Supplemental Information
|
|
- Roxanne Stevenson
- 6 years ago
- Views:
Transcription
1 Supplemental Information LKB1 inhibits lung cancer progression through lysyl oxidase and extracellular matrix remodeling Yijun Gao, Qian Xiao, HuiMin Ma, Li Li, Jun Liu, Yan Feng, Zhaoyuan Fang, Jing Wu, Xiangkun Han, Junhua Zhang, Yihua Sun, Gongwei Wu, Robert Padera, Haiquan Chen, Kwok-kin Wong, Gaoxiang Ge, and Hongbin Ji Supplemental Materials and Methods Antibodies and reagents The following antibodies were used: LKB1 (Upstate); S6 ribosomal protein, phospho-s6 ribosomal protein, Src, Src py416, E-Cadherin, Cleaved Caspase-3 (all from Cell Signaling); HIF-1, -catenin, FAK, FAK py397 (all from BD Transduction Laboratories); -Actin and LOX (Sigma-Aldrich); Ki-67 (Novocastra Laboratories Ltd); Biotinylated goat anti-rabbit secondary antibody (ZYMED company); Alexa Fluor 555 or 488 conjugated anti-mouse, rat or rabbit IgG secondary antibodies (Invitrogen); HRP-conjugated rabbit and mouse secondary antibodies (Santa Cruz); Tubulin and 1 integrin antibody were obtained from the Developmental Studies Hybridoma Bank developed under the auspices of the NICHD and maintained by the University of Iowa, Department of Biology, Iowa City, IA integrin antibody was purified from
2 supernatant of the hybridoma culture. LOX inhibitor BAPN and mtor inhibitor rapamycin were purchased from Sigma-Aldrich and LC laboratories, respectively. Plasmids pbabe-puro-flag-hlkb1 was described previously (1). pgl3 HRE-Luc and mutant HRE-Luc reporter constructs were generously provided by Dr. Celeste Simon (University of Pennsylvania). pbabe-puro-hif-1 wt and pbabe-puro-hif-1 -PA were kindly provided by Dr. William Kaelin (Dana-Farber Cancer Institute, Harvard University). Human LOX promoter (1019 bp) was amplified from human genomic DNA and cloned into pgl3-basic (Promega). The human LOX sequences were amplified from A549 cdna using primers: 5 - GATCGAATTCATGCGCGGCGG-3 (forward) and 5 -GATCGTCGACCTACTTGTCATCGTCATCCTTGTAGTCAGATCTATACGG TGAAATTGTGCAGCCT-3 (reverse). Amplicon was inserted into pbabe-neo. The shrnas towards human LOX were cloned into plko.1 (Addgene). The target sequences are: shlox-1: 5 -GUGCAGAAGAUGUCCAUGU-3 shlox-2: 5 -GGUUCCUGAAUCUGACUAU-3 The shrnas towards human LKB1 was from Sigma-Aldrich. The target sequences are: shlkb1-1: 5 -GCCAACGUGAAGAAGGAAAUU-3 shlkb1-2: 5 -GAUCCUCAAGAAGAAGAAGUU-3
3 Cell culture, proliferation and anchorage-independent cell growth The human NSCLC cell lines A549, CRL-5807, CRL-5844, CRL-5800 and HTB-182 (ATCC) were maintained in RPMI1640 (Hyclone) supplemented with 10% FBS (Biochrom). 293T cells (ATCC) were cultured in DMEM (Hyclone) with 10% FBS. Viral infection of cells was as previously described (2). For cell proliferation assay, cells were cultured in 60 mm dishes and total cell numbers in each of four independent dishes were counted at indicated time points. Anchorage-independent cell growth was assessed using soft agar assay as described before (1). RT-PCR and real-time PCR Total RNA was prepared as previously described (1) and retrotranscribed into first-strand cdna using RevertAid First Strand cdna Synthesis Kit (Fermentas). The cdnas were then used for either regular PCR or real-time PCR on a 7500 Fast Real-Time PCR System (Applied Biosystems) using SYBR-Green Master PCR mix (Toyobo). GAPDH served as internal control. Primers used were: Human LOX: 5 -CATCATGCGTATGCCTCAG-3 (forward) and 5 -TTCCCACTTCAGAACACCAG-3 (reverse); Mouse Lox: 5 -GGTTACTTCCAGTACGGTCTCC-3 (forward) and 5 -GCAGCGCATCTCAGGTTGT-3 (reverse) Human LKB1: 5 -CTCTGACCTGCTGAAAGGGATG-3 (forward) and 5 -TGTCTGGGCTCGGTGGGATG-3 (reverse);
4 Human GAPDH: 5 -AGGTGAAGGTCGGAGTCAAC-3 (forward) and 5 -AGTTGAGGTCAATGAAGGGG-3 (reverse). Mouse Gapdh: 5 -TGCCCCCATGTTTGTGATG-3 (forward) and 5 -TGTGGTCATGAGCCCTTCC (reverse). Immunoblotting Immunoblotting was performed as previously described (1). Wound healing assay Wound healing assay was performed as described (3). Wound closure was analyzed with AxioVision LE Rel 4.5 (4). Three-Dimensional cell culture and immunofluorescence Cells were cultured in matrigel (BD Transduction Laboratories) as previously described (5) for days at 37 in a humidified incubator. For 3D culture with different stiffness, rat tail type I collagen (Upstate) was added to matrigel at 0, 0.8, 1.6, 2.4 mg/ml final concentration. For antibody co-incubation, 1 integrin blocking antibody (20 g/ml) was added to medium of the cells grown in matrigel with or without type I collagen (1.6 mg/ml). For immunofluorescence, 3D cultures were fixed with 2% PFA in phosphate-buffered saline (PBS) supplemented with 50 mm glycine at room temperature for 30 min, and washed three times for 20 min with PBS containing glycine. Cells were then blocked with 10% goat serum in immunofluorescence (IF) buffer (PBS, 0.1% bovine serum albumin, 0.2% Triton X-100, 0.05% Tween-20) at room temperature for 1 hour, and incubated with primary antibodies with 10% goat serum overnight at 4. Cells were washed three times for
