2018 Biochemistry 110 California Institute of Technology Lecture 7: Molecular Disease: Sickle-Cell Anemia
|
|
- Shana Underwood
- 5 years ago
- Views:
Transcription
1 2018 Biochemistry 110 California Institute of Technology Lecture 7: Molecular Disease: Sickle-Cell Anemia James Herrick ( ) Phase-Contrast microscopy image of Sickle Cells intermingled with erythrocytes. In Chicago in 1904, Herrick first observed the sickle-shaped red blood cells from patients that suffered from anemia, irregular heartbeat and a series of physical ailments. His findings went unexplained until 1949 when Linus Pauling examined the physical properties of hemoglobin from those afflicted with the disease and identified a single amino acid substitution as the cause of the disease. Today, thousand Americans live into their 40s and 50s with the disease that previously had a life expectancy of no more than 30 years. The study and treatment of this disease, which affects 100,000 African Americans in the U.S., continues to be an active endeavor in research and medicine.!review of Hb: Cooperativity, Allosteric Effect, Bohr Effect ( ).!Sickle Cell Anemia: Effects of Single Nucleotide Changes to Hb ( ).
2 Features of Hemoglobin that allow 88% O2 transport from Lungs to Tissues 1. Cooperativity β1 β1 α1 15 x eli FH α1 x eli FH x eli FH x eli FH α2 Tetrameric Hb structure can switch from Low Affinity State (T State) to High Affinity State (R state). This allows a Sigmoidal-Shaped binding curve (S-Curve). α2 β2 T State (favors deoxyhemoglobin) β2 R State (favors oxyhemoglobin) 2. Allosteric Effect 2,3-Bisphosphoglycerate in red blood cells binds at a single site between the two beta chains and stabilizes the Low Affinity State (T State). 3. Bohr Effect Affinity of Hemoglobin for O2 decreases as ph decreases and also as CO2 levels increase in Tissues. The effect is a combination of carbonic acid (H2CO3) lowering ph which protonates key Histidines and also carbamate formation from CO2 reacting with N-terminal amino group.
3 Erythrocytes are Designed to Move O 2 Efficiently Through Capillaries Bi-concave shape maximizes surface area for O 2 uptake/release while maintaining smooth profile and flexibility mammalian erythrocytes are anuclear - made in bone marrow x erythrocytes (1/4 of total cell count) in the human body» SCD is associated with red blood cells that are crescent-shaped, sticky and suffer rapid hemolysis.
4 Pauling s Research on Hemoglobin In 1935 the Rockefeller Foundation had been supporting my work on the crystal structure of the sulphide minerals and they said to me, You know, we re really not interested in the sulphide minerals. We re interested in biological substances - The Pauling Blog, paulingblog.wordpress.com measured magnetic susceptibility of blood - venous blood was paramagnetic - arterial blood was diamagnetic In 1945, Pauling attended a presentation by physician William Castle, who noted that for sickle-cell patients: - venous blood showed predominance of sickle cells - arterial blood showed most cells normally shaped Pauling s notebook Pauling s Laboratory in Gates (1935) Pauling Observed Altered Electrophoretic Mobility of Hemoglobin S Science 1949, 110, Subsequent 2D electrophoretic paper analysis of tryptic peptides of the β-hb chain and comparison with those of β-hb S by Baglioni and Ingram: single tryptic peptide: Val-His-Leu-Thr-Pro-Glu-Glu-Lys in β-hb S is changed to: > Val-His-Leu-Thr-Pro-Val-Glu-Lys apply sample HbA HbS _ apply electric field + then elute then stain vertically with ninhydrin with AcOH/BuOH (cathode) - + (anode) (cathode) - + (anode)
5 A Single Nucleotide Difference Leads to Sickle Cell Behavior We call it β-e6v. (E in the 6th position of chain β changes to V) DeoxyHemoglobin S forms Long Helical Fibers The Hemoglobin S tetramer with the Val-6 associates with the hydrophobic patch on another Hemoglobin β-chain in the deoxygenated state.
