Stem Cells and The Endometrium. Director, Division of Reproductive Endocrinology and infertility

Size: px
Start display at page:

Download "Stem Cells and The Endometrium. Director, Division of Reproductive Endocrinology and infertility"

Transcription

1 Stem Cells and The Endometrium Hugh S. Taylor, M.D. Director, Division of Reproductive Endocrinology and infertility

2 Nothing to disclose

3 Stem Cells Cells that are capable of both self-renewal and have broad potential to differentiate into multiple adult cell types. These cells may be derived from the inner cell mass or may be found in the adult. Bone marrow is one source of mutipotent adult stem cells.

4 Endometrium The endometrium, is known for its remarkable regenerative capacity as it undergoes dynamic changes each menstrual cycle. Need for stem cells to replenish the endometrium.

5 Endometrial Progenitor Stem Cells C.E. Gargett et al. Molecular and Cellular Endocrinology 288 (2008) 22 29

6 In the last 20 years, multipotent stem cells have been isolated multiple tissues. They are few in number. About 1 stem cell found in 100,000 cells circulating in the blood. Furthermore they resemble the other Furthermore, they resemble the other cells that surround them.

7

8 Can Bone Marrow Derived Cells Differentiate Into Endometrium?

9 Subjects Four bone marrow transplant recipients HLA type that allowed determination of the origin any cell Age Rx Chemotherapy and TBI

10 Methods Endometrial biopsy RT-PCR for HLA Immunohistochemistry for HLA and CD45

11 RT-PCR amplifying HLA AA11A11 Taylor HS, JAMA. 2004;292(1):81-5

12 Taylor HS, JAMA. 2004;292(1):81-5

13 Serial IHC for HLA and CD45 Taylor HS, JAMA. 2004;292(1):81-5

14 Marker of Differentiation Calcitonin HLA Merge Taylor HS, JAMA. 2004;292(1):81-5

15 Do Stem Cells Contribute to Endometrium in a murine model?

16 Identification of bone marrow-derived cells in murine-endometrium Transplant of Male bone marrow into female mice. Assessment of SRY gene expression and Y chromosome by FISH Du, H. and Taylor H. Stem Cells 2007;25:

17 Stem cell origin of endometrium in mouse Du, H. and Taylor H. Stem Cells 2007;25:

18 Male CD45 Cytokeritin

19 Stem Cells and Disease Can Stem Cells Contribute to Endometriosis i?

20 Support of Sampson s theory Dependent distribution Common occurrence of retrograde menstruation High incidence with outflow tract obstruction Tubal patency common Risk factors that include frequent menstruation and early menarchy. Animal models involving peritoneal transplant

21 Sampson s Theory does not explain the presence of endometriosis i outside of the peritoneal cavity or in men.

22 A Novel Origin of Endometriosis Do stem cells contribute to murine endometriosis?

23 Methods Wild Type and LacZ transgenic mice Hysterectomy Uterine transplant to ectopic location Beta-Galactosidase activity and Beta Galactosidase activity and expression

24 IHC using anti Beta-galacotosidase antibody Wt control LacZ transgenic Wt transplanted to LacZ transgenic Du, H. and Taylor H. Stem Cells 2007;25:

25 IHC using anti Beta-galactosidase Stromal Cells

26 X-GAL staining of Beta-Galactosidase activity Glandular cell Stromal Cell

27 Novel mechanism of disease- Ectopic transdifferentiation of stem cells.

28 Bone Marrow and Endometrial Stem Cells Potential for endometrial repair after disease. Explains failure of ablative therapies for abnormal bleeding. Novel mechanism of disease- Ectopic transdifferentiation of stem cells.