5 20 min with IF buffer, and incubated with Alexa Fluor 555 or 488 conjugated secondary antibodies with 10% goat serum at room temperature for 40 min. Nuclei were counterstained with DAPI. After washing with IF buffer, cells were mounted in Immu-Mount (Thermo Electron Corporation). Cells were visualized using a laser scanning confocal microscope (Leica TCS ST5-MT). Mouse treatment Kras G12D, Lkb1 L/L and P53 L/L mice were originally generously provided by Dr. T. Jacks and Dr. R. Depinho, respectively. Lung cancer mice models with Kras; Kras, Lkb1 L/L ; Kras, P53 L/L mice were generated as described before (1). All mice were housed in a specific pathogen-free environment at the Shanghai Institute of Biochemistry and Cell Biology and treated in strict accordance with protocols approved by the Institutional Animal Care and Use Committee of the Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences. For de novo lung cancer mice model, mice were treated with 2x10 6 plague-forming unites of adeno-cre at 6~8 weeks of age as previously described (6). Four weeks later, Kras, Lkb1 L/L mice were randomly divided into two groups (8 each) for intraperitoneal injection with either saline or BAPN (100 mg/kg) daily as described for another 8 weeks (7). As for BAPN treatment in Kras lung cancer mice model, 3 mice each group were used after 8 weeks of adeno-cre treatment. All mice were sacrificed for gross inspection and histopathological examination. Histopathological analysis and immunological studies
6 Histopahtological analysis and immunological studies were performed as described before (1, 4, 8). Briefly, mice were sacrificed and lung tissues were inflated and fixed in 10% formalin, embedded in paraffin and sectioned for hematoxylin and eosin (HE) staining. Tumor number and size were measured in five continuous slides with 100 M interval in each mouse from 7~8 mice. Staining with picro-sirius red (Direct Red 80, Sigma-Aldrich) were used to assess collagen deposition in lung tumors (9). LOX enzymatic activity assay Serum from mice, human lung cancer patients and phenol red-free conditioned media (CM) from confluent cells were collected for LOX enzymatic activity assessment. Samples were prepared in a final volume of 1 ml containing 1.2 M urea (Amresco), 0.05 M sodium borate (Sigma, ph 8.2), 0.1 units/ml of horseradish peroxidase (Fluka), 50 M Amplex Red (Invitrogen) and 10 mm 1,5-diaminopentane (Sigma-Aldrich) and were incubated at 37 C for 1 hour (10). Fluorescence was measured using a Hitachi F-2000 fluorescence spectrophotometer with excitation and emission wavelengths at 560 nm and 590 nm, respectively. Parallel assays were prepared with 500 M BAPN to completely inhibit the activity of LOX. The LOX activities were calculated as the increase in fluorescent units above the BAPN controls. Human serum sample analysis The study was approved by the local ethic committees in Shanghai Cancer Hospital, Fudan University and sera were collected with the written consent from patients from July 2007 to March Blood samples were collected in procoagulant tube and
7 allowed to clot at room temperature within 2 hours. Coagulated blood was spun at 4,000 rpm for 5 min, and the serum samples were immediately aliquoted and frozen for storage at 80 C until thawed for LOX enzymatic activity assay. All the patients involved in this study were initially diagnosed with lung cancer without other types of cancers and had not received any chemotherapy or radiotherapy before. Clinical data including gender, smoking status, past medical history, medications, stage at diagnosis and pathology were collected for each patient. All statistical analyses were carried out using the SPSS 11.5 statistical software package. Student's t-test and one-way ANOVA statistical analysis were used for patient demographic and clinical data. P < 0.05 in all cases was considered statistically significant.