6 The Aggregation of Deoxy-Hemoglobin Makes SCD Particularly Dangerous Depletion of oxygen due to blood vessel blockage drives the deoxygenation of the tetramer. SCD increases opportunity for infections that can initate more aggregation.» Children growing up with SCD require special medical attention. The Sickle Cell Heterozygous Trait Confers Malaria Resistance
7 Sickle-Cell Phenotype Develops in Infants as Fetal Hemoglobin is Replaced by Adult Hemoglobin α -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLSH-----GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK β VHLTPEEKSAVTALWGKVNV--DEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDK γ GHFTEEDKATITSLWGKVNV--EDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDK δ VHLTPEEKTAVNALWGKVNV--DAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDK ε VHFTAEEKAAVTSLWSKMNV--EEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKMNDNLKPAFAKLSELHCDK LRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141 LHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 146 (Adult Hemoglobin (HbA) - α 2 β 2 ) LHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH 146 (Fetal Hemoglobin (HbF) - α 2 γ 2 ) LHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH 147 (Adult Hemoglobin A 2 (HbA 2 ) - α 2 δ 2 ) LHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH 147 (Embryonic Hemoglobin Gower II α 2 ε 2,1A9W) To date, the best treatment for SCD is hydroxyurea. - antineoplastic drug increases the proportion of HbF for sickle-cell patients. - carriers of the HbS trait from Saudia Arabia were known to produce an unusual proportion of HbF in their blood. - HbF was known to be a very potent inhibitor of the polymerization of deoxy-hbs. Vernon Ingram, Genetics 2004, 167, 1-7.
8 The Bohr Effect CO 2 generated in the tissues is converted to H + - and HCO 3 in RBC s by Carbonic Anhydrase. Deoxy-Hb has increased affinity for H + (pka s of certain groups are raised). The groups that have pka s near ph are His and the peptide terminal NH 2 group. In addition, CO 2 carbamoylates the α-chain terminal amino group:
9 Early Treatment for SCD with Cyanate : The Bohr effect (deoxy-hb transporting protons and CO 2 ) is reduced when the terminal amino groups of the α-chains are carbamoylated. O R NH 2 + -NCO + H + R N NH2 Terminal Amino Group Cyanate H Carbamoylated derivative Cyanate enters red blood cells and carbamoylates the terminal amino groups of hemoglobin increasing the affinity of Hb for oxygen. (Thus decreasing the propensity to aggregate deoxy-hbs.) Unfortunately, cyanate was found to have several side effects and is no longer used. Treatment of SCD is still an active area of medicinal research.
10 There are Over 100 Examples of Site-Specific Changes in Hemoglobin α-chain I G Honolulu Norfolk M Boston M Iwate G Philadelphia O Indonesia K16E E30Q G57D H58Y H87Y N68K E116K β-chain C S G SanJose E M Saskatoon M Zurich M HydePark M Milwaukee D Punjab E6K E6V E7G E26K H63Y H63R H92Y V67E E121Q Tyrosine F8 CH 2 Heme Proximal N Histidine F8 N Fe2+ O 2 HN CH 2 Hemoglobin A Heme H O Fe 3+ O H Hemoglobin M Iwate H O H Heme Fe 3+ M signifies the propensity for the Methemoglobin form (Fe3+). N Distal Histidine E7 CH 2 O Tyrosine E7 CH 2 Hemoglobin M Boston The frequency of any non-s mutant allele is <10-4. These other mutations do not confer any (known) benefit. 1. Altered Exterior: Nearly all substitutions on the surface of the hemoglobin tetramer are harmless. Hb-S is a striking exception. 2. Altered Active Site: The defective subunit can no longer bind O Altered Tertiary Structure: The polypeptide chain can no longer fold. 4. Altered Quaternary Structure: Mutations at the subunit interfaces result in loss of allosteric properties.
4 Fahed Al Karmi Sufian Alhafez Dr nayef karadsheh
4 Fahed Al Karmi Sufian Alhafez Dr nayef karadsheh Genetic variants of hemoglobin Hemoglobinopathies (abnormal variants of hemoglobin) are divided into: 1. Structural abnormalities: Any change in the genes
More informationChapter 7. Heme proteins Cooperativity Bohr effect
Chapter 7 Heme proteins Cooperativity Bohr effect Hemoglobin is a red blood cell protein that transports oxygen from the lungs to the tissues. Hemoglobin is an allosteric protein that displays cooperativity
More informationLecture 5. Dr. Sameh Sarray Hlaoui
Lecture 5 Myoglobin & Hemoglobin Dr. Sameh Sarray Hlaoui Myoglobin and Hemoglobin Myoglobin - Myoglobin and Hemoglobin are (metalloprotein containing a heme prosthetic group). hemeproteins - Function as
More informationBatool Emad. Marah Karablieh. - Nayef Karadsheh
4 4 1 P a g e Batool Emad Marah Karablieh - Nayef Karadsheh ***Topics that will be discussed in this Lecture: 1) Globin gene organization 2) Hemoglobinopathies 3) HbS (sickle cell disease) 4) HbC and HbSC
More informationChem*3560 Lecture 4: Inherited modifications in hemoglobin
Chem*3560 Lecture 4: Inherited modifications in hemoglobin Genetic modifications fall into two classes: Thalassemias, which are the result of failure to express globin genes. Thalassa is Greek for the
More informationGlobular proteins Proteins globular fibrous
Globular proteins Globular proteins Proteins are biochemical compounds consisting of one or more polypeptides typically folded into a globular or fibrous form in a biologically functional way. Globular
More informationOla Al-juneidi Abdel-Mu'ez Siyam. Dr. Nayef
3 Ola Al-juneidi Abdel-Mu'ez Siyam Dr. Nayef Transport of CO 2 We have talked previously about the role of hemoglobin in the transport of oxygen and how it is regulated by various allosteric effectors,
More information1. Hemoglobin and the Movement of Oxygen. Respirator system/biochemistry
1. Hemoglobin and the Movement of Oxygen Respirator system/biochemistry YOU MUST BE ABLE TO: Hemoglobin and the Movement of Oxygen specific aims 1. Compare structure of myoglobin and hemoglobin 2. Understand
More information270,000,000 hemoglobin units are. hemoglobin has 4 heme units; 2 α and 2 β units. Active site of a heme unit has an Iron ion
RBC strange shape a biconcave disc that is round and flat RBC has no nucleus. The nucleus is extruded from the cell as it matures. An RBC can change shape to an amazing extent, without breaking, as it
More informationThe hemoglobin (Hb) can bind a maximum of 220 ml O2 per liter.
