Stem Cells and The Endometrium. Director, Division of Reproductive Endocrinology and infertility
|
|
- Roderick Barton
- 5 years ago
- Views:
Transcription
1 Stem Cells and The Endometrium Hugh S. Taylor, M.D. Director, Division of Reproductive Endocrinology and infertility
2 Nothing to disclose
3 Stem Cells Cells that are capable of both self-renewal and have broad potential to differentiate into multiple adult cell types. These cells may be derived from the inner cell mass or may be found in the adult. Bone marrow is one source of mutipotent adult stem cells.
4 Endometrium The endometrium, is known for its remarkable regenerative capacity as it undergoes dynamic changes each menstrual cycle. Need for stem cells to replenish the endometrium.
5 Endometrial Progenitor Stem Cells C.E. Gargett et al. Molecular and Cellular Endocrinology 288 (2008) 22 29
6 In the last 20 years, multipotent stem cells have been isolated multiple tissues. They are few in number. About 1 stem cell found in 100,000 cells circulating in the blood. Furthermore they resemble the other Furthermore, they resemble the other cells that surround them.
7
8 Can Bone Marrow Derived Cells Differentiate Into Endometrium?
9 Subjects Four bone marrow transplant recipients HLA type that allowed determination of the origin any cell Age Rx Chemotherapy and TBI
10 Methods Endometrial biopsy RT-PCR for HLA Immunohistochemistry for HLA and CD45
11 RT-PCR amplifying HLA AA11A11 Taylor HS, JAMA. 2004;292(1):81-5
12 Taylor HS, JAMA. 2004;292(1):81-5
13 Serial IHC for HLA and CD45 Taylor HS, JAMA. 2004;292(1):81-5
14 Marker of Differentiation Calcitonin HLA Merge Taylor HS, JAMA. 2004;292(1):81-5
15 Do Stem Cells Contribute to Endometrium in a murine model?
16 Identification of bone marrow-derived cells in murine-endometrium Transplant of Male bone marrow into female mice. Assessment of SRY gene expression and Y chromosome by FISH Du, H. and Taylor H. Stem Cells 2007;25:
17 Stem cell origin of endometrium in mouse Du, H. and Taylor H. Stem Cells 2007;25:
18 Male CD45 Cytokeritin
19 Stem Cells and Disease Can Stem Cells Contribute to Endometriosis i?
20 Support of Sampson s theory Dependent distribution Common occurrence of retrograde menstruation High incidence with outflow tract obstruction Tubal patency common Risk factors that include frequent menstruation and early menarchy. Animal models involving peritoneal transplant
21 Sampson s Theory does not explain the presence of endometriosis i outside of the peritoneal cavity or in men.
22 A Novel Origin of Endometriosis Do stem cells contribute to murine endometriosis?
23 Methods Wild Type and LacZ transgenic mice Hysterectomy Uterine transplant to ectopic location Beta-Galactosidase activity and Beta Galactosidase activity and expression
24 IHC using anti Beta-galacotosidase antibody Wt control LacZ transgenic Wt transplanted to LacZ transgenic Du, H. and Taylor H. Stem Cells 2007;25:
25 IHC using anti Beta-galactosidase Stromal Cells
26 X-GAL staining of Beta-Galactosidase activity Glandular cell Stromal Cell
27 Novel mechanism of disease- Ectopic transdifferentiation of stem cells.
28 Bone Marrow and Endometrial Stem Cells Potential for endometrial repair after disease. Explains failure of ablative therapies for abnormal bleeding. Novel mechanism of disease- Ectopic transdifferentiation of stem cells.