8 Figure S1. No significant increase of LOX gene expression in mouse lung tumors with P53 deficiency. Real-time PCR quantification of Lox mrna levels in mouse Kras lung tumors with wild-type p53 (n=3) and with p53 deficiency (n=3). Data were presented as means ± SEM. Statistical analyses were performed using Student s t test.
9 Figure S2. Detection of LOX expression in a panel of human NSCLC cell lines. Western blot was performed to detect LOX protein level in 17 human NSCLC cell lines with known LKB1 mutation status.
10 Figure S3. HIF-1 mediates LOX transcription downstream of LKB1. (A-D) Re-introduction of HIF-1 rescued the inhibition of LOX promoter activity (A,C) and protein levels (B,D) by ectopic LKB1 expression in CRL-5800 (A-B) and CRL-5807 (C-D). CRL-5807 cells expressing LKB1 and/or HIF1 constructs were treated with 200 m CoCl 2 for 12 hours. Data were presented as means ± SEM. Statistical analyses were performed using Student s t test. * p < 0.05,** p < 0.01.
11 Figure S4. LKB1 knockdown increases LOX gene transcription. (A-B) Knockdown of LKB1 in HTB-182 lung cancer cells increased LOX expression (A) and enzymatic activities (B). Data were presented as means ± SEM. Statistical analysis were performed using Student s t test. * p < 0.05, *** p <
12 Figure S5. HIF-1 mediates LOX transcription downstream of LKB1. (A) Ectopic LKB1 expression inhibited LOX promoter activity in A549 cells. (B) Ectopic LKB1 expression inhibited the gene transcription under promoter with wild-type hypoxia-responsive element (HRE) in A549 cells. (C and D) Expression of either HIF-1 or PA mutant, a stable form of HIF-1 up-regulated LOX promoter activity (C) and LOX mrna levels (D) in A549 cells. (E and F) Re-introduction of HIF-1 rescued the inhibition of LOX mrna (E) and LOX enzymatic activity (F) by ectopic LKB1 expression in A549 cells. (G and H) Knockdown of HIF-1 decreased the LOX promoter activity (G) and LOX mrna levels (H). A549 cells expressing HIF-1 shrna were treated with 200 m CoCl 2 for 12 hours. Data were presented as
13 means ± SEM. Statistical analyses were performed using Student s t test. * p < 0.05, ** p < 0.01, *** p < Figure S6. LKB1 negatively regulates LOX transcription through mtor-hif-1 signaling axis. (A-B) mtor inhibitor rapamycin treatment significantly decreased LOX promoter activity (A) and LOX mrna level (B) in A549 cells. (C) mtor inhibition by rapamycin down-regulated LOX and HIF-1 protein level. (D) mtor inhibition significantly decreased the transcription activity on promoter with wild-type HRE in A549 cells. (E) Ectopic expression of HIF-1 rescued the down-regulation of LOX enzymatic activity by rapamycin treatment in A549 cells. Data were presented as means ± SEM. Statistical analyses were performed using Student s t test. * p < 0.05, ** p < 0.01, *** p <
14 Figure S7. LOX is not involved in regulation of A549 cell proliferation in two-dimensional cell culture. LOX over-expression in A549 cells (A-C) or CRL-5807 cells (D-E) or LOX shrna knockdown in A549 (F-H) or CRL-5844 cells (I-J) had no effect on cell proliferation in two-dimensional cell culture. Anti-Flag is used for detection of Flag-LKB1 overexpression. Enzymatic activity inhibition by BAPN had no effect on A549 cell proliferation (K). Neither could LOX rescue the inhibition of cell growth by LKB1 in A549 (C) or CRL-5807 (E) cells. Data were presented as means ± SEM. Statistical analyses were performed using Student s t test. *** p <
15 Figure S8. LOX mediates lung cancer cell anchorage-independent growth and migration. (A-B) Ectopic expression of LOX in CRL-5807 cells rescued the inhibitory effect of LKB1 on anchorage-independent cell growth (A) and cell migration (B). (C-D) Knockdown of LOX in CRL-5844 cells significantly impaired anchorage-independent cell growth (C) and cell migration (D). Data are presented as mean ± SEM. Statistical analyses were performed using Student s t test. ** p < 0.01, *** p <
