6. Discuss non-parametric
More informationHayden Smith, PhD, MPH /\ v._
Hayden Smith, PhD, MPH.. + /\ v._ Information and clinical examples provided in presentation are strictly for educational purposes, and should not be substituted for clinical guidelines or up-to-date medical
More informationComputer Models for Medical Diagnosis and Prognostication
Computer Models for Medical Diagnosis and Prognostication Lucila Ohno-Machado, MD, PhD Division of Biomedical Informatics Clinical pattern recognition and predictive models Evaluation of binary classifiers
More information7/17/2013. Evaluation of Diagnostic Tests July 22, 2013 Introduction to Clinical Research: A Two week Intensive Course
Evaluation of Diagnostic Tests July 22, 2013 Introduction to Clinical Research: A Two week Intensive Course David W. Dowdy, MD, PhD Department of Epidemiology Johns Hopkins Bloomberg School of Public Health
More informationScreening (Diagnostic Tests) Shaker Salarilak
Screening (Diagnostic Tests) Shaker Salarilak Outline Screening basics Evaluation of screening programs Where we are? Definition of screening? Whether it is always beneficial? Types of bias in screening?
More informationAssessment of performance and decision curve analysis
Assessment of performance and decision curve analysis Ewout Steyerberg, Andrew Vickers Dept of Public Health, Erasmus MC, Rotterdam, the Netherlands Dept of Epidemiology and Biostatistics, Memorial Sloan-Kettering
More informationDerivative-Free Optimization for Hyper-Parameter Tuning in Machine Learning Problems
Derivative-Free Optimization for Hyper-Parameter Tuning in Machine Learning Problems Hiva Ghanbari Jointed work with Prof. Katya Scheinberg Industrial and Systems Engineering Department Lehigh University
More informationWorksheet for Structured Review of Physical Exam or Diagnostic Test Study
Worksheet for Structured Review of Physical Exam or Diagnostic Study Title of Manuscript: Authors of Manuscript: Journal and Citation: Identify and State the Hypothesis Primary Hypothesis: Secondary Hypothesis:
More informationBMI 541/699 Lecture 16
BMI 541/699 Lecture 16 Where we are: 1. Introduction and Experimental Design 2. Exploratory Data Analysis 3. Probability 4. T-based methods for continous variables 5. Proportions & contingency tables -
More informationProbability Revision. MED INF 406 Assignment 5. Golkonda, Jyothi 11/4/2012
Probability Revision MED INF 406 Assignment 5 Golkonda, Jyothi 11/4/2012 Problem Statement Assume that the incidence for Lyme disease in the state of Connecticut is 78 cases per 100,000. A diagnostic test
More informationWeek 2 Video 3. Diagnostic Metrics
Week 2 Video 3 Diagnostic Metrics Different Methods, Different Measures Today we ll continue our focus on classifiers Later this week we ll discuss regressors And other methods will get worked in later
More informationReceiver operating characteristic
Receiver operating characteristic From Wikipedia, the free encyclopedia In signal detection theory, a receiver operating characteristic (ROC), or simply ROC curve, is a graphical plot of the sensitivity,
More informationBuilding robust time-lapse models. Kirstine Kirkegaard The Fertility Clinic Aarhus University Hospital
Building robust time-lapse models Kirstine Kirkegaard The Fertility Clinic Aarhus University Hospital Time-lapse as a diagnostic test Morphology Limited information Dependent on timing Subjective Validated
More informationMachine learning II. Juhan Ernits ITI8600
Machine learning II Juhan Ernits ITI8600 Hand written digit recognition 64 Example 2: Face recogition Classification, regression or unsupervised? How many classes? Example 2: Face recognition Classification,
More informationNet Reclassification Risk: a graph to clarify the potential prognostic utility of new markers
Net Reclassification Risk: a graph to clarify the potential prognostic utility of new markers Ewout Steyerberg Professor of Medical Decision Making Dept of Public Health, Erasmus MC Birmingham July, 2013
More informationFeature selection methods for early predictive biomarker discovery using untargeted metabolomic data
Feature selection methods for early predictive biomarker discovery using untargeted metabolomic data Dhouha Grissa, Mélanie Pétéra, Marion Brandolini, Amedeo Napoli, Blandine Comte and Estelle Pujos-Guillot
More informationSupplemental Information
ARTICLE Supplemental Information This section contains additional detail about alternative scores that were considered for the M-CHAT-R/F (see Supplemental Appendix), as well as additional information
More informationMETHODS FOR DETECTING CERVICAL CANCER