29 Does the Endometrium Contain Stem Cells that can Differentiate into Non- endometrial Cell Types?
30 Methods Reproductive aged women Endometrial biopsy Endometrial stromal cell culture Differentiation protocols
31 Chondrocytes Wolff E. and Taylor H Reproductive Sciences 2007
32
33 Type II Collagen
34 Neurogenic Differentiation
35 Flow cytometry: Human Endometrial Derived Stem Cells CD45 + (0.3%) CD31 + (1.4%) CD90 + (99.6%) Leukocyte Endothelial cell Stromal cell PDGFRß + (99.7%) CD146 + (99.7%) Wolff E et al JCMM 2010
36 in vitro to Control Endometrial Stromal Cells Neurogenic Differentiated 50 um 50 um Wolff E et al JCMM 2010
37 in vitro Nestin Expression 50 um 50 um 50 um DIC Immunofluorescence Merge Wolff E et al, JCMM 2010
38 in vitro Tyrosine Hydroxylase Expression Merge Wolff E et al, JCMM 2010
39 in vitro Dopamine Synthesis: Metabolites Present in Media Control Neurogenic DOPAC (Dihydroxyphenylacetic acid) ) 0.2 pg/ml 1.2 pg/ml Wolff E et al, JCMM 2010
40 Ba 2+ sensitive K + currents: GIRK2 Channels Undifferentiated HEDSC Neurogenic Baseline Wolff E et al, JCMM 2010
41 Parkinson s s Disease (PD) Model PD is a degenerative disorder of the central nervous system that impairs movement and speech PD is caused by deficiency of Dopamine production in the Substantia Nigra of the brain MPTP (1-methyl 4-phenyl 1,2,3,6- tetrahydropyridine) is a neurotoxin of dopamine producing cells MPTP induces a permanent model of PD
42 Human Endometrial Derived Stem Cells (HEDSC) Transplantation ti MPTP Parkinson's Disease PBS HEDSC
43 HEDSC Engraftment t PCR for Human DNA in Transplanted Brains
44 HEDSC Engraftment Human Nestin Antibody Wolff E et al, JCMM 2010
45 EDSC Neurotransplantation Engraft in mice brains PCR detects human DNA Engraft in mice brains Striatum t (transplant t site) Migrate & Differentiate morphologically in vivo Substantia nigra (lesion site)
46 ESC Neurotransplantation Rescues dopamine concentrations * *all p< * *
47 Pancreatic Beta Cells From Endometrial Stem Cells
48 Methods: Human endometrial tissue from subjects undergoing hysteroscopy/hysterectomy at P2-P5 (n=7) Differentiation following a 3 step-protocol SCID mouse model
49 β-pancreatic Gene Expression During Development Chandra V et al. Stem Cells2009 Aug;27(8):
50 Differentiation Protocol Standard protocol: In ECM gel Step 1: H-DMEM+10%FBS+10-6 M RA for 24 hours, H- DMEM+10%FBS for 48 hours Step 2: L-DMEM+10%FBS+10mmol/L nicotinamide+ 20ng/mL EGF for 7 days Step 3: L-DMEM+10%FBS+10 nmol/l exendin 4 for 7 days
51 Gene expression using standard protocol
52 In vitro differentiation Undifferentiated Step 2 Step 3
53 Ctrl S1 S2 S3 Pancreas PDX-1 Insulin β-actin
54 Modified Protocol Step 3
55 Immunofluorescence Insulin DAPI Undifferentiated Differentiated
56 Insulin Secretion et (ELISA)
57 Diabetes Animal Model Streptozotocin (200mg/kg ip) No transplantation 5 STZ 10 7 Undifferentiated endometrial cells Renal subcapsular transplantation 10 7 differentiated cells 4 Control 8 Cases SCID Female Mice
58 Control (undifferentiated tx) Treatment (differentiated cell Tx)
59 Endometrial Stem Cells Potential source of HLA identical stem cells in women Easily Obtainable bl Renewable e abe Can treat animal models of Parkinson s disease and diabetes.
60 Conclusions: Cell trafficking into the uterus likely contributes to uterine tissue regeneration and repair. Stem cells are a novel etiology of endometriosis The endometrium is a source of multipotent mesenchymal stem cells. These cells have a vast capacity for differentiation into multiple cell types useful in tissue repair and regenerative medicine.
61 Acknowledgements Stem Cell Group: o g g u Hongling Du NIH R01 HD NIH R01 ES Erin Wolff NIH U54 HD Xavier Santamaria Effi Massasa Yuping Zhou Collaborators: Xiao-Bing Gao Tamas Horvath
What is the Pathogenesis of Endometriosis?