29 Does the Endometrium Contain Stem Cells that can Differentiate into Non- endometrial Cell Types?

30 Methods Reproductive aged women Endometrial biopsy Endometrial stromal cell culture Differentiation protocols

31 Chondrocytes Wolff E. and Taylor H Reproductive Sciences 2007

32

33 Type II Collagen

34 Neurogenic Differentiation

35 Flow cytometry: Human Endometrial Derived Stem Cells CD45 + (0.3%) CD31 + (1.4%) CD90 + (99.6%) Leukocyte Endothelial cell Stromal cell PDGFRß + (99.7%) CD146 + (99.7%) Wolff E et al JCMM 2010

36 in vitro to Control Endometrial Stromal Cells Neurogenic Differentiated 50 um 50 um Wolff E et al JCMM 2010

37 in vitro Nestin Expression 50 um 50 um 50 um DIC Immunofluorescence Merge Wolff E et al, JCMM 2010

38 in vitro Tyrosine Hydroxylase Expression Merge Wolff E et al, JCMM 2010

39 in vitro Dopamine Synthesis: Metabolites Present in Media Control Neurogenic DOPAC (Dihydroxyphenylacetic acid) ) 0.2 pg/ml 1.2 pg/ml Wolff E et al, JCMM 2010

40 Ba 2+ sensitive K + currents: GIRK2 Channels Undifferentiated HEDSC Neurogenic Baseline Wolff E et al, JCMM 2010

41 Parkinson s s Disease (PD) Model PD is a degenerative disorder of the central nervous system that impairs movement and speech PD is caused by deficiency of Dopamine production in the Substantia Nigra of the brain MPTP (1-methyl 4-phenyl 1,2,3,6- tetrahydropyridine) is a neurotoxin of dopamine producing cells MPTP induces a permanent model of PD

42 Human Endometrial Derived Stem Cells (HEDSC) Transplantation ti MPTP Parkinson's Disease PBS HEDSC

43 HEDSC Engraftment t PCR for Human DNA in Transplanted Brains

44 HEDSC Engraftment Human Nestin Antibody Wolff E et al, JCMM 2010

45 EDSC Neurotransplantation Engraft in mice brains PCR detects human DNA Engraft in mice brains Striatum t (transplant t site) Migrate & Differentiate morphologically in vivo Substantia nigra (lesion site)

46 ESC Neurotransplantation Rescues dopamine concentrations * *all p< * *

47 Pancreatic Beta Cells From Endometrial Stem Cells

48 Methods: Human endometrial tissue from subjects undergoing hysteroscopy/hysterectomy at P2-P5 (n=7) Differentiation following a 3 step-protocol SCID mouse model

49 β-pancreatic Gene Expression During Development Chandra V et al. Stem Cells2009 Aug;27(8):

50 Differentiation Protocol Standard protocol: In ECM gel Step 1: H-DMEM+10%FBS+10-6 M RA for 24 hours, H- DMEM+10%FBS for 48 hours Step 2: L-DMEM+10%FBS+10mmol/L nicotinamide+ 20ng/mL EGF for 7 days Step 3: L-DMEM+10%FBS+10 nmol/l exendin 4 for 7 days

51 Gene expression using standard protocol

52 In vitro differentiation Undifferentiated Step 2 Step 3

53 Ctrl S1 S2 S3 Pancreas PDX-1 Insulin β-actin

54 Modified Protocol Step 3

55 Immunofluorescence Insulin DAPI Undifferentiated Differentiated

56 Insulin Secretion et (ELISA)

57 Diabetes Animal Model Streptozotocin (200mg/kg ip) No transplantation 5 STZ 10 7 Undifferentiated endometrial cells Renal subcapsular transplantation 10 7 differentiated cells 4 Control 8 Cases SCID Female Mice

58 Control (undifferentiated tx) Treatment (differentiated cell Tx)

59 Endometrial Stem Cells Potential source of HLA identical stem cells in women Easily Obtainable bl Renewable e abe Can treat animal models of Parkinson s disease and diabetes.

60 Conclusions: Cell trafficking into the uterus likely contributes to uterine tissue regeneration and repair. Stem cells are a novel etiology of endometriosis The endometrium is a source of multipotent mesenchymal stem cells. These cells have a vast capacity for differentiation into multiple cell types useful in tissue repair and regenerative medicine.

61 Acknowledgements Stem Cell Group: o g g u Hongling Du NIH R01 HD NIH R01 ES Erin Wolff NIH U54 HD Xavier Santamaria Effi Massasa Yuping Zhou Collaborators: Xiao-Bing Gao Tamas Horvath

What is the Pathogenesis of Endometriosis?