Chapter III METHODS FOR DETECTING CERVICAL CANCER 3.1 INTRODUCTION The successful detection of cervical cancer in a variety of tissues has been reported by many researchers and baseline figures for the
More informationProtein Structure & Function. University, Indianapolis, USA 3 Department of Molecular Medicine, University of South Florida, Tampa, USA
Protein Structure & Function Supplement for article entitled MoRFpred, a computational tool for sequence-based prediction and characterization of short disorder-to-order transitioning binding regions in
More informationS4. Summary of the GALNS assay validation. Intra-assay variation (within-run precision)
S4. Summary of the GALNS assay validation (i.) Intra-assay variation (within-run precision) Intra-assay variation was determined by measuring standard blood samples (low activity standard; medium activity
More informationChapter 10. Screening for Disease
Chapter 10 Screening for Disease 1 Terminology Reliability agreement of ratings/diagnoses, reproducibility Inter-rater reliability agreement between two independent raters Intra-rater reliability agreement
More informationCritical reading of diagnostic imaging studies. Lecture Goals. Constantine Gatsonis, PhD. Brown University
Critical reading of diagnostic imaging studies Constantine Gatsonis Center for Statistical Sciences Brown University Annual Meeting Lecture Goals 1. Review diagnostic imaging evaluation goals and endpoints.
More informationEvidence-Based Medicine: Diagnostic study
Evidence-Based Medicine: Diagnostic study What is Evidence-Based Medicine (EBM)? Expertise in integrating 1. Best research evidence 2. Clinical Circumstance 3. Patient values in clinical decisions Haynes,
More informationZheng Yao Sr. Statistical Programmer
ROC CURVE ANALYSIS USING SAS Zheng Yao Sr. Statistical Programmer Outline Background Examples: Accuracy assessment Compare ROC curves Cut-off point selection Summary 2 Outline Background Examples: Accuracy
More information1 Diagnostic Test Evaluation
1 Diagnostic Test Evaluation The Receiver Operating Characteristic (ROC) curve of a diagnostic test is a plot of test sensitivity (the probability of a true positive) against 1.0 minus test specificity
More informationThe Latest Technology from CareFusion
The Latest Technology from CareFusion Contents 1 Introduction... 2 1.1 Overview... 2 1.2 Scope... 2 2.1 Input Recordings... 2 2.2 Automatic Analysis... 3 2.3 Data Mining... 3 3 Results... 4 3.1 AHI comparison...
More informationAn Improved Patient-Specific Mortality Risk Prediction in ICU in a Random Forest Classification Framework
An Improved Patient-Specific Mortality Risk Prediction in ICU in a Random Forest Classification Framework Soumya GHOSE, Jhimli MITRA 1, Sankalp KHANNA 1 and Jason DOWLING 1 1. The Australian e-health and
More informationMeta-analysis of diagnostic research. Karen R Steingart, MD, MPH Chennai, 15 December Overview
Meta-analysis of diagnostic research Karen R Steingart, MD, MPH karenst@uw.edu Chennai, 15 December 2010 Overview Describe key steps in a systematic review/ meta-analysis of diagnostic test accuracy studies
More informationAn Introduction to ROC curves. Mark Whitehorn. Mark Whitehorn
An Introduction to ROC curves Mark Whitehorn Mark Whitehorn It s all about me Prof. Mark Whitehorn Emeritus Professor of Analytics Computing University of Dundee Consultant Writer (author) m.a.f.whitehorn@dundee.ac.uk
More informationROC (Receiver Operating Characteristic) Curve Analysis
ROC (Receiver Operating Characteristic) Curve Analysis Julie Xu 17 th November 2017 Agenda Introduction Definition Accuracy Application Conclusion Reference 2017 All Rights Reserved Confidential for INC
More informationGene Finding in Eukaryotes
Gene Finding in Eukaryotes Jan-Jaap Wesselink jjwesselink@cnio.es Computational and Structural Biology Group, Centro Nacional de Investigaciones Oncológicas Madrid, April 2008 Jan-Jaap Wesselink jjwesselink@cnio.es
More informationPredictive Models for Healthcare Analytics
Predictive Models for Healthcare Analytics A Case on Retrospective Clinical Study Mengling Mornin Feng mfeng@mit.edu mornin@gmail.com 1 Learning Objectives After the lecture, students should be able to:
More informationVU Biostatistics and Experimental Design PLA.216
VU Biostatistics and Experimental Design PLA.216 Julia Feichtinger Postdoctoral Researcher Institute of Computational Biotechnology Graz University of Technology Outline for Today About this course Background
More informationCochrane Handbook for Systematic Reviews of Diagnostic Test Accuracy
Cochrane Handbook for Systematic Reviews of Diagnostic Test Accuracy Chapter 10 Analysing and Presenting Results Petra Macaskill, Constantine Gatsonis, Jonathan Deeks, Roger Harbord, Yemisi Takwoingi.