16 Figure S9. LOX confers to Lkb1 deficient tumor progression. (A) Detection of LOX serum activity from Kras, Lkb1 L/L mice treated with BAPN or saline (8 mice each group). (B) Ki-67 immunostaining on lung sections from Kras, Lkb1 L/L mice after 4-week treatment of LOX inhibitor BAPN or saline (left panels) and cleaved Caspase-3 immunostaining on lung sections from Kras, Lkb1 L/L mice treated with either BAPN or saline for 1-week (right panels). Scale bars: 50 m. (C) Histological inspection of lung tumors from intravenous injection of A549 cells with or without LOX knockdown. Scale bar: 200 m (upper panels), 50 m (bottom panels). (D) Quantification of tumor volume in H&E stained lung sections. Data were presented as means ± SEM. Statistical analysis were performed using Student s t test. * p < 0.05, *** p <
17 Figure S10. LOX inhibition does not significantly affect the progression of mouse lung tumors with wildtype Lkb1. (A) BAPN treatment had no effect on the size of Kras murine lung tumors. Scale bars: 500 m (left panels), 100 m (right panels). (B) Quantification of tumor number and volume in H&E stained lung sections from Kras mice treated with BAPN or saline (3 mice each group). Data were presented as means ± SEM. Statistical analyses were performed using Student s t test.
18 Figure S11. Excess collagen deposition increases lung cancer progression through activation of 1 integrin signaling. (A) Sirius red staining of collagen (right panels) showed evident collagen rich fibrotic loci in lung tumors from Kras, Lkb1 L/L mice but not in those from Kras mice. H&E staining was shown in left panels. Scale bars: 100 m. (B) Diminished collagen rich fibrotic loci in Lkb1-deficient lung tumors after BAPN treatment shown by sirius red staining (right panels). H&E staining was shown in left panels. Scale bars: 100 m. (C) Altered cell morphology of A549 cells grown in matrigel with type I collagen as 3 dimensional spheres. Scale bars: 200 m.
19 References: 1. Ji H, et al. (2007) LKB1 modulates lung cancer differentiation and metastasis. Nature 448: Naldini L, Blomer U, Gage FH, Trono D, Verma IM (1996) Efficient transfer, integration, and sustained long-term expression of the transgene in adult rat brains injected with a lentiviral vector. Proc Natl Acad Sci U S A 93: Rodriguez LG, Wu X, Guan JL (2005) Wound-healing assay. Methods Mol Biol 294: Ji H, et al. (2006) The impact of human EGFR kinase domain mutations on lung tumorigenesis and in vivo sensitivity to EGFR-targeted therapies. Cancer Cell 9: Debnath J, Muthuswamy SK, Brugge JS (2003) Morphogenesis and oncogenesis of MCF-10A mammary epithelial acini grown in three-dimensional basement membrane cultures. Methods 30: Jackson EL, et al. (2001) Analysis of lung tumor initiation and progression using conditional expression of oncogenic K-ras. Genes Dev 15: Gilad GM, Gilad VH (2001) b-aminopropionitrile treatment can accelerate recovery of mice after spinal cord injury. Eur J Pharmacol 430: Ge G, Greenspan DS (2006) BMP1 controls TGFb1 activation via cleavage of latent TGFb-binding protein. J Cell Biol 175: Junqueira LC, Bignolas G, Brentani RR (1979) Picrosirius staining plus polarization microscopy, a specific method for collagen detection in tissue sections. Histochem J 11: Palamakumbura AH, Trackman PC (2002) A fluorometric assay for detection of lysyl oxidase enzyme activity in biological samples. Anal Biochem 300:
SUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationFang et al. NMuMG. PyVmT unstained Anti-CCR2-PE MDA-MB MCF MCF10A
A NMuMG PyVmT 16.5+.5 47.+7.2 Fang et al. unstained Anti-CCR2-PE 4T1 Control 37.6+6.3 56.1+.65 MCF1A 16.1+3. MCF-7 3.1+5.4 MDA-M-231 42.1+5.5 unstained Secondary antibody only Anti-CCR2 SUPPLEMENTAL FIGURE
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Correlation between LKB1 and YAP expression in human lung cancer samples. (a) Representative photos showing LKB1 and YAP immunohistochemical staining in human
More informationSupplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES
More informationImpact of hyper-o-glcnacylation on apoptosis and NF-κB activity SUPPLEMENTARY METHODS
SUPPLEMENTARY METHODS 3D culture and cell proliferation- MiaPaCa-2 cell culture in 3D was performed as described previously (1). Briefly, 8-well glass chamber slides were evenly coated with 50 µl/well
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding
More informationMTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)
Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum
More informationSUPPLEMENTARY FIGURES AND TABLE
SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).
More informationSestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury
Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting protein3) regulate autophagy and mitophagy in renal tubular cells in acute kidney injury by Masayuki Ishihara 1, Madoka Urushido 2, Kazu Hamada
More informationErzsebet Kokovay, Susan Goderie, Yue Wang, Steve Lotz, Gang Lin, Yu Sun, Badrinath Roysam, Qin Shen,
Cell Stem Cell, Volume 7 Supplemental Information Adult SVZ Lineage Cells Home to and Leave the Vascular Niche via Differential Responses to SDF1/CXCR4 Signaling Erzsebet Kokovay, Susan Goderie, Yue Wang,
More information(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC,
Supplemental Figure Legends Figure S1. Cell line characterization (A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, green) and co-stained with DAPI to visualize the nuclei.
More informationm 6 A mrna methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer
SUPPLEMENTARY INFORMATION Articles https://doi.org/10.1038/s41556-018-0174-4 In the format provided by the authors and unedited. m 6 A mrna methylation regulates AKT activity to promote the proliferation
More informationSupplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were
Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl
More informationSupplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION
Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION X. Shawn Liu 1, 3, Bing Song 2, 3, Bennett D. Elzey 3, 4, Timothy L. Ratliff 3, 4, Stephen F. Konieczny
More informationSupplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway
Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.
More informationSupporting Information
Supporting Information Fujishita et al. 10.1073/pnas.0800041105 SI Text Polyp Scoring. Intestinal polyps were counted as described (1). Briefly, the small and large intestines were excised, washed with
More informationSupporting Information
Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)
More informationVEGFR2-Mediated Vascular Dilation as a Mechanism of VEGF-Induced Anemia and Bone Marrow Cell Mobilization
Cell Reports, Volume 9 Supplemental Information VEGFR2-Mediated Vascular Dilation as a Mechanism of VEGF-Induced Anemia and Bone Marrow Cell Mobilization Sharon Lim, Yin Zhang, Danfang Zhang, Fang Chen,
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein
More informationSoft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v)
SUPPLEMENTARY MATERIAL AND METHODS Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v) top agar (LONZA, SeaKem LE Agarose cat.5004) and plated onto 0.5% (w/v) basal agar.