Hemoglobin Hemoglobin The most important function of the red blood cells is totransport (O2) from the lungs into the tissues, and carbon dioxide (CO2) from the tissues back into the lungs. O2 is poorly
More informationPBL SEMINAR. HEMOGLOBIN, O 2 -TRANSPORT and CYANOSIS An Overview
1 University of Papua New Guinea School of Medicine and Health Sciences Division of Basic Medical Sciences Discipline of Biochemistry and Molecular Biology PBL SEMINAR HEMOGLOBIN, O 2 -TRANSPORT and CYANOSIS
More informationKey Concepts. Learning Objectives
Lectures 8 and 9: Protein Function, Ligand Binding -- Oxygen Binding and Allosteric Regulation in Hemoglobin [PDF] Reading: Berg, Tymoczko & Stryer, Chapter 7, pp. 183-199 problems in textbook: chapter
More informationHemoglobin and hemoglobinpathies. Srbová M., Průša R.
Hemoglobin and hemoglobinpathies Srbová M., Průša R. Hemoproteins Consist of hem cyclic tetrapyrrole 1 iron cation Fe 2+ bound in the middle of tetrapyrrole scelet by coordination covalent bonds conjugated
More informationFUNCTIONS OF HEMOGLOBIN:
HEMOGLOBIN: Conjugated protein Simple protein combined with a non-protein substance Hemoglobin HEME +GLOBIN nonprotein substance HEME( prosthetic group) Red colour of blood is due to Hb in RBCs Normal
More informationBiochemistry 15 Doctor /7/2012
Heme The Heme is a chemical structure that diffracts by light to give a red color. This chemical structure is introduced to more than one protein. So, a protein containing this heme will appear red in
More information4. THE THREE-DIMENSIONAL STRUCTURE OF PROTEINS
4. THE THREE-DIMENSIONAL STRUCTURE OF PROTEINS 4.1 Proteins Structures and Function Levels of Structure in Proteins Native conformation - Biological activity - Random structure: no obvious regular repeating
More informationNafith Abu Tarboush DDS, MSc, PhD
Nafith Abu Tarboush DDS, MSc, PhD natarboush@ju.edu.jo www.facebook.com/natarboush Types of proteins Proteins can be divided into two groups according to structure: Fibrous (fiber-like with a uniform secondary-structure
More informationGas Exchange in the Tissues
Gas Exchange in the Tissues As the systemic arterial blood enters capillaries throughout the body, it is separated from the interstitial fluid by only the thin capillary wall, which is highly permeable
More informationPHAR3316 Pharmacy biochemistry Exam #2 Fall 2010 KEY
1. How many protons is(are) lost when the amino acid Asparagine is titrated from its fully protonated state to a fully deprotonated state? A. 0 B. 1 * C. 2 D. 3 E. none Correct Answer: C (this question
More informationDr. Puntarica Suwanprathes. Version 2007
Dr. Puntarica Suwanprathes Version 2007 O 2 and CO 2 transport in blood Oxyhemoglobin dissociation curve O 2 consumption (VO 2 ) CO 2 production (VCO 2 ) O 2 capacity O 2 content: CaO 2 or CvO 2 %saturation
More informationAmino acids & Protein Structure Chemwiki: Chapter , with most emphasis on 16.3, 16.4 and 16.6
Amino acids & Protein Structure Chemwiki: Chapter 16. 16.1, 16.3-16.9 with most emphasis on 16.3, 16.4 and 16.6 1 1. Most jobs (except information storage) in cells are performed by proteins. 2. Proteins
More informationAll mutations are alterations in the nucleotide sequence of DNA. At the molecular level, we can divide mutations into two categories:
Mutations Accurate DNA replication, transcription, and translation all depend on the reliable pairing of complementary bases. Errors occur, though infrequently, in all three processes least often in DNA
More informationHaemoglobinopathies case studies 11 th Annual Sickle Cell and Thalassaemia Conference October 2017
Haemoglobinopathies case studies 11 th Annual Sickle Cell and Thalassaemia Conference 11 13 October 2017 Chris Lambert Haematology Service Delivery Manager Viapath Laboratories Kings College Hospital HUMAN
More informationProperties of amino acids in proteins