Endometriosis Epigenetics and Stem Cells Hugh S. Taylor, MD Director of Reproductive Endocrinology and Infertility Yale University School of dicine What is the Pathogenesis of Endometriosis? Theories for
More informationStem cells in endometriosis: pathogenetic factors and target for new medical treatments? Alberto Revelli MD PhD
Stem cells in endometriosis: pathogenetic factors and target for new medical treatments? Alberto Revelli MD PhD Gyn/Obst 1U, Physiopathology of Reproduction and IVF Unit Dept. Surgical Sciences, S. Anna
More informationJournal Club WS 2012/13 Stefanie Nickl
Journal Club WS 2012/13 Stefanie Nickl Background Mesenchymal Stem Cells First isolation from bone marrow 30 ys ago Isolation from: spleen, heart, skeletal muscle, synovium, amniotic fluid, dental pulp,
More informationComparative morphometric characteristics of eutopic and ectopic endometrial cells in patients with endometriomas
Comparative morphometric characteristics of eutopic and ectopic endometrial cells in patients with endometriomas SEUD Congress 2015 Paris The pathogenesis of early-onset endometriosis has recently been
More informationCell therapeutics for the Insulin-Dependent Diabetes Mellitus
Cell therapeutics for the Insulin-Dependent Diabetes Mellitus Haekwon Kim Dept. of Biotechnology Seoul Women s University Introduction Type I diabetes is caused by the autoimmune destruction of pancreatic
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationMPB333:Molecular Endocrinology of Obesity and Diabetes
MPB333:Molecular Endocrinology of Obesity and Diabetes The Use of Stem Cells as a Cure for Type 1 Diabetes January 15, 2010 Trish Labosky 9415C MRBIV trish.labosky@vanderbilt.edu In theory. 2. ~Easy and
More informationFunctional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma
Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma Pei-Song Gao, MD, PhD Division of Allergy & Clinical Immunology Johns Hopkins University School
More informationReview. Endometriosis: a role for stem cells
Endometriosis is a complex gynecologic condition affecting 6 10% of reproductive aged women and is a major cause of chronic pain and infertility. Mechanisms of disease pathogenesis are poorly understood.
More informationStem cells: units of development and regeneration. Fernando D. Camargo Ph.D. Whitehead Fellow Whitehead Institute for Biomedical Research.
Stem cells: units of development and regeneration Fernando D. Camargo Ph.D. Whitehead Fellow Whitehead Institute for Biomedical Research Concepts 1. Embryonic vs. adult stem cells 2. Hematopoietic stem
More informationEndometrio ed endometriosi: the same tissue?
Endometrio ed endometriosi: the same tissue? Valentino Remorgida Clinica Ostetrica e Ginecologica IRCCS Azienda Ospedaliera Universitaria San Martino IST Istituto Nazionale per la Ricerca sul Cancro, Università
More informationDevelopment Supplementary information. Supplementary Figures * * +/+ +/- -/- +/+ +/- -/-
Development 144: doi:1.1242/dev.1473: Supplementary information Supplementary Figures A (f) FRT LoxP 2 3 4 B All Males Females I Ovary 1 (+) 77 bps (f) 78 bps (-) >13 bps (-) 2 4 (-) 424 bps M +/f +/-
More informationSTEM CELLS IN REFRACTORY ASHERMAN SYNDROME
STEM CELLS IN REFRACTORY ASHERMAN SYNDROME Dr Neeta Singh, MD, FICOG, FCPS, FIMSA Professor Division of Reproductive Medicine Department of Obstetrics & Gynecology All India Institute Of Medical Sciences
More informationReview Article Endometrial Stem Cells and Reproduction
Obstetrics and Gynecology International Volume 2012, Article ID 851367, 5 pages doi:10.1155/2012/851367 Review Article Endometrial Stem Cells and Reproduction Sara S. Morelli, Pauline Yi, and Laura T.
