SODs and their metallochaperones in mitochondrial antioxidant defense
|
|
- Loreen Lawson
- 5 years ago
- Views:
Transcription
1 ODs and their metallochaperones in mitochondrial antioxidant defense
2 The mitochondria as a factory for RO O 2? - O 2? - O 2? - O 2? - O 2? - O 2? - O 2? - O 2? -
3 Mn OD2
4 The metal containing superoxide dismutases.- + 2O 2 + 2H H 2 O 2 + O 2 OD1 = cytosolic, copper-requiring OD2 = mitochondria, manganese-requiring
5 Cu/Zn OD1 Highly conserved among eukaryotes Maturation of OD1: 1. Zinc insertion 2. Copper insertion 3. Disulfide bond formation Zn Cu Zn Cu OD1 Homodimer
6 1) O 2?- + Cu ++ Cu + + O 2 2) O 2? - + Cu + + 2H + Cu ++ + H 2 O 2 From Tainer et al., JMB 1982
7 OD1: Disulfide formation between C57 and C146 C146 C57 A rare cytosolic disulfide
8 Copper chaperones: escort proteins for metals From O Halloran and Culotta, J. Biol. Chem. 2000
9 Yeast cells lacking CC have no OD1 activity Wild type CC- Mn OD2 Cu/Zn OD1 Native gel assay for OD activity Western for OD1 protein
10 Mammalian OD1 has low activity without CC OD1 activity From Wong et al. Proc. Natl. Acad ci 2000
11 Copper activation of OD1 via CC From O Halloran and Culotta 2000
12 A fraction of OD1 and its copper chaperone CC localize to the mitochondria of yeast OD1 PM MIT0 CC MGE1 (mito) PGK1 (cyto) PM = post mitochondrial spnt; largely cytosol From turtz et al., JBC 2001
13 OD1 and CC localize to the intermembrane space of mitochondria PM Mito IM Mat OD1 CC PM = post-mitochondrial supernatant Mito = mitochondria IM = intermembrane space Mat = matrix turtz, et al. JBC 2001
14 OD1 in the mitochondria shows activity Wild type sod2? null PM mito PM mito OD2 activity OD1 activity OD1 polypeptide From turtz et al., JBC 2001
15 Mn OD2
16 What is the form of OD1 that enters mitochondria? H H H H H H Zn Zn Zn Zn H H H H Zn Cu Zn Cu Zn Cu Zn Cu H H
17 Apo, reduced OD1 is taken up most efficiently by mitochondria during in vitro import mitochondrial OD1 -OD1 E,E H E,E - E,Zn H E,Zn - Cu,Zn - Total OD1 Field, et al. JBC 2003
18 Mature OD1 Zn Cu Zn Cu Zn H H CC Zn H H Zn Cytosol Cu H H Mitochondrial IM H Zn Cu Zn Cu Zn H H CC Zn H H Zn H Mature OD1 Cu
19 OD1 appears to follow CC into mitochondria Mito IM pre-seq Yeast CC Cells expressing: Native CC pre-seq CC PM Mit IM Matrix PM Mit IM Matrix CC CC OD1 * * OD1 From turtz et al., JBC 2001
20 High levels of OD1 activity in cells with high mitochondrial CC Cells expressing: Native CC preseq-cc P M P M OD1 protein OD1 activity
21 How does CC affect mitochondrial accumulation of OD1? C C C C C C C Co-import? Mitochondrial retention?
22 CC helps to retain OD1 in the mitochondria No mitochondrial CC Total Retained Abundant mitochondrial CC Total Retained Mitochondrial OD1 C C C C Field, et al. JBC 2003
23 Disrupting OD1-CC interactions OD1 FG50,51EE (disrupts dimer interface) From Lamb et al., Nat. truc. Biol. 2001
24 OD1: P WT M F50E, G51E P M OD2 OD1 OD1 Disrupting the dimerization interface between OD1 and CC prevents mitochondrial accumulation of OD1 CC Field, et al. JBC 2003
25 tationary Phase urvival: A marker of chronological lifespan and oxidative damage Chronological life span in yeast: time a nondividing cell will survive in stationary phase Markers of oxidative damage and mitochondrial RO increase with time in stationary phase tationary phase survival is strongly influenced by anti-oxidant enzyme activity From the labs of V. Longo, J. Valentine, E. Gralla and T. Bilinski
26 sod1? yeast exhibit a shortened lifespan during stationary phase Day 2 WT sod1? turtz, et al. JBC 2001
27 IM OD1 prolongs lifespan during stationary phase OD2 OD1 native PM MITO IM-enriched PMMITO Day 2 Day 5 native OD1 IM-enriched OD1 turtz, et al. JBC 2001
28 Human OD1 mutations and familial AL (Lou Gehrigs disease)
29 Eukaryotic mitochondrial OD2 - a homotetramer D159 H163 From Borgstahl et al., Cell ) O 2?- + Mn +++ Mn ++ + O 2 2) O 2?- + Mn H + Mn H 2 O 2