Properties of amino acids in proteins one of the primary roles of DNA (but far from the only one!!!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids
More informationPharmacist. Drugs. body physiology. ( molecular constituents)
Why? Pharmacist Drugs body physiology ( molecular constituents) Mechanistic levels of response: Altered patient response physiologic systems Vascular system blood, muscle, liver tissues / organs cellular
More informationHaemoglobin BY: MUHAMMAD RADWAN WISSAM MUHAMMAD
Haemoglobin BY: MUHAMMAD RADWAN WISSAM MUHAMMAD Introduction is the iron-containing oxygen transport metalloprotein in the red blood cells Hemoglobin in the blood carries oxygen from the respiratory organs
More informationProtein Structure and Function
Protein Structure and Function Protein Structure Classification of Proteins Based on Components Simple proteins - Proteins containing only polypeptides Conjugated proteins - Proteins containing nonpolypeptide
More informationBiology 2C03: Genetics What is a Gene?
Biology 2C03: Genetics What is a Gene? September 9 th, 2013 Model Organisms - E. coli - Yeast - Worms - Arabodopsis - Fruitflie - Mouse What is a Gene? - Define, recognize, describe and apply Mendel s
More informationREAD THIS FIRST. Your Name
Introduction to Biochemistry Final Examination - Individual (Part I) Monday, 24 May 2010 7:00 8:45 PM H. B. White Instructor 120 Points Your Name "Ability is what you're capable of doing. Motivation determines
More informationO 2 O 2 O 2. Haemoglobin
O 2 O 2 O 2 Haemoglobin O 2 O 2 O 2 98% travels in oxyhaemoglobin (in red blood cells) 2% is dissolved in plasma (compared to carbon dioxide, oxygen is relatively insoluble in plasma) O 2 is not very soluble
More informationOrganic Molecules: Proteins
Organic Molecules: Proteins Proteins Most structurally & functionally diverse group Function: involved in almost everything enzymes (pepsin, DNA polymerase) structure (keratin, collagen) carriers & transport
More informationBiochemistry. Structure and function of hemoglobin M E D I C I N E. Be like stem cells, differentiate yourself from others! Editing file PO 4.
HbA NH 2 H 2 O 2 KClO 3 Cl 2 O 7 PO 4 CH2O NAOH KMnO 4 M E D I C I N E KING SAUD UNIVERSITY Co 2 COOH MgCl 2 H 2 O Important Extra Information Doctors slides Doctors notes SO 2 HCN CCl 4 CuCl 2 Biochemistry
More informationDONE BY : RaSHA RAKAN & Bushra Saleem
DONE BY : RaSHA RAKAN & Bushra Saleem Hemolytic anemias (2 of 2) Sickle Cell Anemia The most common familial hemolytic anemia in the world Sickle cell anemia is the prototypical (and most prevalent) hemoglobinopathy
More informationQ1: Circle the best correct answer: (15 marks)
Q1: Circle the best correct answer: (15 marks) 1. Which one of the following incorrectly pairs an amino acid with a valid chemical characteristic a. Glycine, is chiral b. Tyrosine and tryptophan; at neutral
More informationProteins. Big Idea 4: Biological Systems Interact
Proteins Big Idea 4: Biological Systems Interact Essential Knowledge Essential knowledge 4.B.1: Interactions between molecules affect their structure and function. a. Change in the structure of a molecular
More informationIntroductory slide with title and major topics. Footer with last name, course and year on each slide
Introductory slide with title and major topics Footer with last name, course and year on each slide From your undergraduate education, summer biochemistry pre- matriculation studies or prep work for this
More informationSickle Cell Disease and impact on the society
Sickle Cell Disease and impact on the society Professor Z.A.Jeremiah Ph.D, FRCPath (London) Professor of Haematology and Blood Transfusion Science Niger Delta University, Wilberforce Island Outline What
More informationMultiple-Choice Questions Answer ALL 20 multiple-choice questions on the Scantron Card in PENCIL
Multiple-Choice Questions Answer ALL 20 multiple-choice questions on the Scantron Card in PENCIL For Questions 1-10 choose ONE INCORRECT answer. 1. Which ONE of the following statements concerning the