More informationA Predictive Chronological Model of Multiple Clinical Observations T R A V I S G O O D W I N A N D S A N D A M. H A R A B A G I U
A Predictive Chronological Model of Multiple Clinical Observations T R A V I S G O O D W I N A N D S A N D A M. H A R A B A G I U T H E U N I V E R S I T Y O F T E X A S A T D A L L A S H U M A N L A N
More informationUnderstanding Diagnostic Research Outline of Topics
Albert-Ludwigs-Universität Freiburg Freiräume für wissenschaftliche Weiterbildung Understanding Diagnostic Research Outline of Topics Werner Vach, Veronika Reiser, Izabela Kolankowska In Kooperation mit
More informationRELIABILITY OF OPERATORS DURING THE VISUAL INSPECTION OF PRODUCED PARENTERAL DRUGS
RELIABILITY OF OPERATORS DURING THE VISUAL INSPECTION OF PRODUCED PARENTERAL DRUGS F. Sadeghipour, A. Bugmann, V. Herrera, P. Bonnabry Geneva, 22 March 2006 11th Congress of the European Association of
More informationDetection of Mild Cognitive Impairment using Image Differences and Clinical Features
Detection of Mild Cognitive Impairment using Image Differences and Clinical Features L I N L I S C H O O L O F C O M P U T I N G C L E M S O N U N I V E R S I T Y Copyright notice Many of the images in
More informationDiagnostic tests, Laboratory tests
Diagnostic tests, Laboratory tests I. Introduction II. III. IV. Informational values of a test Consequences of the prevalence rate Sequential use of 2 tests V. Selection of a threshold: the ROC curve VI.
More informationIt s hard to predict!
Statistical Methods for Prediction Steven Goodman, MD, PhD With thanks to: Ciprian M. Crainiceanu Associate Professor Department of Biostatistics JHSPH 1 It s hard to predict! People with no future: Marilyn
More informationUsing SuSPect to Predict the Phenotypic Effects of Missense Variants. Chris Yates UCL Cancer Institute
Using SuSPect to Predict the Phenotypic Effects of Missense Variants Chris Yates UCL Cancer Institute c.yates@ucl.ac.uk Outline SAVs and Disease Development of SuSPect Features included Feature selection
More informationIntroduction to Meta-analysis of Accuracy Data
Introduction to Meta-analysis of Accuracy Data Hans Reitsma MD, PhD Dept. of Clinical Epidemiology, Biostatistics & Bioinformatics Academic Medical Center - Amsterdam Continental European Support Unit
More informationBiomarker adaptive designs in clinical trials
Review Article Biomarker adaptive designs in clinical trials James J. Chen 1, Tzu-Pin Lu 1,2, Dung-Tsa Chen 3, Sue-Jane Wang 4 1 Division of Bioinformatics and Biostatistics, National Center for Toxicological
More informationValidation of QFracture. Analysis prepared for NICE 2011
Validation of QFracture compared with FRAX Analysis prepared for NICE 2011 Authors: Julia Hippisley-Cox & Carol Coupland Email: Julia.hippisley-cox@nottingham.ac.uk Julia Hipisley-Cox, University of Nottingham,
More informationCS229 Final Project Report. Predicting Epitopes for MHC Molecules
CS229 Final Project Report Predicting Epitopes for MHC Molecules Xueheng Zhao, Shanshan Tuo Biomedical informatics program Stanford University Abstract Major Histocompatibility Complex (MHC) plays a key
More informationSYSTEMATIC REVIEWS OF TEST ACCURACY STUDIES
Biomarker & Test Evaluation Program SYSTEMATIC REVIEWS OF TEST ACCURACY STUDIES Patrick MM Bossuyt Structure 1. Clinical Scenarios 2. Test Accuracy Studies 3. Systematic Reviews 4. Meta-Analysis 5.