30 OD2 must acquire its Mn in the mitochondria ynthesized in cytosol Activated in mitochondria
31 Mn insertion and mitochondrial import of OD1 appear coupled Newly synthesized OD2?
32 Possible mitochondrial transporters for manganese: The MCF (mito carrier family) transporters Intermembrane space N term C term Mitochondrial inner membrane Mitochondrial matrix
33 YGR257c = an unknown member of MCF family of mito transporters WT YGR257c? OD2 OD1 YGR257c deletion leads to virtual inactivation of OD2. OD1 activity increases probably due to compensatory mechanism.? -od2p
34 upplementation of Mn (but not other metals) fully restores OD2 activity WT ygr257c? WT ygr257c? WT ygr257c? +Mn +Cu +Fe WT ygr257c? OD2 OD1? -od2p
35 The MCF family of. cerevisiae Gene Loci Function Gene Loci Function MIR1 YJR077C phosphate AAC1 YMR056C ADP/ATP AAC2 YBL030C ADP/ATP AAC3 YBR085W ADP/ATP ARG11 YOR130C ornithine CAC1 YOR100C carnitine CTP1 YBR291C citrate ACR1 YJR095W dicarboxylate OAC1 YKL120W oxaloacetate DIC1 YLR348C dicarboxylate FLX1 YIL134W flavin LEU5 YHR002W acetylcoa MR3 YJL133W Mg++, Fe++? MR4 YKR052C Mg++, Fe++? RIM2 YBR192W Fe++, cysteine? YMC1 YPR058W? YMC2 YBR104W? PET8 YNL003C? YHM1 YDL198C? - YMR241W?? - YPR011C?? - YHR002W?? - YNL083W?? - YGR096W?? - YOR222W?? - YPL134C?? - YEL006W?? - YIL006W?? - YPR128C?? - YER053C?? - YER053C?? - YFR045W?? - YPR021C?? - YMR166C?? MTM1 YGR257C Mito transporter for Mn - YDL119C?? - YDR470C??
36 Mitochondrial manganese 100 Mitochondrial Mn (ng/mgs protein) 50 Wild type mtm1?
37
38 Human homologue to MTM1 Yeast Human Yeast Human Yeast Human Yeast Human Yeast Human Yeast Human ERMLAGAGVLTLI LTPMDVVRIR LQQQQMIP DCCDGAAEVPNAVGKMKTFTNV M+++GAG+V+TL +TP+DVV++RLQ Q+ P + K QQMVAGAGAVVTLF MTPLDVVKVRLQQRP ATELTTPRFWLYTKAL 6 8 GGQNLNNAKIF WEACFQELHCKN LKFNGTLEAFTKIA VEGI TLWRG 1 24 Q+ ++ C N + +F GTL+AF K I E G +LW G - - QPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRFTGTLDAFVKIV RHEGTRTLWG 1 26 I LTLLMAI PANMVYFGYEYI RD-VPI ATYPTLNPLFCGAI ARVFAATIA PLELVK T L+ M + PA + YF+ Y T P+ GA+AR+ T ++ PLELV+ LPATLVMTVPATAI YFTAYDQLKAFLCGQLTDLYAPMVAGALARMGTVTVVPLELVR 1 86 TKLQI PRKTKTWMMVKDLLNETRQEMKMVGPRALFKGLEI TLWRDVPF AI YW 2 43 TKLQ+ + L + Q G R+L+ G T RDVPFA+YW + TKLQAQHVYRE LAVQAAVTQGGWRLWLGWGPTALRDVPFALYWFN 2 36 YELCKERLWLDTRFAKDANWVHFI NFAGCI GMIA AI CTHPFDVGKTRWQI MMNN 3 03 YEL K W L R KD V F +G I GM+AA T PFDV KT+ Q++ YELVK- - WL GLR-- PKDQTVGI- - FVAGGI GMVAATLTLPFDVVKTQRQMLGAV 2 90 DPK-GGNRRNMFKFLETIWRTEGLAALYTGLAARVIK I RPCAI MI YEI KKVF R + + L I G L+ G R+IK P CAI MI +YE K F EAVRVKPPRVDTWLLLRRIR AEGTRGLFAGFLPRI IK AAPCAI MI TYEFGKFF 34 8
Time period
1 Expression of Genes involved in"1,4 alpha glucan branching enzyme" enzyme YEL11W.5.5.5 2 2.5 Expression of Genes involved in"1 phosphatidylinositol 4,5 bisphosphate phosphodiesterase" enzyme 2 YPL268W
More informationSystematic Investigation of Metabolic Reprogramming in Different Cancers Based on Tissue-specific Metabolic Models
Shanghai Jiao Tong University Systematic Investigation of Metabolic Reprogramming in Different Cancers Based on Tissue-specific Metabolic Models Fangzhou Shen, Jian Li, Ying Zhu, Zhuo Wang 王卓 zhuowang@sjtu.edu.cn
More informationPositional analyses of BRCA1-dependent expression in Saccharomyces cerevisiae
[Cell Cycle 7:24, 3928-3934; 15 December 2008]; 2008 Landes Bioscience Report Positional analyses of BRCA1-dependent expression in Saccharomyces cerevisiae Robert V. Skibbens,* Danielle N. Ringhoff, Jutta
More informationMetals in Redox Biology C O R Y B O O N E, C E C I L I A H A G E R T, Q I A N G MA R E D O X - C O U R S E
Metals in Redox Biology C O R Y B O O N E, C E C I L I A H A G E R T, Q I A N G MA R E D O X - C O U R S E 2 0 1 2 Metals Producing ROS M A Q I A N G ROS as a class includes superoxide radical anion (O