More informationAnemia s. Troy Lund MSMS PhD MD
Anemia s Troy Lund MSMS PhD MD lundx072@umn.edu Hemoglobinopathy/Anemia IOM take home points. 1. How do we identify the condtion? Smear, CBC Solubility Test (SCD) 2. How does it present clincally? 3. How
More informationBiochemistry by Mary K. Campbell & Shawn O. Farrell
4 Biochemistry by Mary K. Campbell & Shawn O. Farrell 4-1 4 The ThreeDimensional Structure of Proteins 4-2 4 Learning Objectives 1. How does the Structure of Proteins Determine Their Function? 2. What
More informationCh5: Macromolecules. Proteins
Ch5: Macromolecules Proteins Essential Knowledge 4.A.1 The subcomponents of biological molecules and their sequence determine the properties of that molecule A. Structure and function of polymers are derived
More informationHEMOGLOBINOPATHIES LECTURE OUTLINE. An overview of the structure of hemoglobin. Different types of hemoglobin. Definition of hemoglobinopathies
Slide 1 HEOGLOBINOPATHIES Slide 2 LETURE OUTLINE An overview of the structure of hemoglobin. Different types of hemoglobin. Definition of hemoglobinopathies Sickle ell Disease and Hemoglobin Slide 3 HEOGLOBIN
More informationHemoglobin & Sickle Cell Anemia Exercise
Name StarBiochem Hemoglobin & Sickle Cell Anemia Exercise Learning Objectives In this exercise, you will use StarBiochem, a protein 3D viewer, to explore the structure of the normal hemoglobin protein
More informationNafith Abu Tarboush DDS, MSc, PhD
Nafith Abu Tarboush DDS, MSc, PhD natarboush@ju.edu.jo www.facebook.com/natarboush http://eacademic.ju.edu.jo/n.abutarboush/material/forms/allitems.aspx Biological Functions of Proteins Enzymes--catalysts
More informationMolecular Biology. general transfer: occurs normally in cells. special transfer: occurs only in the laboratory in specific conditions.
Chapter 9: Proteins Molecular Biology replication general transfer: occurs normally in cells transcription special transfer: occurs only in the laboratory in specific conditions translation unknown transfer:
More informationGeorge R. Honig Junius G. Adams III. Human Hemoglobin. Genetics. Springer-Verlag Wien New York
George R. Honig Junius G. Adams III Human Hemoglobin Genetics Springer-Verlag Wien New York George R. Honig, M.D., Ph.D. Professor and Head Department of Pediatrics, College of Medicine University of Illinois
More informationAnatomy and Physiology
Anatomy and Physiology For The First Class 2 nd Semester Erythrocytes = Red Blood Cells (RBC) Erythrocytes = Red Blood Cells Red blood cells are biconcave discs, they have no nucleus and cytoplasmic organelles.
More informationCopyright 2008 Pearson Education, Inc., publishing as Pearson Benjamin Cummings
Concept 5.4: Proteins have many structures, resulting in a wide range of functions Proteins account for more than 50% of the dry mass of most cells Protein functions include structural support, storage,
More informationHaemoglobinopathy Case Studies. Dr Jill Finlayson Department of Haematology Pathwest Laboratory Medicine
Haemoglobinopathy Case Studies Dr Jill Finlayson Department of Haematology Pathwest Laboratory Medicine Case 1 KB, 36y M Refugee Afghanistan Screening bloods Hb 101 g/l RCC 3.75 x10 12 /L MCV 90 fl MCH
More informationLecture #1. Done By : Rasha Rakan. Corrected by: Obadah Abubaker
Lecture #1 Done By : Rasha Rakan Corrected by: Obadah Abubaker مالحظة: المكتوب باللون األسود هو ما كتب ف السال دات وما كتب باللون األزرق فهو كالم الدكتور أثناء المحاضرة وللذ ن قومون بتصو ر الش ت جعلنا
More informationAP Bio. Protiens Chapter 5 1
Concept.4: Proteins have many structures, resulting in a wide range of functions Proteins account for more than 0% of the dry mass of most cells Protein functions include structural support, storage, transport,
More informationAround million aged erythrocytes/hour are broken down.