More informationIntracrine Androgens Enhance Decidualization and Modulate Expression of Human
Intracrine Androgens Enhance Decidualization and Modulate Expression of Human Endometrial Receptivity Genes. Authors: Douglas A Gibson 1, Ioannis Simitsidellis 1, Fiona L Cousins 1*, Hilary O.D. Critchley
More informationUMR 7221CNRS/MNHN Evolution des régulations endocriniennes Muséum National d Histoire Naturelle Paris - France
Role of Foxl2 and Dlx5/6 on uterine development and function: implications for BPES UMR 7221CNRS/MNHN Evolution des régulations endocriniennes Muséum National d Histoire Naturelle Paris - France TAKE HOME
More informationMeeting Report. From December 8 to 11, 2012 at Atlanta, GA, U.S.A
Meeting Report Affiliation Department of Transfusion Medicine and Cell Therapy Name Hisayuki Yao Name of the meeting Period and venue Type of your presentation Title of your presentation The 54 th Annual
More informationConverting Novel Therapeutic Models into Early Phase Clinical Trials
Converting Novel Therapeutic Models into Early Phase Clinical Trials James H. Doroshow, M.D. Deputy Director for Clinical and Translational Research National Cancer Institute, NIH IOM National Cancer Policy
More informationstem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products
stem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products Stem Cell Qualified Extracellular Matrix Proteins Stem cell research requires the finest
More informationMaking Mature Human Islet Cells from Stem Cells to Model Disease and Treat Diabetes
University of British Columbia Departments of Surgery and Cellular & Physiological Sciences Making Mature Human Islet Cells from Stem Cells to Model Disease and Treat Diabetes 2016 International Conference
More informationNeuroprotection in preclinical models of Parkinson disease by the NAPVSIPQ peptide
Neuroprotection in preclinical models of Parkinson disease by the NAPVSIPQ peptide Bruce H. Morimoto, Ph.D. Executive Director, Applied Translational Medicine Microtubules Microtubules essential for neuronal
More informationTransplanted Donor Cells Rescue Contra-Lateral Chemo-ablated Muscle Bed
Only 25% of Nuclei are of Donor Origin! R + BCNU DONOR (i.m.) or MGMTP140K WT L + BCNU SALINE (i.m.) O6BG (i.p.) Transplanted Donor Cells Rescue Contra-Lateral Chemo-ablated Muscle Bed Transplanted Donor
More informationRecombinant adenovirus carrying glial cell line2derived neurotrophic factor gene protect midbra in dopaminergic neurons in mice
256 ( ) JOURNAL OF PEKIN G UNIVERSITY( HEAL TH SCIENCES) Vol. 35 No. 3 J une 2003 ( 100083) [ ] ; ;MPTP [ ] : (r GDNF) (DA) 2 2 (MPTP) :LacZ (Ad2LacZ) 24 h 72 h 10 d 30 d X2Gal ;r GDNF (Ad2r GDNF) 72 h
More informationDISCLOSURE. I have the following financial relationships:
DISCLOSURE I have the following financial relationships: Consultant for: Fate Therapeutics, GlaxoSmithKline, Bone Therapeutics, G1 Therapeutics Contracted Research for: GlaxoSmithKline Royalties from:
More informationParacrine Mechanisms in Adult Stem Cell Signaling and Therapy
Paracrine Mechanisms in Adult Stem Cell Signaling and Therapy Massimiliano Gnecchi, Zhiping Zhang, Aiguo Ni, Victor J. Dzau Circulation Research 2008 Nov 21;103(11):1204-19 Introduction(1) After AMI all
More informationReview Article Stem cell and endometriosis: new knowledge may be producing novel therapies
Int J Clin Exp Med 2014;7(11):3853-3858 www.ijcem.com /ISSN:1940-5901/IJCEM0002199 Review Article Stem cell and endometriosis: new knowledge may be producing novel therapies Jing Yang, Fengying Huang Department
More informationβ-cell Preservation and Regeneration After Islet Transplantation
β-cell Preservation and Regeneration After Islet Transplantation Jyuhn-Huarng Juang, MD Division of Endocrinology and Metabolism, Department of Internal Medicine, Chang Gung University and Memorial Hospital,
More informationReviewer #1 (Remarks to the Author)
Reviewer #1 (Remarks to the Author) This manuscript presents an engineering system designed to culture and maintain living tissue from female reproductive organs. The modular capacity, reconfigurability,
More informationSecondary Negative Effects of Isolation Enzyme (s) On Human Islets. A.N.Balamurugan
Secondary Negative Effects of Isolation Enzyme (s) On Human Islets A.N.Balamurugan Human Islets Functional Mass Preservation 18-25 min 10 min 8-12 min 10-15 min 45-60 min pancreas in chamber 37º Sub-Optimal
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationIslets of Langerhans consist mostly of insulin-producing β cells. They will appear to be densely labeled
Are adult pancreatic beta cells formed by self-duplication or stem cell differentiation? Introduction Researchers have long been interested in how tissues produce and maintain the correct number of cells