More informationGenome-wide expression analyses: Metabolic adaptation of Saccharomyces cerevisiae to high sugar stress
FEMS Yeast Research 3 (2003) 375^399 www.fems-microbiology.org Abstract Genome-wide expression analyses: Metabolic adaptation of Saccharomyces cerevisiae to high sugar stress Daniel J. Erasmus, George
More informationAntioxidant Enzymes. - Superoxide dismutases (SODs) - Catalases - Peroxiredoxins - Glutathione peroxidases
Antioxidant Enzymes - Superoxide dismutases (SODs) - Catalases - Peroxiredoxins - Glutathione peroxidases Eva Maria Steiner, Samantha Swenson, Mattias Günther and Xiaoxiao Peng 1 Eva Maria Steiner June
More informationManganese activation of superoxide dismutase 2 in Saccharomyces cerevisiae requires MTM1, a member of the mitochondrial carrier family
Manganese activation of superoxide dismutase 2 in Saccharomyces cerevisiae requires MTM1, a member of the mitochondrial carrier family Edward Luk*, Mark Carroll, Michelle Baker, and Valeria Cizewski Culotta*
More informationTwo-dimensional protein map of an ale -brewing yeast strain: proteome dynamics during fermentation
FEMS Yeast Research 5 (2004) 213 230 www.fems-microbiology.org Two-dimensional protein map of an ale -brewing yeast strain: proteome dynamics during fermentation Dominique Kobi a, Sandra Zugmeyer a, Serge
More informationAdvance Access published June 16, 2004
Advance Access published June 16, 2004 Journal of Antimicrobial Chemotherapy DOI: 10.1093/jac/dkh336 JAC Genome-wide expression profiling reveals genes associated with amphotericin B and fluconazole resistance
More informationC. Wang et al. 3 SI TABLE S1. List of genes encoding characterized and putative yeast kinases
C. Wang et al. 3 SI TABLE S1 List of genes encoding characterized and putative yeast kinases No. Standard Position in KO Name collection Annotation Systematic Name Alpha' catalytic subunit of casein kinase
More informationMia40 and MINOS act in parallel with Ccs1 in the biogenesis of mitochondrial Sod1
Mia40 and MINOS act in parallel with Ccs1 in the biogenesis of mitochondrial Sod1 Aksana Varabyova, Ulrike Topf, Paulina Kwiatkowska, Lidia Wrobel, Magdalena Kaus-Drobek* and Agnieszka Chacinska International
More informationKey to deletion results
Key to deletion results ORF ORF name Gene name Gene annotation (from SGD) Essential (YPD) simulation Essential call (/TN) Slow growth simulation Slow growth experimental [Giaever02] Slow growth call (/TN)
More informationComponent plane presentation integrated self-organizing map for microarray data analysis
FEBS 27042 FEBS Letters 538 (2003) 117^124 Component plane presentation integrated self-organizing map for microarray data analysis Li Xiao a;1, Kankan Wang b;1, Yue Teng c, Ji Zhang a;c; a Center for
More informationThe Sensitivity of Yeast Mutants to Oleic Acid Implicates the Peroxisome and Other Processes in Membrane Function
Copyright Ó 2007 by the Genetics Society of America DOI: 10.1534/genetics.106.064428 The Sensitivity of Yeast Mutants to Oleic Acid Implicates the Peroxisome and Other Processes in Membrane Function Daniel
More informationOxidative Phosphorylation
Oxidative Phosphorylation Energy from Reduced Fuels Is Used to Synthesize ATP in Animals Carbohydrates, lipids, and amino acids are the main reduced fuels for the cell. Electrons from reduced fuels are
More informationThis student paper was written as an assignment in the graduate course
77:222 Spring 2001 Free Radicals in Biology and Medicine Page 0 This student paper was written as an assignment in the graduate course Free Radicals in Biology and Medicine (77:222, Spring 2001) offered
More informationanalysis of the Saccharomyces cerevisiae 26S proteasome.