More informationSUPPORTING MATREALS. Methods and Materials
SUPPORTING MATREALS Methods and Materials Cell Culture MC3T3-E1 (subclone 4) cells were maintained in -MEM with 10% FBS, 1% Pen/Strep at 37ºC in a humidified incubator with 5% CO2. MC3T3 cell differentiation
More informationSuppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial
Supplementary Information Häuselmann et al. Monocyte induction of E-selectin-mediated endothelial activation releases VE-cadherin junctions to promote tumor cell extravasation in the metastasis cascade
More informationSupplemental Information. Tissue Myeloid Progenitors Differentiate. into Pericytes through TGF-b Signaling. in Developing Skin Vasculature
Cell Reports, Volume 18 Supplemental Information Tissue Myeloid Progenitors Differentiate into Pericytes through TGF-b Signaling in Developing Skin Vasculature Tomoko Yamazaki, Ani Nalbandian, Yutaka Uchida,
More informationSupplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression
Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationFigure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min
Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with
More informationThe toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells
1 SUPPLEMENTARY INFORMATION The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells Karin Loser 1,2,6, Thomas Vogl 2,3, Maik Voskort 1, Aloys
More informationSupplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated,
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated, embedded in matrigel and exposed
More informationSupplementary data Supplementary Figure 1 Supplementary Figure 2
Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna
More informationSupplemental Information. Autophagy in Oncogenic K-Ras. Promotes Basal Extrusion. of Epithelial Cells by Degrading S1P. Current Biology, Volume 24
Current Biology, Volume 24 Supplemental Information Autophagy in Oncogenic K-Ras Promotes Basal Extrusion of Epithelial Cells by Degrading S1P Gloria Slattum, Yapeng Gu, Roger Sabbadini, and Jody Rosenblatt
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupporting Information
Supporting Information Identification of Novel ROS Inducers: Quinone Derivatives Tethered to Long Hydrocarbon Chains Yeonsun Hong,, Sandip Sengupta,, Wooyoung Hur, *, Taebo Sim,, * KU-KIST Graduate School
More informationSupplementary Materials and Methods
Supplementary Materials and Methods Reagents and antibodies was purchased from iaffin GmbH & Co KG. Cisplatin (ristol-myers Squibb Co.) and etoposide (Sandoz Pharma Ltd.) were used. Antibodies recognizing
More informationHCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation
SUPPLEMENTARY INFORMATION Materials and Methods Human cell lines and culture conditions HCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation in exon 20 of BRCA1
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationOncolytic Adenovirus Complexes Coated with Lipids and Calcium Phosphate for Cancer Gene Therapy
Oncolytic Adenovirus Complexes Coated with Lipids and Calcium Phosphate for Cancer Gene Therapy Jianhua Chen, Pei Gao, Sujing Yuan, Rongxin Li, Aimin Ni, Liang Chu, Li Ding, Ying Sun, Xin-Yuan Liu, Yourong
More informationSupplementary Information Supplementary Fig. 1. Elevated Usp9x in melanoma and NRAS mutant melanoma cells are dependent on NRAS for 3D growth.
Supplementary Information Supplementary Fig. 1. Elevated Usp9x in melanoma and NRAS mutant melanoma cells are dependent on NRAS for 3D growth. a. Immunoblot for Usp9x protein in NRAS mutant melanoma cells
More informationSupplemental Information
Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationSupplementary Materials. for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis
Supplementary Materials for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis 1 Supplementary Figure Legends Supplementary Figure 1: Integrin expression
More informationSupplemental information
Carcinoemryonic antigen-related cell adhesion molecule 6 (CEACAM6) promotes EGF receptor signaling of oral squamous cell carcinoma metastasis via the complex N-glycosylation y Chiang et al. Supplemental
More informationSupplementary Figure 1. Validation of astrocytes. Primary astrocytes were
Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were separated from the glial cultures using a mild trypsinization protocol. Anti-glial fibrillary acidic protein (GFAP) immunofluorescent
More information(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationSupporting Information
Supporting Information Palmisano et al. 10.1073/pnas.1202174109 Fig. S1. Expression of different transgenes, driven by either viral or human promoters, is up-regulated by amino acid starvation. (A) Quantification
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationA549 and A549-fLuc cells were maintained in high glucose Dulbecco modified
Cell culture and animal model A549 and A549-fLuc cells were maintained in high glucose Dulbecco modified Eagle medium supplemented with 10% fetal bovine serum at 37 C in humidified atmosphere containing
More informationType of file: PDF Size of file: 0 KB Title of file for HTML: Supplementary Information Description: Supplementary Figures
Type of file: PDF Size of file: 0 KB Title of file for HTML: Supplementary Information Description: Supplementary Figures Supplementary Figure 1 mir-128-3p is highly expressed in chemoresistant, metastatic
More informationSupplementary Materials and Methods
Supplementary Materials and Methods Hepatocyte toxicity assay. Freshly isolated hepatocytes were incubated for overnight with varying concentrations (-25 µm) of sodium glycochenodeoxycholate (GCDC) or
More informationSupplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the
Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student
More informationSupplemental Materials. STK16 regulates actin dynamics to control Golgi organization and cell cycle
Supplemental Materials STK16 regulates actin dynamics to control Golgi organization and cell cycle Juanjuan Liu 1,2,3, Xingxing Yang 1,3, Binhua Li 1, Junjun Wang 1,2, Wenchao Wang 1, Jing Liu 1, Qingsong
More informationSupplementary Table 1. Characterization of HNSCC PDX models established at MSKCC
Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC Supplementary Table 2. Drug content and loading efficiency estimated with F-NMR and UV- Vis Supplementary Table 3. Complete
More informationEpithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive
Online Data Supplement: Epithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive asthma Dan Cheng, Zheng Xue, Lingling Yi, Huimin Shi, Kan Zhang, Xiaorong Huo, Luke R. Bonser,
More informationSupplementary Figure 1.