More informationEndometriosis. *Chocolate cyst in the ovary
Endometriosis What is endometriosis? Endometriosis is a common condition in young women. It's chronic, painful, and it often progressively gets worse over the time. *Chocolate cyst in the ovary Normally,
More informationSupplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated
Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1. Long-term protection studies. 45 minutes of ischemia was induced in wild type (S1pr2 +/+ ) and S1pr2 -/- by MCAO. A) 5 days later brains were harvested
More informationSupporting Information
Supporting Information Chan et al. 1.173/pnas.9654916 A Patient B Xenograft C * remaining feature of normal lymph node * * * D lymphocytes Infiltrating transitional carcinoma cells E Enlarged axillary
More informationFigure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B)
Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) PCR identified expected hhb-egf band (left panel) and HA tag band (right) in kidneys of transgenic (TG) mice
More informationExosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway
Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway Jieyuan Zhang, Xiaolin Liu, Haiyan Li, Chunyuan Chen, Bin Hu, Xin Niu, Qing
More informationNeutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury
Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Bastian OW, Koenderman L, Alblas J, Leenen LPH, Blokhuis TJ. Neutrophils contribute to
More informationNasser Aghdami MD., PhD
CONTRIBUTON OF HUMAN INDUCED PLURIPOTENT STEM CELL DERIVED ENDOTHELIAL CELLS IN VASCULAR REGENERATION OF BLEOMYCIN-INDUCED SCLERODERMA MOUSE MODEL Nasser Aghdami MD., PhD Department of Regenerative Medicine
More informationCell Therapy for Diabetes: Generating Functional Islets from Human Exocrine Tissue
Cell Therapy for Diabetes: Generating Functional Islets from Human Exocrine Tissue Kevin Docherty University of Aberdeen ELRIG Drug Discovery 2016 ACC Liverpool 14 th October 2016 Autoimmune destruction
More informationMouse Models for Studying Human Islet Transplantation
Mouse Models for Studying Human Islet Transplantation Ronald G. Gill, Joshua Beilke,, Nathan Kuhl,, Michelle Kerklo, and Mark M. Nicolls Barbara Davis Center for Childhood Diabetes University of Colorado
More informationStem cells and Cancer. John Glod. December 2, 2009
Stem cells and Cancer John Glod Lehigh University Lehigh University December 2, 2009 The Tumor Microenvironment Littlepage et al Cancer Cell 2005 Cancer Stem Cells A small group of cells within the larger
More informationBlood 101 Introduction Blood and Marrow & Overview of Bone Marrow Failure Diseases. Dr. M. Sabloff October 16 th 2010
Blood 101 Introduction Blood and Marrow & Overview of Bone Marrow Failure Diseases Dr. M. Sabloff October 16 th 2010 Normal Marrow knee joint white is articular cartilage Adjacent to this is the red marrow
More informationSDF-1/CXCR4 Axis on Endothelial Progenitor Cells Regulates Bone Fracture Healing
SDF-1/CXCR4 Axis on Endothelial Progenitor Cells Regulates Bone Fracture Healing Yohei Kawakami, M.D., Ph.D. 1,2, Masaaki Ii 3, Tomoyuki Matsumoto, M.D., Ph.D. 1, Astuhiko Kawamoto, M.D., Ph.D. 2, Yutaka
More informationX P. Supplementary Figure 1. Nature Medicine: doi: /nm Nilotinib LSK LT-HSC. Cytoplasm. Cytoplasm. Nucleus. Nucleus
a b c Supplementary Figure 1 c-kit-apc-eflu780 Lin-FITC Flt3-Linc-Kit-APC-eflu780 LSK Sca-1-PE-Cy7 d e f CD48-APC LT-HSC CD150-PerCP-cy5.5 g h i j Cytoplasm RCC1 X Exp 5 mir 126 SPRED1 SPRED1 RAN P SPRED1
More informationMesenchymal Stem Cells to Repair Vascular Damage after Chemotherapy: Past, Present and Future
Mesenchymal Stem Cells to Repair Vascular Damage after Chemotherapy: Past, Present and Future Cell Therapy 2014 Las Vegas, NV, USA Sulaiman Al-Hashmi, PhD Sultan Qaboos University Oman What are MSCs? Stem
More informationThe Wnt/βcatenin signaling pathway
Wnt signaling is crucial for functioning of the endometrium The Role of Wnt Signaling in Uterus Development (I) and in Homeostasis (II) and Malignancy (III) of the Uterine Endometrium Leen J Blok Erasmus
More informationHematopoiesis. - Process of generation of mature blood cells. - Daily turnover of blood cells (70 kg human)
Hematopoiesis - Process of generation of mature blood cells - Daily turnover of blood cells (70 kg human) 1,000,000,000,000 total cells 200,000,000,000 red blood cells 70,000,000,000 neutrophils Hematopoiesis
More informationParkinsonism or Parkinson s Disease I. Symptoms: Main disorder of movement. Named after, an English physician who described the then known, in 1817.