Physiol Genomics 7: 27-34, 2001. Two-hybrid analysis of the Saccharomyces cerevisiae 26S proteasome GERARD CAGNEY, 1 PETER UETZ, 1 AND STANLEY FIELDS 1,2 1 Departments of Genetics and Medicine and 2 Howard
More informationThe nuclear localization of SWI/SNF proteins is subjected to oxygen regulation
Dastidar et al. Cell & Bioscience 2012, 2:30 Cell & Bioscience RESEARCH Open Access The nuclear localization of SWI/SNF proteins is subjected to oxygen regulation Ranita Ghosh Dastidar, Jagmohan Hooda,
More informationAnalysis of the vacuolar luminal proteome of Saccharomyces cerevisiae
Analysis of the vacuolar luminal proteome of Saccharomyces cerevisiae Jean-Emmanuel Sarry 1 *, Sixue Chen 2 *, Richard P. Collum 1, Shun Liang 1, Mingsheng Peng 1, Albert Lang 1, Bianca Naumann 1, Florence
More informationAlcohol-conferred hemolysis in yeast is a consequence of increased respiratory burden
Alcohol-conferred hemolysis in yeast is a consequence of increased respiratory burden Amir Shuster 1,2,3, Nir Osherov 1,2, Alicia Leikin-Frenkel 4 & Mel Rosenberg 1,2,3 1 Department of Human Microbiology,
More informationObjective: You will be able to construct an explanation for how each phase of respiration captures and stores free energy.
Objective: You will be able to construct an explanation for how each phase of respiration captures and stores free energy. Do Now: Compare and contrast the three black equations below ADP + P + Energy
More informationBiochemical Comparison of Commercial Selenium Yeast Preparations
Biol Trace Elem Res (2015) 166:245 259 DOI 10.1007/s12011-015-0242-6 Biochemical Comparison of Commercial Selenium Yeast Preparations Sheena Fagan & Rebecca Owens & Patrick Ward & Cathal Connolly & Sean
More information19 Oxidative Phosphorylation and Photophosphorylation W. H. Freeman and Company
19 Oxidative Phosphorylation and Photophosphorylation 2013 W. H. Freeman and Company CHAPTER 19 Oxidative Phosphorylation and Photophosphorylation Key topics: Electron transport chain in mitochondria Capture
More informationPathways conservation. Starch and sucrose metabolism. About Search Families Download Top Help! Blast Publications CBiB.
Pathways conservation About Search Families Download Top Help! Blast Publications CBiB Starch and sucrose metabolism (link to KEGG) Synthetic pattern of the pathway : sckdy Reference Protein Genolevures
More informationChapter 7: How Cells Harvest Energy AP
Chapter 7: How Cells Harvest Energy AP Essential Knowledge 1.B.1 distributed among organisms today. (7.1) 1.D.2 Organisms share many conserved core processes and features that evolved and are widely Scientific
More informationHost co-factors of the retrovirus-like transposon Ty1
Host co-factors of the retrovirus-like transposon Ty1 Curcio et al. Curcio et al. Mobile DNA 2012, 3:12 Curcio et al. Mobile DNA 2012, 3:12 RESEARCH Open Access Host co-factors of the retrovirus-like transposon
More informationIGOR V. KARPICHEV AND GILLIAN M. SMALL* Department of Cell Biology and Anatomy, Mount Sinai School of Medicine, New York, New York 10029
MOLECULAR AND CELLULAR BIOLOGY, Nov. 1998, p. 6560 6570 Vol. 18, No. 11 0270-7306/98/$04.00 0 Copyright 1998, American Society for Microbiology. All Rights Reserved. Global Regulatory Functions of Oaf1p
More informationAPC1, APC2, CDC16, CDC23, CDC27, DOC1 Anaphase-promoting complex, cyclosome
Supplementary material S4. Annotated list of es Table S3. Annotated list of es: comparison with known interaction data "Entry points" gives the names of the proteins tagged and purified. The " found protein"
More informationCoupling of the transcriptional regulation of glutathione biosynthesis to the
JBC Papers in Press. Published on September 26, 2003 as Manuscript M310156200 Coupling of the transcriptional regulation of glutathione biosynthesis to the availability of glutathione and methionine via
More informationTABLE S1. Deletion strains that confer an Ino- phenotype
Deletion strains that confer an Ino- phenotype YJR083C ACF4 + + S Protein of unknown function YDL203C ACK1 + + S Protein that functions upstream of the PKC-CWI signaling pathway YDR448W ADA2 S W W Transcription
More informationProtein sorting (endoplasmic reticulum) Dr. Diala Abu-Hsasan School of Medicine
Protein sorting (endoplasmic reticulum) Dr. Diala Abu-Hsasan School of Medicine dr.abuhassand@gmail.com An overview of cellular components Endoplasmic reticulum (ER) It is a network of membrane-enclosed
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Respiration Practice Name MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. 1) Which of the following statements describes NAD+? A) NAD+ can donate