More informationHealth Studies 315: Handouts. Health Studies 315: Handouts
Health Studies 315: Handouts Health Studies 315: Handouts l Lecture Notes l Last YearÍs Exam l Article: Wagner, JM, McKinney, P, Carpenter, JL. Does this patient have appendicitis? JAMA 276(19):1589-1594
More informationBehavioral Data Mining. Lecture 4 Measurement
Behavioral Data Mining Lecture 4 Measurement Outline Hypothesis testing Parametric statistical tests Non-parametric tests Precision-Recall plots ROC plots Hardware update Icluster machines are ready for
More informationMary Keogan, on Mary behalf Keogan of all in NHISSOT On behalf of all in NHISSOT. 4th April 2014
Solid Organ Transplantation How the Lab Contributes to Improved Patient Outcomes Mary Keogan, on Mary behalf Keogan of all in NHISSOT On behalf of all in NHISSOT 4th April 2014 Solid Organ Transplantation
More informationDiagnostic Test. H. Risanto Siswosudarmo Department of Obstetrics and Gynecology Faculty of Medicine, UGM Jogjakarta. RS Sardjito
ب س م الل ه الر ح م ن الر ح يم RS Sardjito Diagnostic Test Gold standard New (test Disease No Disease Column Total Posi*ve a b a+b Nega*ve c d c+d Row Total a+c b+d N H. Risanto Siswosudarmo Department
More informationSensitivity, Specificity, and Relatives
Sensitivity, Specificity, and Relatives Brani Vidakovic ISyE 6421/ BMED 6700 Vidakovic, B. Se Sp and Relatives January 17, 2017 1 / 26 Overview Today: Vidakovic, B. Se Sp and Relatives January 17, 2017
More informationSubmitted: February 15, 2013 Posted: March 16, 2013
1 Submitted: February 15, 2013 Posted: March 16, 2013 TITLE: The results of the validation process of a Modified SGA (Subjective Global Assessment) Nutrition Assessment and Risk Level Tool designed by
More informationMACHINE LEARNING BASED APPROACHES FOR PREDICTION OF PARKINSON S DISEASE
Abstract MACHINE LEARNING BASED APPROACHES FOR PREDICTION OF PARKINSON S DISEASE Arvind Kumar Tiwari GGS College of Modern Technology, SAS Nagar, Punjab, India The prediction of Parkinson s disease is
More informationCHAPTER 2 MAMMOGRAMS AND COMPUTER AIDED DETECTION
9 CHAPTER 2 MAMMOGRAMS AND COMPUTER AIDED DETECTION 2.1 INTRODUCTION This chapter provides an introduction to mammogram and a description of the computer aided detection methods of mammography. This discussion
More informationSystematic Reviews and meta-analyses of Diagnostic Test Accuracy. Mariska Leeflang
Systematic Reviews and meta-analyses of Diagnostic Test Accuracy Mariska Leeflang m.m.leeflang@amc.uva.nl This presentation 1. Introduction: accuracy? 2. QUADAS-2 exercise 3. Meta-analysis of diagnostic
More informationChristina Martin Kazi Russell MED INF 406 INFERENCING Session 8 Group Project November 15, 2014
INFERENCING (HW 8) 1 Christina Martin Kazi Russell MED INF 406 INFERENCING Session 8 Group Project November 15, 2014 Page 2 The Clinical Decision Support System designed to utilize the Training Set data
More information8/3/2016. Background. CT-Ventilation. Validation, Clinical Endpoints and Opportunities for CT Ventilation. 4DCT-Ventilation Imaging.