Parkinsonism or Parkinson s Disease I. Symptoms: Main disorder of movement. Named after, an English physician who described the then known, in 1817. Four (4) hallmark clinical signs: 1) Tremor: (Note -
More informationGerm Cell Transplantation in Fish
Larvi 2009 Germ Cell Transplantation in Fish Goro Yoshizaki (Tokyo University of Marine Science and Technology, SORST/JST) Tuna Mackerel Body weight; 300 kg 300 g Body length; 3 m 30 cm Scombridae family
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:1.138/nature11463 %Sox17(+) 9 8 7 6 5 4 3 2 1 %Sox17(+) #Sox17(+) d2 d4 d6 d8 d1 d12 d14 d18 25 2 15 1 5 Number of Sox17(+) cells X 1 Supplementary Figure 1: Expression of
More informationSupplementary Figure 1.
Supplementary Figure 1. Increased expression of cell cycle pathway genes in insulin + Glut2 low cells of STZ-induced diabetic islets. A) random blood glucose measuers of STZ and vehicle treated MIP-GFP
More informationThe Contribution Of Tie2-Lineage Cells To rhbmp-2 Induced Bone Formation
The Contribution Of Tie2-Lineage Cells To rhbmp-2 Induced Bone Formation Mille P. Kolind, Ph.D 1, Alastair Aiken 1, Kathy Mikulec 1, Lauren Peacock 1, David Little 1,2, Aaron Schindeler, PhD 1,2. 1 Orthopaedic
More informationTissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science
Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration
More informationRegenerative Medicine for Cardiomyocytes
Regenerative Medicine Regenerative Medicine for JMAJ 47(7): 328 332, 2004 Keiichi FUKUDA Assistant Professor, Institute for Advanced Cardiac Therapeutics, Keio University School of Medicine Abstract: Heart
More informationResident cardiac stem cells: how to find and use them
Resident cardiac stem cells: how to find and use them G. Hasenfuß Cardiology and Pneumology Heart Research Center Göttingen Georg-August-University Göttingen Definition: Stem cell Selfrenewal Stem cell
More informationEndometriosis. Assoc.Prof.Pawin Puapornpong, Faculty of Medicine, Srinakharinwirot University.
Endometriosis Assoc.Prof.Pawin Puapornpong, Faculty of Medicine, Srinakharinwirot University. Endometriosis Definition: Ectopic Endometrial Tissue True Incidence Unknown:? 1-5% Does NOT Discriminate by
More informationSupplementary Figure 1:
Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas
More informationProgesterone responsiveness is not downregulated in adenomyosis.
Progesterone responsiveness is not downregulated in adenomyosis. Takehiro Hiraoka Yasushi Hirota Tomoko Saito-Fujita Hirofumi Haraguchi Miyuki Harada Tetsuya Hirata Kaori Koga Osamu Hiraike Tomoyuki Fujii
More informationThe Role of Rac Signaling in The Perivascular Niche
The Role of Rac Signaling in The Perivascular Niche Felicia Ciuculescu Diaspora and Higher Education and Research Perspectives in Personalized Medicine- from Concept to Clinical Application Center for
More informationWe are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors
We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists 3,700 108,500 1.7 M Open access books available International authors and editors Downloads Our
More informationSupplementary Table 1. Characterization of HNSCC PDX models established at MSKCC
Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC Supplementary Table 2. Drug content and loading efficiency estimated with F-NMR and UV- Vis Supplementary Table 3. Complete
More informationRegulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair
Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Chapter 04 Boek 1_Gie.indb 55 21-05-2007 12:27:33 Chapter 04 Abstract Goal: TGF-b and IGF-I
More informationTo this end, we performed immunofluorescent staining for GSCs (Fig.3). All the spheroidforming cells showed immunoreactivity for
H.Yoshioka et al. lished for isolation ofneural stem cells. Within 24-48 hours of primary culture, murine brain tumors yielded a minority fraction of cells that formed neurosphere-like clusters (tumor
More informationTopically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals
Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Stem cells move to injured area, differentiate into neighboring cells, and replace the damaged cells Cell Eons Stem cells
More informationChronic variable stress activates hematopoietic stem cells
SUPPLEMENTARY INFORMATION Chronic variable stress activates hematopoietic stem cells Timo Heidt *, Hendrik B. Sager *, Gabriel Courties, Partha Dutta, Yoshiko Iwamoto, Alex Zaltsman, Constantin von zur
More informationWhat is endometrial cancer?