More informationMITOCHONDRIA LECTURES OVERVIEW
1 MITOCHONDRIA LECTURES OVERVIEW A. MITOCHONDRIA LECTURES OVERVIEW Mitochondrial Structure The arrangement of membranes: distinct inner and outer membranes, The location of ATPase, DNA and ribosomes The
More informationThis student paper was written as an assignment in the graduate course
77:222 Spring 2003 Free Radicals in Biology and Medicine Page 0 This student paper was written as an assignment in the graduate course Free Radicals in Biology and Medicine (77:222, Spring 2003) offered
More informationRole of PUG1 in Inducible Porphyrin and Heme Transport in Saccharomyces cerevisiae
EUKARYOTIC CELL, May 2008, p. 859 871 Vol. 7, No. 5 1535-9778/08/$08.00 0 doi:10.1128/ec.00414-07 Copyright 2008, American Society for Microbiology. All Rights Reserved. Role of PUG1 in Inducible Porphyrin
More informationAhmad Ulnar. Faisal Nimri ... Dr.Faisal
24 Ahmad Ulnar Faisal Nimri... Dr.Faisal Fatty Acid Synthesis - Occurs mainly in the Liver (to store excess carbohydrates as triacylglycerols(fat)) and in lactating mammary glands (for the production of
More informationCH 7: Cell Respiration and Fermentation Overview. Concept 7.1: Catabolic pathways yield energy by oxidizing organic fuels
CH 7: Cell Respiration and Fermentation Overview Living cells require energy from outside sources Some animals obtain energy by eating plants, and some animals feed on other organisms Energy flows into
More informationChapter 14 - Electron Transport and Oxidative Phosphorylation
Chapter 14 - Electron Transport and Oxidative Phosphorylation The cheetah, whose capacity for aerobic metabolism makes it one of the fastest animals Prentice Hall c2002 Chapter 14 1 14.4 Oxidative Phosphorylation
More informationHarvesting energy: photosynthesis & cellular respiration part 1I
Harvesting energy: photosynthesis & cellular respiration part 1I Agenda I. Overview (Big Pictures) of Photosynthesis & Cellular Respiration II. Making Glucose - Photosynthesis III. Making ATP - Cellular
More informationElectron Transport and Oxidative. Phosphorylation
Electron Transport and Oxidative Phosphorylation Electron-transport chain electron- Definition: The set of proteins and small molecules involved in the orderly sequence of transfer to oxygen within the
More informationGlycolysis. Cellular Respiration
Glucose is the preferred carbohydrate of cells. In solution, it can change from a linear chain to a ring. Energy is stored in the bonds of the carbohydrates. Breaking these bonds releases that energy.
More informationproteins Identification, analysis, and prediction of protein ubiquitination sites
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Identification, analysis, and prediction of protein ubiquitination sites Predrag Radivojac,1 Vladimir Vacic,2 Chad Haynes,3 Ross R. Cocklin,4 Amrita Mohan,1
More informationHarvesting energy: photosynthesis & cellular respiration
Harvesting energy: photosynthesis & cellular respiration Learning Objectives Know the relationship between photosynthesis & cellular respiration Know the formulae of the chemical reactions for photosynthesis
More information4. Which step shows a split of one molecule into two smaller molecules? a. 2. d. 5
1. Which of the following statements about NAD + is false? a. NAD + is reduced to NADH during both glycolysis and the citric acid cycle. b. NAD + has more chemical energy than NADH. c. NAD + is reduced
More informationGenome-Wide Analysis of Host Factors in Nodavirus RNA Replication
Genome-Wide Analysis of Host Factors in Nodavirus RNA Replication Linhui Hao 1,2, Brett Lindenbach 1 a, Xiaofeng Wang 1 b, Billy Dye 1 c, David Kushner 1 d, Qiuling He 3 e, Michael Newton 3,4, Paul Ahlquist
More informationROS as targets for therapeutic intervention of diabetic nephropathy
36 th Autumn Congress of Korean Diabetes Association September 16-17, 2010, BEXCO, Busan, Korea ROS as targets for therapeutic intervention of diabetic nephropathy Hunjoo Ha Department of Bioinspired Science
More informationThe plasma membrane proteome of Saccharomyces cerevisiae and its response to the antifungal calcofluor
Proteomics 2006, 6, 3029 3039 DOI 10.1002/pmic.200500762 3029 RESEARCH ARTICLE The plasma membrane proteome of Saccharomyces cerevisiae and its response to the antifungal calcofluor Frédéric Delom 1 *,
More informationThis student paper was written as an assignment in the graduate course
77:222 Spring 2005 Free Radicals in Biology and Medicine Page 0 This student paper was written as an assignment in the graduate course Free Radicals in Biology and Medicine (77:222, Spring 2005) offered
More informationOVERVIEW OF RESPIRATION AND LOOSE ENDS. What agents? What war?