Anemia Degradation ofheme Around 100 200 million aged erythrocytes/hour are broken down. The degradation process starts in reticuloendothelial cells in the spleen, liver, and bone marrow. [1] The tetrapyrrole
More informationSickle Cell Anemia A Fictional Reconstruction Answer Key
We have made it easy for you to find a PDF Ebooks without any digging. And by having access to our ebooks online or by storing it on your computer, you have convenient answers with sickle cell anemia a
More informationHemoglobin & Sickle Cell Anemia Exercise
Name StarBiochem Hemoglobin & Sickle Cell Anemia Exercise Background Hemoglobin is the protein in red blood cells responsible for carrying oxygen from the lungs to the rest of the body and for returning
More informationThalassemias:general aspects and molecular pathology
Thalassemias:general aspects and molecular pathology Prof. Renzo Galanello Pediatric Clinic 2 University of Cagliari Ospedale Regionale Microcitemie-ASL8 HEMOGLOBINOPATHIES CLASSIFICATION Structurally
More information2,3BPG & Smoking. When the carve is shifted to the right decreasing in O2 binging affinity b.c the change in the shape &function
Where do protons bind to Hemoglobin? It could bind in dissociated carboxyl group in Hb or in dissociate amino group ( NH+3, COOH ) Protons change Hb shape, How? Once proton bind to Hb it will produce +
More informationThe Structure and Function of Macromolecules
The Structure and Function of Macromolecules Macromolecules are polymers Polymer long molecule consisting of many similar building blocks. Monomer the small building block molecules. Carbohydrates, proteins
More informationMethionine (Met or M)
Fig. 5-17 Nonpolar Fig. 5-17a Nonpolar Glycine (Gly or G) Alanine (Ala or A) Valine (Val or V) Leucine (Leu or L) Isoleucine (Ile or I) Methionine (Met or M) Phenylalanine (Phe or F) Polar Trypotphan (Trp
More informationShort, 2 point questions. Be brief, but not vague. Specfic details are needed.
Biochemistry Exam II Fall 2012 Dr. Stone Name There are 11 short answer/ multiple choice questions worth 2 points each. There are six long answer questions worth a total of 68 points. Short, 2 point questions.
More informationBiological Sciences 4087 Exam I 9/20/11
Name: Biological Sciences 4087 Exam I 9/20/11 Total: 100 points Be sure to include units where appropriate. Show all calculations. There are 5 pages and 11 questions. 1.(20pts)A. If ph = 4.6, [H + ] =
More informationCS612 - Algorithms in Bioinformatics
Spring 2016 Protein Structure February 7, 2016 Introduction to Protein Structure A protein is a linear chain of organic molecular building blocks called amino acids. Introduction to Protein Structure Amine
More informationHemolytic anemias (2 of 2)
Hemolytic anemias (2 of 2) Sickle Cell Anemia The most common familial hemolytic anemia in the world Sickle cell anemia is the prototypical (and most prevalent) hemoglobinopathy Mutation in the β-globin
More informationDr.Abdolreza Afrasiabi
Dr.Abdolreza Afrasiabi Thalassemia & Heamophilia Genetic Reaserch Center Shiraz Medical University Hemoglobin tetramer Hemoglobin Structure % A 1 α 2 β 2 94-97% A 2 α 2 δ 2 2.5% A 1C α 2 (β-n-glucose)
More informationUnraveling Hemoglobinopathies with Capillary Electrophoresis
Session Number 2002 Unraveling Hemoglobinopathies with Capillary Electrophoresis David F. Keren, M.D. Professor of Pathology Division Director, Clinical Pathology The University of Michigan dkeren@med.umich.edu
More informationHEMOGLOBIN ELECTROPHORESIS DR ARASH ALGHASI SHAFA HOSPITAL-AHWAZ
HEMOGLOBIN ELECTROPHORESIS DR ARASH ALGHASI SHAFA HOSPITAL-AHWAZ Hemoglobin Hemoglobin (Hb), protein constituting 1/3 of the red blood cells Each red cell has 640 million molecules of Hb sites in the cells:
More informationShort polymer. Dehydration removes a water molecule, forming a new bond. Longer polymer (a) Dehydration reaction in the synthesis of a polymer
HO 1 2 3 H HO H Short polymer Dehydration removes a water molecule, forming a new bond Unlinked monomer H 2 O HO 1 2 3 4 H Longer polymer (a) Dehydration reaction in the synthesis of a polymer HO 1 2 3
More informationChemistry and Biochemistry 153A Spring Exam 2
hemistry and Biochemistry 153A Spring 2011 Exam 2 Instructions: You will have 1 hour 45 minutes to complete the exam. You may use a pencil (recommended) or blue or black ink pen to write your answers.