Uterine cancer What is endometrial cancer? Endometrial cancer is the growth of abnormal cells in the lining of the uterus. The lining is called the endometrium. Endometrial cancer usually occurs in women
More informationChapter 3 Theories on Endometriosis
Chapter 3 Theories on Endometriosis Sajal Gupta, Avi Harlev, Ashok Agarwal, and Elizabeth Pandithurai 3.1 Sampson s Theory There are several theories as to how endometriosis develops, but the most widely
More informationGBME graduate course. Chapter 43. The Basal Ganglia
GBME graduate course Chapter 43. The Basal Ganglia Basal ganglia in history Parkinson s disease Huntington s disease Parkinson s disease 1817 Parkinson's disease (PD) is a degenerative disorder of the
More informationEarly cell death (FGF) B No RunX transcription factor produced Yes No differentiation
Solution Key - Practice Questions Question 1 a) A recent publication has shown that the fat stem cells (FSC) can act as bone stem cells to repair cavities in the skull, when transplanted into immuno-compromised
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Pleiotrophin Regulates the Expansion and Regeneration of Hematopoietic Stem Cells Heather A Himburg 1, Garrett G Muramoto 1 *, Pamela Daher 1*, Sarah K Meadows 1, J. Lauren Russell
More informationPearson r = P (one-tailed) = n = 9
8F4-Specific Lysis, % 1 UPN1 UPN3 8 UPN7 6 Pearson r =.69 UPN2 UPN5 P (one-tailed) =.192 4 UPN8 n = 9 2 UPN9 UPN4 UPN6 5 1 15 2 25 8 8F4, % Max MFI Supplementary Figure S1. AML samples UPN1-UPN9 show variable
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationThe toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells
1 SUPPLEMENTARY INFORMATION The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells Karin Loser 1,2,6, Thomas Vogl 2,3, Maik Voskort 1, Aloys
More informationSUPPLEMENTARY INFORMATION
Haematopoietic stem cell release is regulated by circadian oscillations Simón Méndez-Ferrer *, Daniel Lucas *, Michela Battista * and Paul S. Frenette * Mount Sinai School of Medicine, *Departments of
More informationStem cells. -Dr Dinesh Bhurani, MD, DM, FRCPA. Rajiv Gandhi Cancer Institute, Delhi, -Director, Department of Haematology and BMT
Stem cells -Dr Dinesh Bhurani, MD, DM, FRCPA -Director, Department of Haematology and BMT Rajiv Gandhi Cancer Institute, Delhi, Flow of presentation Update on stem cell uses Haematopoietic stem cell transplantation
More informationSupplemental Table 1. Primer sequences for transcript analysis
Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationEndometriosis and Infertility - FAQs
Published on: 8 Apr 2013 Endometriosis and Infertility - FAQs Introduction The inner lining of the uterus is called the endometrium and it responds to changes that take place during a woman's monthly menstrual
More informationPathogenesis of Degenerative Diseases and Dementias. D r. Ali Eltayb ( U. of Omdurman. I ). M. Path (U. of Alexandria)
Pathogenesis of Degenerative Diseases and Dementias D r. Ali Eltayb ( U. of Omdurman. I ). M. Path (U. of Alexandria) Dementias Defined: as the development of memory impairment and other cognitive deficits
More informationHighly Efficient CRISPR/Cas9 Gene Editing and Long-Term Engraftment of Human Hematopoietic Stem and Progenitor Cells
Highly Efficient CRISPR/Cas9 Gene Editing and Long-Term Engraftment of Human Hematopoietic Stem and Progenitor Cells J. M. Heath, A. Chalishazar, C.S. Lee, W. Selleck, C. Cotta-Ramusino, D. Bumcrot, J.L.
More informationDIP.G.O. EXAMINATION 2007
DIP.G.O. EXAMINATION 2007 GYNAECOLOGY Batch A/07 Time : 2 hrs. Question 1. a. Define Dysfunctional Uterine Bleeding 10 b. What are the various terms used to describe menstrual disorder? 10 Question 2.
More informationWhat s (new) and Important in Reporting of Uterine Cancers Katherine Vroobel The Royal Marsden
What s (new) and Important in Reporting of Uterine Cancers Katherine Vroobel The Royal Marsden Maastricht Pathology 2018 Wednesday 20 th June Endometrioid adenocarcinoma High grade carcinomas (common)
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2610 Figure S1 FSMCs derived from MSLN CLN transgenic mice express smooth muscle-specific proteins. Beta-galactosidase is ubiquitously expressed within cultured FSMCs derived from MSLN
More informationDAX1, testes development role 7, 8 DFFRY, spermatogenesis role 49 DMRT genes, male sex differentiation role 15
Subject Index N-Acetylcysteine, sperm quality effects 71 Ambiguous genitalia, origins 1, 2 Anti-Müllerian hormone function 13 receptors 13 Sertoli cell secretion 10, 38 Apoptosis assays in testes 73, 74
More informationAccelerate Your Research with Conversant Bio
Accelerate Your Research with Conversant Bio 400+ Participating MDs 50+ Partner sites for tissue procurement Continuous expansion of sourcing capabilities Closely monitored chain of custody Full regulatory
More informationSupplementary Figure 1. Chimeric analysis of inner ears. (A-H) Chimeric inner ears with fluorescent ES cells and (I,J) Rainbow inner ears.