5.19.06 OVERVIEW OF RESPIRATION AND LOOSE ENDS What agents? What war? 1 Ubiquinone or Coenzyme Q: small hydrophobic molecule that can pick up or donate electrons The respiratory chain contains 3 large
More informationFatty acid breakdown
Fatty acids contain a long hydrocarbon chain and a terminal carboxylate group. Most contain between 14 and 24 carbon atoms. The chains may be saturated or contain double bonds. The complete oxidation of
More informationAconitase Enzyme Activity Microplate Assay Kit
ab109712 Aconitase Enzyme Activity Microplate Assay Kit Instructions for Use For the quantitative measurement of Aconitase activity in samples from all species This product is for research use only and
More informationGenome-Wide Functional Profiling Reveals Genes Required for Tolerance to Benzene Metabolites in Yeast
Genome-Wide Functional Profiling Reveals Genes Required for Tolerance to Benzene Metabolites in Yeast Matthew North 1, Vickram J. Tandon 1, Reuben Thomas 2, Alex Loguinov 1, Inna Gerlovina 3, Alan E. Hubbard
More informationThe biochemistry of peroxisomal L-oxidation in the yeast Saccharomyces cerevisiae
FEMS Microbiology Reviews 27 (2003) 35^64 www.fems-microbiology.org The biochemistry of peroxisomal L-oxidation in the yeast Saccharomyces cerevisiae c J. Kalervo Hiltunen a;, Anu M. Mursula a, Hanspeter
More informationCh. 9 Cell Respiration. Title: Oct 15 3:24 PM (1 of 53)
Ch. 9 Cell Respiration Title: Oct 15 3:24 PM (1 of 53) Essential question: How do cells use stored chemical energy in organic molecules and to generate ATP? Title: Oct 15 3:28 PM (2 of 53) Title: Oct 19
More informationElectron Transport Chain and Oxidative phosphorylation
Electron Transport Chain and Oxidative phosphorylation So far we have discussed the catabolism involving oxidation of 6 carbons of glucose to CO 2 via glycolysis and CAC without any oxygen molecule directly
More informationEukaryotic Cu- and Zn-containing superoxide dismutase 1
Mechanisms for activating Cu- and Zn-containing superoxide dismutase in the absence of the CCS Cu chaperone Mark C. Carroll*, Jody B. Girouard*, Janella L. Ulloa*, Jamuna R. Subramaniam, Phillip C. Wong,
More informationResearch Article Factors Affecting Splicing Strength of Yeast Genes
Comparative and Functional Genomics Volume 2011, Article ID 212146, 13 pages doi:10.1155/2011/212146 Research Article Factors Affecting Splicing Strength of Yeast Genes Pinchao Ma 1 and Xuhua Xia 1, 2
More informationRespiration. Respiration. Respiration. How Cells Harvest Energy. Chapter 7
How Cells Harvest Energy Chapter 7 Organisms can be classified based on how they obtain energy: autotrophs: are able to produce their own organic molecules through photosynthesis heterotrophs: live on
More informationThese are example problems, which are similar to those you may see on the final exam.
MCB102 / Metabolism Problem Set #3 Spring 2008 These are example problems, which are similar to those you may see on the final exam. QUESTION 1: /. Circle the correct answer, but if the answer is provide
More informationBiochemical Determinants Governing Redox Regulated Changes in Gene Expression and Chromatin Structure
Biochemical Determinants Governing Redox Regulated Changes in Gene Expression and Chromatin Structure Frederick E. Domann, Ph.D. Associate Professor of Radiation Oncology The University of Iowa Iowa City,
More informationBiochemistry: A Short Course
Tymoczko Berg Stryer Biochemistry: A Short Course Second Edition CHAPTER 20 The Electron-Transport Chain 2013 W. H. Freeman and Company Chapter 20 Outline Oxidative phosphorylation captures the energy
More informationThis student paper was written as an assignment in the graduate course
77:222 Spring 2003 Free Radicals in Biology and Medicine Page 0 This student paper was written as an assignment in the graduate course Free Radicals in Biology and Medicine (77:222, Spring 2003) offered
More informationMolecular Biology of Metal Homeostasis and Detoxification
Topics in Current Genetics 14 Molecular Biology of Metal Homeostasis and Detoxification From Microbes to Man Bearbeitet von Markus J. Tamás, Enrico Martinoia 1. Auflage 2005. Buch. XX, 509 S. Hardcover
More informationCellular Respiration
Cellular Respiration The breakdown of glucose for cellular energy. happens in all living cells. is exothermic H atoms and e are removed from glucose (oxidization) and added to oxygen (reduction) excess
More informationProtein carbonylation: a marker of oxidative stress damage
Protein carbonylation: a marker of oxidative stress damage ITN-TREATMENT Metabolic Dysfunctions associated with Pharmacological Treatment of Schizophrenia TREATMENT Protein carbonyl formation: Metal-Catalyzed
More informationSID#: Also give full SID# (w/ 9) on your computer grid sheet (fill in grids under Student Number) BIO 315 Exam I
SID#: Also give full SID# (w/ 9) on your computer grid sheet (fill in grids under Student Number) BIO 315 Exam I Choose an answer of A,B, C, or D for each of the following Multiple Choice Questions 1-35.