More informationChapter 15. Enzyme Regulation. Activity? Part 1 Factors that influence enzymatic activity
Chapter 15 Enzyme Regulation http://lms.ls.ntou.edu.tw/course/106ls tw/course/106 hanjia@mail.ntou.edu.tw Reginald H. Garrett Charles M. Grisham Essential Questions Before this class, ask your self the
More informationIntroduction to Protein Structure Collection
Introduction to Protein Structure Collection Teaching Points This collection is designed to introduce students to the concepts of protein structure and biochemistry. Different activities guide students
More informationv o = V max [S] rate = kt[s] e V max = k cat E t ΔG = -RT lnk eq K m + [S]
Exam 3 Spring 2017 Dr. Stone 8:00 Name There are 100 possible points on this exam. -ΔG / RT v o = V max [S] rate = kt[s] e V max = k cat E t ΔG = -RT lnk eq K m + [S] h rate forward = k forward [reactants]
More informationRaghad Abu Jebbeh. Amani Nofal. Mamoon Ahram
... 14 Raghad Abu Jebbeh Amani Nofal Mamoon Ahram This sheet includes part of lec.13 + lec.14. Amino acid peptide protein Terminology: 1- Residue: a subunit that is a part of a large molecule. 2- Dipeptide:
More informationHemoglobin and anemia BCH 471
Hemoglobin and anemia BCH 471 OBJECTIVES Quantitative determination of hemoglobin in a blood sample. Hemoglobin structure Hemoglobin (Hb) is a porphyrin iron (II) protein in RBCs that transport oxygen
More informationCHY2026: General Biochemistry. Unit 4:Amino Acid Chemistry
CHY2026: General Biochemistry Unit 4:Amino Acid Chemistry http://www.hcc.mnscu.edu/programs/dept/chem/v.27/amino_acid_structure_2.jpg Hydrogen Amino group Carboxyl Group Unique side chain (R-group) R Central
More informationIn adults, the predominant Hb (HbA) molecule has four chains: two α and two β chains. In thalassemias, the synthesis of either the α or the β chains
Thalassaemias Thalassemia Thalassemia is an inherited autosomal recessive blood disease. Associated with absence or reduction in a or b globin chains. Reduced synthesis of one of the globin chains can
More informationChem Exam 2 (A) Name
Chem 4511 Exam 2 (A) Name No credit will be given for answers (or work) that are on the backsides of the pages. You may use the backsides as scratch paper, but put all of your answers on the front sides.
More informationThe Structure and Function of Large Biological Molecules Part 4: Proteins Chapter 5
Key Concepts: The Structure and Function of Large Biological Molecules Part 4: Proteins Chapter 5 Proteins include a diversity of structures, resulting in a wide range of functions Proteins Enzymatic s
More informationFind this material useful? You can help our team to keep this site up and bring you even more content consider donating via the link on our site.
Find this material useful? You can help our team to keep this site up and bring you even more content consider donating via the link on our site. Still having trouble understanding the material? Check
More informationThe Challenging Diagnosis of Treacherous Hemoglobinopathies
The Challenging Diagnosis of Treacherous Hemoglobinopathies David F. Keren, M.D. Professor of Pathology The University of Michigan dkeren@med.umich.edu Objectives Use Capillary Electrophoresis and HPLC
More informationHuman Genetic Diseases. AP Biology
Human Genetic Diseases 1 2 2006-2007 3 4 5 6 Pedigree analysis Pedigree analysis reveals Mendelian patterns in human inheritance data mapped on a family tree = male = female = male w/ trait = female w/
More informationIntroduction to Biochemistry Midterm exam )ومن أحياها(
Introduction to Biochemistry Midterm exam 2016-2017 )ومن أحياها( 1. Which of the following amino (in a peptide chain) would probably be found at a beta bend or turn? a. lysine * b. Gly c. arg d. asn 2.
More informationStudent number. University of Guelph Department of Chemistry and Biochemistry Structure and Function In Biochemistry
University of Guelph Department of Chemistry and Biochemistry 19356 Structure and Function In Biochemistry Midterm Test, March 3, 1998. Time allowed, 90 min. Answer questions 120 on the computer scoring
More informationThe Making of the Fittest: Natural Selection in Humans
INTRODUCTION MENDELIAN GENETICS, PROBABILITY, PEDIGREES, AND CHI-SQUARE STATISTICS Hemoglobin is a protein found in red blood cells (RBCs) that transports oxygen throughout the body. The hemoglobin protein
More informationComprehensive Hemoglobin Analysis HBA1/2 (
Comprehensive Hemoglobin Analysis HBA1/2 ( α-globin) and HBB (β-globin) mutation and deletion/duplication analysis and HBD (δ-globin) and HBG1/2 (γ-globin) mutation analysis Description: Hemoglobin (Hb)
More informationPeptides. The two amino acids are joined through a dehydration reaction.