Validation, Clinical Endpoints and Opportunities for CT Ventilation Yevgeniy Vinogradskiy PhD University of Colorado School of Medicine Department Of Radiation Oncology 4DCT-Ventilation Imaging Background
More informationProPred1: prediction of promiscuous MHC Class-I binding sites. Harpreet Singh and G.P.S. Raghava
BIOINFORMATICS Vol. 19 no. 8 2003, pages 1009 1014 DOI: 10.1093/bioinformatics/btg108 ProPred1: prediction of promiscuous MHC Class-I binding sites Harpreet Singh and G.P.S. Raghava Institute of Microbial
More informationSUPPLEMENTARY INFORMATION
Supplementary Notes 1: accuracy of prediction algorithms for peptide binding affinities to HLA and Mamu alleles For each HLA and Mamu allele we have analyzed the accuracy of four predictive algorithms
More informationThe cross sectional study design. Population and pre-test. Probability (participants). Index test. Target condition. Reference Standard
The cross sectional study design. and pretest. Probability (participants). Index test. Target condition. Reference Standard Mirella Fraquelli U.O. Gastroenterologia 2 Fondazione IRCCS Cà Granda Ospedale
More informationFigure 1: Design and outcomes of an independent blind study with gold/reference standard comparison. Adapted from DCEB (1981b)
Page 1 of 1 Diagnostic test investigated indicates the patient has the Diagnostic test investigated indicates the patient does not have the Gold/reference standard indicates the patient has the True positive
More informationComparing Multifunctionality and Association Information when Classifying Oncogenes and Tumor Suppressor Genes
000 001 002 003 004 005 006 007 008 009 010 011 012 013 014 015 016 017 018 019 020 021 022 023 024 025 026 027 028 029 030 031 032 033 034 035 036 037 038 039 040 041 042 043 044 045 046 047 048 049 050
More informationEmpirical assessment of univariate and bivariate meta-analyses for comparing the accuracy of diagnostic tests
Empirical assessment of univariate and bivariate meta-analyses for comparing the accuracy of diagnostic tests Yemisi Takwoingi, Richard Riley and Jon Deeks Outline Rationale Methods Findings Summary Motivating
More informationAMH CUT-OFF VALUES FOR PREDICTING OVARIAN RESPONSE IN IVF. Nguyễn Xuân Hợi, MD, PhD Hoàng Văn Hùng MsC, MD
AMH CUT-OFF VALUES FOR PREDICTING OVARIAN RESPONSE IN IVF Nguyễn Xuân Hợi, MD, PhD Hoàng Văn Hùng MsC, MD INTRODUCTION Ovarian stimulation is an important process in IVF treatment, aiming at obtain a number
More informationPersonalized Colorectal Cancer Survivability Prediction with Machine Learning Methods*
Personalized Colorectal Cancer Survivability Prediction with Machine Learning Methods* 1 st Samuel Li Princeton University Princeton, NJ seli@princeton.edu 2 nd Talayeh Razzaghi New Mexico State University
More informationExample - Birdkeeping and Lung Cancer - Interpretation. Lecture 20 - Sensitivity, Specificity, and Decisions. What do the numbers not mean...