More informationAddition of ammonia or amino acids to a nitrogen-depleted medium a ects gene expression patterns in yeast cells during alcoholic fermentation
RESEARCH ARTICLE Addition of ammonia or amino acids to a nitrogen-depleted medium a ects gene expression patterns in yeast cells during alcoholic fermentation Elena Jiménez-Martí & Marcel lí del Olmo Departament
More informationIII. 6. Test. Respiració cel lular
III. 6. Test. Respiració cel lular Chapter Questions 1) What is the term for metabolic pathways that release stored energy by breaking down complex molecules? A) anabolic pathways B) catabolic pathways
More informationChapter 9. Cellular Respiration and Fermentation
Chapter 9 Cellular Respiration and Fermentation Energy flows into an ecosystem as sunlight and leaves as heat Photosynthesis generates O 2 and organic molecules, which are used in cellular respiration
More informationElectron transport chain chapter 6 (page 73) BCH 340 lecture 6
Electron transport chain chapter 6 (page 73) BCH 340 lecture 6 The Metabolic Pathway of Cellular Respiration All of the reactions involved in cellular respiration can be grouped into three main stages
More informationSuperoxide Dismutase Assay Kit
Superoxide Dismutase Assay Kit Catalog Number KA3782 100 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...
More informationChemical Energy. Valencia College
9 Pathways that Harvest Chemical Energy Valencia College 9 Pathways that Harvest Chemical Energy Chapter objectives: How Does Glucose Oxidation Release Chemical Energy? What Are the Aerobic Pathways of
More informationElectron transport chain, oxidative phosphorylation, mitochondrial transport systems
Electron transport chain, oxidative phosphorylation, mitochondrial transport systems JAN ILLNER Respiratory chain & oxidative phosphorylation INTERMEMBRANE SPACE ubiquinone cytochrome c ATPase Production
More information2
1 2 3 4 5 6 7 8 9 10 11 What is the fate of Pyruvate? Stages of Cellular Respiration GLYCOLYSIS PYRUVATE OX. KREBS CYCLE ETC 2 The Krebs Cycle does your head suddenly hurt? 3 The Krebs Cycle An Overview
More informationPHM142 Energy Production + The Mitochondria
PHM142 Energy Production + The Mitochondria 1 The Endosymbiont Theory of Mitochondiral Evolution 1970: Lynn Margulis Origin of Eukaryotic Cells Endosymbiant Theory: the mitochondria evolved from free-living
More informationTranscriptional Response of Saccharomyces cerevisiae to the Plasma Membrane-Perturbing Compound Chitosan
EUKARYOTIC CELL, Apr. 2005, p. 703 715 Vol. 4, No. 4 1535-9778/05/$08.00 0 doi:10.1128/ec.4.4.703 715.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved. Transcriptional Response
More informationAging and nutrition 03/11/2012. Why do people age? Oxidative stress and damage
Aging and nutrition % of elderly people in Canadian population is increasing more than for other age groups within the elderly age group there is great variability in terms health, metabolism, physical
More informationProblem Set #5 4/3/ Spring 02
Question 1 Chloroplasts contain six compartments outer membrane, intermembrane space, inner membrane, stroma, thylakoid membrane, and thylakoid lumen each of which is populated by specific sets of proteins.
More informationThis student paper was written as an assignment in the graduate course
77:222 Spring 2001 Free Radicals in Biology and Medicine Page 0 This student paper was written as an assignment in the graduate course Free Radicals in Biology and Medicine (77:222, Spring 2001) offered
More informationElectron Transport System Supplemental Reading. Key Concepts PETER MITCHELL'S CHEMIOSMOTIC THEORY
Electron Transport System Supplemental Reading Key Concepts - PETER MITCHELL'S CHEMIOSMOTIC THEORY - THE ELECTRON TRANSPORT SYSTEM IS A SERIES OF COUPLED REDOX REACTIONS Complex I: NADH-ubiquinone oxidoreductase
More informationSheet #5 Dr. Mamoun Ahram 8/7/2014
P a g e 1 Protein Structure Quick revision - Levels of protein structure: primary, secondary, tertiary & quaternary. - Primary structure is the sequence of amino acids residues. It determines the other
More informationCELL BIOLOGY - CLUTCH CH AEROBIC RESPIRATION.