Supplementary Figure 1. Increased β cell mass and islet diameter in βtsc2 -/- mice up to 35 weeks A: Reconstruction of multiple anti-insulin immunofluorescence images showing differences in β cell mass
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationPrevalence and characterization of somatic mutations in Chinese aldosterone-producing adenoma. patients. Supplemental data. First author: Baojun Wang
Prevalence and characterization of somatic mutations in Chinese aldosterone-producing adenoma patients Supplemental data First author: Baojun Wang Patients and tumor samples A total of 87 patients with
More informationProgrammed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration
Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration The Harvard community has made this article openly available. Please
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/1171320/dc1 Supporting Online Material for A Frazzled/DCC-Dependent Transcriptional Switch Regulates Midline Axon Guidance Long Yang, David S. Garbe, Greg J. Bashaw*
More informationSupplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or
Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or 3xflag-CagA expression vector were wounded using a pipette
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationSupplementary Materials and Methods
Supplementary Materials and Methods Immunoblotting Immunoblot analysis was performed as described previously (1). Due to high-molecular weight of MUC4 (~ 950 kda) and MUC1 (~ 250 kda) proteins, electrophoresis
More informationSupplementary Data. Supplementary Methods:
Supplementary Data Supplementary Methods: Cell viability assay. Cells were seeded overnight at a density of 2,000 cells per well in 96-well plates in RPMI with 10% FBS and then treated with the relevant
More information(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment
SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.
More informationEffec<ve Use of PI3K and MEK Inhibitors to Treat Mutant K Ras G12D and PIK3CA H1047R Murine Lung Cancers
Effec
More informationSupplementary Information
Supplementary Information mediates STAT3 activation at retromer-positive structures to promote colitis and colitis-associated carcinogenesis Zhang et al. a b d e g h Rel. Luc. Act. Rel. mrna Rel. mrna
More informationThe subcortical maternal complex controls symmetric division of mouse zygotes by
The subcortical maternal complex controls symmetric division of mouse zygotes by regulating F-actin dynamics Xing-Jiang Yu 1,2, Zhaohong Yi 1, Zheng Gao 1,2, Dan-dan Qin 1,2, Yanhua Zhai 1, Xue Chen 1,
More informationB16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationComparison of Young and Old Cardiac Telocytes Using Atomic Force Microscopy
Comparison of Young and Old Cardiac Telocytes Using Atomic Force Microscopy Jiali Luo 1, 2, 3, 4, a, Shanshan Feng 1, 2, 3, 4, b 1Key Laboratory of Regenerative Medicine, Ministry of Education, Jinan University,
More informationSupplemental Data. TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim.
Supplemental Data TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim. Molly A. Taylor 1, Khalid Sossey-Alaoui 2, Cheryl L. Thompson 3, David Danielpour 4, and William
More informationSUPPLEMENT. Materials and methods
SUPPLEMENT Materials and methods Cell culture and reagents Cell media and reagents were from Invitrogen unless otherwise indicated. Antibiotics and Tet-certified serum were from Clontech. In experiments
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2566 Figure S1 CDKL5 protein expression pattern and localization in mouse brain. (a) Multiple-tissue western blot from a postnatal day (P) 21 mouse probed with an antibody against CDKL5.