Peptides Peptides The two amino acids are joined through a dehydration reaction. Peptides The Peptide Bond The peptide bond is usually drawn as a single bond, but actually has considerable double bond
More informationLast time we finished the abnormal hemoglobins. We have some hemoglobin. 5 Abdel-muez siyam Abdullah nimer Dr. nayef. Page 1
Last time we finished the abnormal hemoglobins. We have some hemoglobin 5 Abdel-muez siyam Abdullah nimer Dr. nayef Page 1 derivatives (mostly outside the book) that are of importance: 1. Normal derivatives:
More informationHuman Genetic Diseases (Ch. 15)
Human Genetic Diseases (Ch. 15) 1 2 2006-2007 3 4 5 6 Genetic counseling Pedigrees can help us understand the past & predict the future Thousands of genetic disorders are inherited as simple recessive
More informationاالمتحان النهائي لعام 1122
االمتحان النهائي لعام 1122 Amino Acids : 1- which of the following amino acid is unlikely to be found in an alpha-helix due to its cyclic structure : -phenylalanine -tryptophan -proline -lysine 2- : assuming
More informationMUTATIONS, MUTAGENESIS, AND CARCINOGENESIS. (Start your clickers)
MUTATIONS, MUTAGENESIS, AND CARCINOGENESIS (Start your clickers) How do mutations arise? And how do they affect a cell and its organism? Mutations: heritable changes in genes Mutations occur in DNA But
More informationHuman Biochemistry Option B
Human Biochemistry Option B A look ahead... Your body has many functions to perform every day: Structural support, genetic information, communication, energy supply, metabolism Right now, thousands of
More informationBelow are the sections of the DNA sequences of a normal hemoglobin gene and the mutated gene that causes sickle cell disease.
Sickle Cell Analysis Directions: Read the information below to complete the two tables. A person with sickle-cell disease has the genotype: Hb s Hb s. People who have this condition have two abnormal genes,
More informationCHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith
CHAPTER 21: Amino Acids, Proteins, & Enzymes General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, Enzymes Learning Objectives: q The 20 common, naturally occurring
More informationبسم هللا الرحمن الرحيم
بسم هللا الرحمن الرحيم Q1: the overall folding of a single protein subunit is called : -tertiary structure -primary structure -secondary structure -quaternary structure -all of the above Q2 : disulfide
More informationHAEMOGLOBIN ESTIMATION
HAEMOGLOBIN ESTIMATION STRUCTURE OF HAEMOGLOBIN: Haemoglobin is a chromoprotein consisting of the colourless globin and four red coloured haem molecules. Haemoglobin is a metal complex, containing an
More informationG = Energy of activation
Biochemistry I, CHEM 4400 Exam 2 10:00 Fall 2015 Dr. Stone Name rate forward = k forward [reactants] rate reverse = k reverse [products] K eq = [products]/[reactants] ΔG = ΔH - TΔS ΔG = ΔG + RT ln Q Q
More informationProteins and their structure
Proteins and their structure Proteins are the most abundant biological macromolecules, occurring in all cells and all parts of cells. Proteins also occur in great variety; thousands of different kinds,
More informationPROTEINS. Amino acids are the building blocks of proteins. Acid L-form * * Lecture 6 Macromolecules #2 O = N -C -C-O.
Proteins: Linear polymers of amino acids workhorses of the cell tools, machines & scaffolds Lecture 6 Macromolecules #2 PRTEINS 1 Enzymes catalysts that mediate reactions, increase reaction rate Structural
More informationTransport of oxygen and carbon dioxide in body fluids. Circulation and Hearts. Circulation in vertebrates and invertebrates
Circulation Transport of oxygen and carbon dioxide in body fluids Circulation and Hearts Circulation in vertebrates and invertebrates Respiratory pigments Increase the amount of oxygen carried by blood
More informationAmino Acids. Review I: Protein Structure. Amino Acids: Structures. Amino Acids (contd.) Rajan Munshi
Review I: Protein Structure Rajan Munshi BBSI @ Pitt 2005 Department of Computational Biology University of Pittsburgh School of Medicine May 24, 2005 Amino Acids Building blocks of proteins 20 amino acids
More informationSickle cell disease. Fareed Omar 10 March 2018
Sickle cell disease Fareed Omar 10 March 2018 Physiology Haemoglobin structure HbA2: 2α and 2δ chains (2-3%) HbF: 2α and 2γ chains (
More information