Odds Ratios Example - Birdkeeping and Lung Cancer - Interpretation Lecture 20 - Sensitivity, Specificity, and Decisions Sta102 / BME102 Colin Rundel April 16, 2014 Estimate Std. Error z value Pr(> z )
More informationClassification with microarray data
Classification with microarray data Aron Charles Eklund eklund@cbs.dtu.dk DNA Microarray Analysis - #27612 January 8, 2010 The rest of today Now: What is classification, and why do we do it? How to develop
More informationIntroduction to diagnostic accuracy meta-analysis. Yemisi Takwoingi October 2015
Introduction to diagnostic accuracy meta-analysis Yemisi Takwoingi October 2015 Learning objectives To appreciate the concept underlying DTA meta-analytic approaches To know the Moses-Littenberg SROC method
More informationCharacterization of a novel detector using ROC. Elizabeth McKenzie Boehnke Cedars-Sinai Medical Center UCLA Medical Center AAPM Annual Meeting 2017
Characterization of a novel detector using ROC Elizabeth McKenzie Boehnke Cedars-Sinai Medical Center UCLA Medical Center AAPM Annual Meeting 2017 New Ideas Investigation Clinical Practice 2 Investigating
More informationResearch Article A Selective Ensemble Classification Method Combining Mammography Images with Ultrasound Images for Breast Cancer Diagnosis
Hindawi Computational and Mathematical Methods in Medicine Volume 27, Article ID 4896386, 7 pages https://doi.org/5/27/4896386 Research Article A Selective Ensemble Classification Method Combining Mammography
More information2011 ASCP Annual Meeting
Diagnostic Accuracy Martin Kroll, MD Professor of Pathology and Laboratory Medicine Boston University School of Medicine Chief, Laboratory Medicine Boston Medical Center Disclosure Roche Abbott Course
More informationEvalua&ng Methods. Tandy Warnow
Evalua&ng Methods Tandy Warnow You ve designed a new method! Now what? To evaluate a new method: Establish theore&cal proper&es. Evaluate on data. Compare the new method to other methods. How do you do
More informationA graphic approach to the evaluation of the performance of diagnostic tests using the software.
~ ~~ ~~C"~C~"C~. ~c~~~ A graphic approach to the evaluation of the performance of diagnostic tests using the SAS@ software. Renza Cristofani Edoardo Bracci Marco Ferdeghini CNR - Institute of Clinical
More informationPredicting Protein-Peptide Binding Affinity by Learning Peptide-Peptide Distance Functions
Predicting Protein-Peptide Binding Affinity by Learning Peptide-Peptide Distance Functions Chen Yanover and Tomer Hertz,2 School of Computer Science and Engineering 2 The Center for Neural Computation,
More informationWorkshop presentation: Development and application of Bioinformatics methods
Workshop presentation: Development and application of Bioinformatics methods Immune system Innate fast Addaptive remembers Cellular Cytotoxic T lymphocytes (CTL) Helper T lymphocytes (HTL) Humoral B lymphocytes
More informationEvidence-based guidelines for diagnosis of common bile duct stones Vanja Giljaca University Hospital Center Rijeka Department of Gastroenterology
Evidencebased guidelines for diagnosis of common bile duct stones Vanja Giljaca University Hospital Center Rijeka Department of Gastroenterology Trusted evidence. Informed decisions. Better health. Outline
More informationClassification of benign and malignant masses in breast mammograms
Classification of benign and malignant masses in breast mammograms A. Šerifović-Trbalić*, A. Trbalić**, D. Demirović*, N. Prljača* and P.C. Cattin*** * Faculty of Electrical Engineering, University of
More informationSaichiu Nelson Tong ALL RIGHTS RESERVED
2017 Saichiu Nelson Tong ALL RIGHTS RESERVED MODELING CLASSIFICATION NETWORK OF ELECTROENCEPHALOGRAPHIC ARTIFACTS AND SIGNALS ASSOCIATED WITH DEEP BRAIN STIMULATION By SAICHIU NELSON TONG A thesis submitted
More informationConvolutional and LSTM Neural Networks
Convolutional and LSTM Neural Networks Vanessa Jurtz January 12, 2016 Contents Neural networks and GPUs Lasagne Peptide binding to MHC class II molecules Convolutional Neural Networks (CNN) Recurrent and
More informationPOD data collection & analysis Tools for beginners
4th European-American Workshop on Reliability of NDE June 2009 Reliability for NDT Tutorial: POD Basic www.ndt.net/index.php?id=8311 POD data collection & analysis Tools for beginners Introduction Round:
More informationThe recommended method for diagnosing sleep
reviews Measuring Agreement Between Diagnostic Devices* W. Ward Flemons, MD; and Michael R. Littner, MD, FCCP There is growing interest in using portable monitoring for investigating patients with suspected
More informationQuestion Sheet. Prospective Validation of the Pediatric Appendicitis Score in a Canadian Pediatric Emergency Department
Question Sheet Prospective Validation of the Pediatric Appendicitis Score in a Canadian Pediatric Emergency Department Bhatt M, Joseph L, Ducharme FM et al. Acad Emerg Med 2009;16(7):591-596 1. Provide
More informationPerformance Evaluation of Machine Learning Algorithms in the Classification of Parkinson Disease Using Voice Attributes
Performance Evaluation of Machine Learning Algorithms in the Classification of Parkinson Disease Using Voice Attributes J. Sujatha Research Scholar, Vels University, Assistant Professor, Post Graduate
More informationPrediction of Post-translational modification sites and Multi-domain protein structure
Prediction of Post-translational modification sites and Multi-domain protein structure Robert Newman, Ph.D. Department of Biology Dukka KC, Ph.D. Department of Computational Science and Engineering North
More informationAlternative splicing analysis in partially annotated genome : Junction-centric versus exon-centric analysis of RNASeq data.