Supplementary Figure 1. himeric analysis of inner ears. (A-H) himeric inner ears with fluorescent ES cells and (I,J) Rainbow inner ears. (A,B) omposite images showing three colors in different vestibular
More informationFigure legends Supplemental Fig.1. Glucose-induced insulin secretion and insulin content of islets. Supplemental Fig. 2.
Figure legends Supplemental Fig.. Glucose-induced insulin secretion and insulin content of islets. Insulin secretory responses to.,., and. mm glucose (A) (n = 7-), and the insulin content in the islets
More informationSupplementary Information
Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1
More informationProtective effect of ginsenoside Rg1 against MPTP-induced apoptosis in mouse substantia nigra neurons 1
Chen XC et al / Acta Pharmacol Sin 2002 Sep; 23 (9): 829-834 829 2002, Acta Pharmacologica Sinica ISSN 1671-4083 Shanghai Institute of Materia Medica Chinese Academy of Sciences http://www.chinaphar.com
More informationUpdates in Gynecologic Oncology. Todd Boren, MD Gynecologic Oncologist Chattanooga s Program in Women s Oncology Sept 8 th, 2018
Updates in Gynecologic Oncology Todd Boren, MD Gynecologic Oncologist Chattanooga s Program in Women s Oncology Sept 8 th, 2018 COI I have no conflict of interest to report Endometrial Cancer: Risk Factors
More informationResearch Article Investigation of Tenascin Expression in Endometriosis
International Scholarly Research Network ISRN Pathology Volume 2012, Article ID 873759, 5 pages doi:10.5402/2012/873759 Research Article Investigation of Tenascin Expression in Endometriosis Zehra Sema
More informationEndometrial tissue in peritoneal fluid
FERTILITY AND STERILITY Copyright c 1986 The American Fertility Society Printed in UBA. Endometrial tissue in peritoneal fluid Delphine Bartosik, M.D. *t Samuel L. Jacobs, M.D.* Lynda J. Kelly, C.T.:J:
More informationSUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences.
Supplementary Table 2. Antibodies used for Immunofluoresence. Antibody Dilution Source Goat anti-pdx1 1:100 R&D Systems Rabbit anti-hnf6 1:100 Santa Cruz Biotechnology Mouse anti-nkx6.1 1:200 Developmental
More informationCRIPTO-1 A POSSIBLE NEW BIOMARKER IN GLIOBLASTOMA MULTIFORME PIA OLESEN, MD, PHD STUDENT
CRIPTO-1 A POSSIBLE NEW BIOMARKER IN GLIOBLASTOMA MULTIFORME PIA OLESEN, MD, PHD STUDENT Glioblastoma WHO Grade IV Glioma Heterogenic Undiffenrentiated phenotype 50% of all Gliomas Around 600 patients
More informationCell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice
Supplementary Methods: Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice and gently meshed in DMEM containing 10% FBS to prepare for single cell suspensions. CD4 + CD25
More informationInteractions between cancer stem cells and their niche govern metastatic colonization
Correction Interactions between cancer stem cells and their niche govern metastatic colonization Ilaria Malanchi, Albert Santamaria-Martínez, Evelyn Susanto, Hong Peng, Hans-Anton Lehr, Jean-Francois Delaloye
More informationReceived, June 29, 1904; accepted for publication
THE AMEBICAN JOURNAL OF CLINICAL PATHOLOGY Copyright 1964 by The Williams & Wilkins Co. Vol. 42, No. 0 Printed in U.S.A. CARCINOMA IN SITU OF THE ENDOMETRIUM ISABELLE A. BUEHL, M.D., PRANK VELLIOS, M.D.,
More informationIntracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation
Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining Btk activation Xingguang Liu, Zhenzhen Zhan, Dong Li, Li Xu, Feng Ma, Peng Zhang, Hangping Yao and Xuetao
More information