More informationSupplementary Figure 1
Supplementary Figure 1 Control Pancreatitis Supplementary Figure 2 A Panc Liver SI Spleen H 2 O B EZH2 fl/fl C EZH2 fl/fl 37bp EZH2 ERK2 D E 5 EZH2 fl/fl Fasting Glucose (mg/dl) 2 18 16 14 12 1 8 6 4 2
More informationNeutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury
Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Bastian OW, Koenderman L, Alblas J, Leenen LPH, Blokhuis TJ. Neutrophils contribute to
More informationProteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival
Supplementary Information for Proteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival Tatsuro Kawamura 1, Makoto Kawatani 1, Makoto Muroi, Yasumitsu Kondoh,
More informationSupplemental Table S1
Supplemental Table S. Tumorigenicity and metastatic potential of 44SQ cell subpopulations a Tumorigenicity b Average tumor volume (mm ) c Lung metastasis d CD high /4 8. 8/ CD low /4 6./ a Mice were injected
More informationAn epithelial-to-mesenchymal transition-inducing potential of. granulocyte macrophage colony-stimulating factor in colon. cancer
An epithelial-to-mesenchymal transition-inducing potential of granulocyte macrophage colony-stimulating factor in colon cancer Yaqiong Chen, Zhi Zhao, Yu Chen, Zhonglin Lv, Xin Ding, Renxi Wang, He Xiao,
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationSupplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. EBV-gB 23-431 mainly exists as trimer in HEK 293FT cells. (a) Western blotting analysis for DSS crosslinked FLAG-gB 23-431. HEK 293FT cells transfected
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES 1 Supplementary Figure 1, Adult hippocampal QNPs and TAPs uniformly express REST a-b) Confocal images of adult hippocampal mouse sections showing GFAP (green), Sox2 (red), and REST
More informationFAK Copy Number. tumor 79. tumor 78. tumor 73. tumor 75. n=79 R 2 =0.09 P= FAK mrna (Log 2 ) MYC mrna (A.U.) n=79 R 2 =0.04 P=0.
A 25 Copy Number 2 15 1 5 B tumor 72 tumor 73 tumor 74 tumor 75 tumor 76 tumor 77 tumor 78 tumor 79 mrna (Log 2 ) 11 1 9 n=79 R 2 =.9 P=.5 C 15 1 2 3 / CEP8 Ratio MYC mrna (A.U.) 1 5 n=79 R 2 =.4 P=.7
More informationSupplementary Data Table of Contents:
Supplementary Data Table of Contents: - Supplementary Methods - Supplementary Figures S1(A-B) - Supplementary Figures S2 (A-B) - Supplementary Figures S3 - Supplementary Figures S4(A-B) - Supplementary
More informationEvaluation of directed and random motility in microslides Assessment of leukocyte adhesion in flow chambers
Evaluation of directed and random motility in microslides Motility experiments in IBIDI microslides, image acquisition and processing were performed as described. PMN, which ended up in an angle < 180
More informationHEK293FT cells were transiently transfected with reporters, N3-ICD construct and
Supplementary Information Luciferase reporter assay HEK293FT cells were transiently transfected with reporters, N3-ICD construct and increased amounts of wild type or kinase inactive EGFR. Transfections
More informationHIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates
HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates Department of Microbiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, USA
More informationSupporting Online Material Material and Methods References Supplemental Figures S1, S2, and S3
Supporting Online Material Material and Methods References Supplemental Figures S1, S2, and S3 Sarbassov et al. 1 Material and Methods Materials Reagents were obtained from the following sources: protein
More informationArgininosuccinate synthetase 1 suppression and arginine restriction inhibit cell
Argininosuccinate synthetase 1 suppression and arginine restriction inhibit cell migration in gastric cancer cell lines Yan-Shen Shan 1, Hui-Ping Hsu 1, Ming-Derg Lai 2,3, Meng-Chi Yen 2,4, Wei-Ching Chen
More informationTFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry
TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi
More informationSupplemental Materials and Methods Plasmids and viruses Quantitative Reverse Transcription PCR Generation of molecular standard for quantitative PCR
Supplemental Materials and Methods Plasmids and viruses To generate pseudotyped viruses, the previously described recombinant plasmids pnl4-3-δnef-gfp or pnl4-3-δ6-drgfp and a vector expressing HIV-1 X4
More informationGraveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document
Graveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document Wet Lab: Sara Olson and Lijun Zhan Computational Lab: Xintao Wei and Michael Duff PI: Brenton Graveley
More informationReason for Dissection. Pleomorphic adenoma. Tongue base adenocarcinoma
Supplementary Table S1 Human Patients Patient Sample No. Gender Age Additional Medication Treatment 1 Reason for Dissection Total Irradiation Dose Estimated Irradiation Dose to SG Gland Time of Resection
More information