!! www.clutchprep.com CONCEPT: OVERVIEW OF AEROBIC RESPIRATION Cellular respiration is a series of reactions involving electron transfers to breakdown molecules for (ATP) 1. Glycolytic pathway: Glycolysis
More informationChapter 6 : How Cells Harvest Energy (B) Dr. Chris Doumen 10/28/14 CITRIC ACID CYCLE. Acetyl CoA CoA CoA CO 2 NAD + FADH 2 NADH FAD + 3 H + ADP + ATP
Chapter 6 : How Cells Harvest Energy (B) Dr. Chris Doumen Acetyl CoA CoA CoA Oxaloacetate Citrate CITRIC ACID CYCLE CO FADH 3 NAD + FAD 3 NADH ADP + P + 3 1 Pyruvate oxida.on and Citric Acid Cycle Thus
More informationCellular Respiration. Biochemistry Part II 4/28/2014 1
Cellular Respiration Biochemistry Part II 4/28/2014 1 4/28/2014 2 The Mitochondria The mitochondria is a double membrane organelle Two membranes Outer membrane Inter membrane space Inner membrane Location
More informationINFLUENCE OF MINERAL NUTRITION ON SUPEROXIDE DISMUTASE ACTIVITY IN BLOOD OF COWS
Bull. Vet. Inst. Pulawy 47, 547-554, 2003 INFLUENCE OF MINERAL NUTRITION ON SUPEROXIDE DISMUTASE ACTIVITY IN BLOOD OF COWS 1, 2 0,526à$: KLECZKOWSKI, 1 :à2'=,0,(5=./8&,6., 1 EWA SITARSKA, 1 JACEK SIKORA
More informationCellular Respiration and Fermentation
CAMPBELL BIOLOGY IN FOCUS URRY CAIN WASSERMAN MINORSKY REECE 7 Cellular Respiration and Fermentation Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge, Simon Fraser University SECOND EDITION
More informationCellular Respiration and Fermentation
CAMPBELL BIOLOGY IN FOCUS URRY CAIN WASSERMAN MINORSKY REECE 7 Cellular Respiration and Fermentation Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge, Simon Fraser University SECOND EDITION
More informationHow Cells Harvest Energy. Chapter 7. Respiration
How Cells Harvest Energy Chapter 7 Respiration Organisms classified on how they obtain energy: autotrophs: produce their own organic molecules through photosynthesis heterotrophs: live on organic compounds
More information7 Cellular Respiration and Fermentation
CAMPBELL BIOLOGY IN FOCUS URRY CAIN WASSERMAN MINORSKY REECE 7 Cellular Respiration and Fermentation Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge, Simon Fraser University SECOND EDITION
More informationComparison of nanoparticle protein corona profiles resulting from changes in nanoparticle environment and engineered properties.
Comparison of nanoparticle protein corona profiles resulting from changes in nanoparticle environment and engineered properties. Korin Wheeler Dept. of Chemistry & Biochemistry Santa Clara University at
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/3/2/e1602038/dc1 Supplementary Materials for Mitochondrial metabolic regulation by GRP78 Manoj Prasad, Kevin J. Pawlak, William E. Burak, Elizabeth E. Perry, Brendan
More information7 Cellular Respiration and Fermentation
CAMPBELL BIOLOGY IN FOCUS URRY CAIN WASSERMAN MINORSKY REECE 7 Cellular Respiration and Fermentation Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge, Simon Fraser University SECOND EDITION
More informationPhotosynthesis in chloroplasts CO2 + H2O. Cellular respiration in mitochondria ATP. powers most cellular work. Heat energy
Figure 9-01 LE 9-2 Light energy ECOSYSTEM Photosynthesis in chloroplasts CO2 + H2O Cellular respiration in mitochondria Organic + O molecules 2 powers most cellular work Heat energy LE 9-UN161a becomes
More informationWhat s the point? The point is to make ATP! ATP
ATP Chapter 8 What s the point? The point is to make ATP! ATP Flows into an ecosystem as sunlight and leaves as heat Energy is stored in organic compounds Carbohydrates, lipids, proteins Heterotrophs eat
More informationPhospholipid biosynthesis in the yeast Saccharomyces cerevisiae and interrelationship with other metabolic processes
Progress in Lipid Research 38 (1999) 361±399 www.elsevier.com/locate/plipres Phospholipid biosynthesis in the yeast Saccharomyces cerevisiae and interrelationship with other metabolic processes George
More informationBiochemistry 694:301. Please use BLOCK CAPITAL letters like this --- A, B, C, D, E. Not lowercase!
Biochemistry 694:301 Second Exam, Dr. Deis Monday Aug. 5, 2002 Name Last 5 digits of SSN Row Letter Seat Number This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is
More informationFREE ENERGY Reactions involving free energy: 1. Exergonic 2. Endergonic
BIOENERGETICS FREE ENERGY It is the portion of the total energy change in a system that is available for doing work at constant temperature and pressure; it is represented as ΔG. Reactions involving free
More informationCitric acid cycle and respiratory chain. Pavla Balínová
Citric acid cycle and respiratory chain Pavla Balínová Mitochondria Structure of mitochondria: Outer membrane Inner membrane (folded) Matrix space (mtdna, ribosomes, enzymes of CAC, β-oxidation of FA,
More informationCellular respiration and fermentation 04/18/2016 BI102
Cellular respiration and fermentation 04/18/2016 BI102 Announcements Exam 1 after lecture Don t forget to do the online assignments every week! Quiz 2 and lab 2 review Cellular Respiration Cells require
More information