Alternative splicing analysis in partially annotated genome : Junction-centric versus exon-centric analysis of RNASeq data. nucleus GENE Pre-mRNA mrna 2 Protein 1 Protein 2 mrna 3 Protein 3 cytoplasm mrna
More informationGeorge Cernile Artificial Intelligence in Medicine Toronto, ON. Carol L. Kosary National Cancer Institute Rockville, MD
George Cernile Artificial Intelligence in Medicine Toronto, ON Carol L. Kosary National Cancer Institute Rockville, MD Using RCA A system to convert free text pathology reports into a database of discrete
More informationSimple Probabilistic Reasoning
Simple Probabilistic Reasoning 6.873/HST951 Harvard-MIT Division of Health Sciences and Technology HST.951J: Medical Decision Support Change over 30 years 1970 s: human knowledge, not much data 2000 s:
More informationFor more information about how to cite these materials visit
Author(s): Rajesh Mangrulkar, M.D., 2013 License: Unless otherwise noted, this material is made available under the terms of the Creative Commons Attribution Non-commercial Share Alike 3.0 License: http://creativecommons.org/licenses/by-nc-sa/3.0/
More informationSUPPLEMENTARY MATERIAL S-1 INTREPID VARIANTS
SUPPLEMENTARY MATERIAL S- INTREPID VARIANTS We define different INTREPID variants based on the positional conservation score cons(s, x) which is used to compute the importance score in Equation S-. IMP
More informationSplice Site Prediction Using Artificial Neural Networks
Splice Site Prediction Using Artificial Neural Networks Øystein Johansen, Tom Ryen, Trygve Eftesøl, Thomas Kjosmoen, and Peter Ruoff University of Stavanger, Norway Abstract. A system for utilizing an
More informationTactile Internet and Edge Computing: Emerging Technologies for Mobile Health
Tactile Internet and Edge Computing: Emerging Technologies for Mobile Health Zaher Dawy, PhD Department of Electrical and Computer Engineering American University of Beirut http://www.aub.edu.lb/~zd03
More informationImproved Intelligent Classification Technique Based On Support Vector Machines
Improved Intelligent Classification Technique Based On Support Vector Machines V.Vani Asst.Professor,Department of Computer Science,JJ College of Arts and Science,Pudukkottai. Abstract:An abnormal growth
More informationI got it from Agnes- Tom Lehrer
Epidemiology I got it from Agnes- Tom Lehrer I love my friends and they love me We're just as close as we can be And just because we really care Whatever we get, we share! I got it from Agnes She got it
More informationMeta-analysis of diagnostic accuracy studies. Mariska Leeflang (with thanks to Yemisi Takwoingi, Jon Deeks and Hans Reitsma)
Meta-analysis of diagnostic accuracy studies Mariska Leeflang (with thanks to Yemisi Takwoingi, Jon Deeks and Hans Reitsma) 1 Diagnostic Test Accuracy Reviews 1. Framing the question 2. Identification
More informationCopyright 2007 IEEE. Reprinted from 4th IEEE International Symposium on Biomedical Imaging: From Nano to Macro, April 2007.
Copyright 27 IEEE. Reprinted from 4th IEEE International Symposium on Biomedical Imaging: From Nano to Macro, April 27. This material is posted here with permission of the IEEE. Such permission of the
More information