What is the Pathogenesis of Endometriosis? Endometriosis Epigenetics and Stem Cells Hugh S. Taylor, MD Director of Reproductive Endocrinology and Infertility Yale University School of dicine What is the Pathogenesis of Endometriosis? Theories for

More information

Stem cells in endometriosis: pathogenetic factors and target for new medical treatments? Alberto Revelli MD PhD

Stem cells in endometriosis: pathogenetic factors and target for new medical treatments? Alberto Revelli MD PhD Stem cells in endometriosis: pathogenetic factors and target for new medical treatments? Alberto Revelli MD PhD Gyn/Obst 1U, Physiopathology of Reproduction and IVF Unit Dept. Surgical Sciences, S. Anna

More information

Journal Club WS 2012/13 Stefanie Nickl

Journal Club WS 2012/13 Stefanie Nickl Journal Club WS 2012/13 Stefanie Nickl Background Mesenchymal Stem Cells First isolation from bone marrow 30 ys ago Isolation from: spleen, heart, skeletal muscle, synovium, amniotic fluid, dental pulp,

More information

Comparative morphometric characteristics of eutopic and ectopic endometrial cells in patients with endometriomas

Comparative morphometric characteristics of eutopic and ectopic endometrial cells in patients with endometriomas Comparative morphometric characteristics of eutopic and ectopic endometrial cells in patients with endometriomas SEUD Congress 2015 Paris The pathogenesis of early-onset endometriosis has recently been

More information

Cell therapeutics for the Insulin-Dependent Diabetes Mellitus

Cell therapeutics for the Insulin-Dependent Diabetes Mellitus Cell therapeutics for the Insulin-Dependent Diabetes Mellitus Haekwon Kim Dept. of Biotechnology Seoul Women s University Introduction Type I diabetes is caused by the autoimmune destruction of pancreatic

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

MPB333:Molecular Endocrinology of Obesity and Diabetes

MPB333:Molecular Endocrinology of Obesity and Diabetes MPB333:Molecular Endocrinology of Obesity and Diabetes The Use of Stem Cells as a Cure for Type 1 Diabetes January 15, 2010 Trish Labosky 9415C MRBIV trish.labosky@vanderbilt.edu In theory. 2. ~Easy and

More information

Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma

Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma Pei-Song Gao, MD, PhD Division of Allergy & Clinical Immunology Johns Hopkins University School

More information

Review. Endometriosis: a role for stem cells

Review. Endometriosis: a role for stem cells Endometriosis is a complex gynecologic condition affecting 6 10% of reproductive aged women and is a major cause of chronic pain and infertility. Mechanisms of disease pathogenesis are poorly understood.

More information

Stem cells: units of development and regeneration. Fernando D. Camargo Ph.D. Whitehead Fellow Whitehead Institute for Biomedical Research.

Stem cells: units of development and regeneration. Fernando D. Camargo Ph.D. Whitehead Fellow Whitehead Institute for Biomedical Research. Stem cells: units of development and regeneration Fernando D. Camargo Ph.D. Whitehead Fellow Whitehead Institute for Biomedical Research Concepts 1. Embryonic vs. adult stem cells 2. Hematopoietic stem

More information

Endometrio ed endometriosi: the same tissue?

Endometrio ed endometriosi: the same tissue? Endometrio ed endometriosi: the same tissue? Valentino Remorgida Clinica Ostetrica e Ginecologica IRCCS Azienda Ospedaliera Universitaria San Martino IST Istituto Nazionale per la Ricerca sul Cancro, Università

More information

Development Supplementary information. Supplementary Figures * * +/+ +/- -/- +/+ +/- -/-

Development Supplementary information. Supplementary Figures * * +/+ +/- -/- +/+ +/- -/- Development 144: doi:1.1242/dev.1473: Supplementary information Supplementary Figures A (f) FRT LoxP 2 3 4 B All Males Females I Ovary 1 (+) 77 bps (f) 78 bps (-) >13 bps (-) 2 4 (-) 424 bps M +/f +/-

More information

STEM CELLS IN REFRACTORY ASHERMAN SYNDROME

STEM CELLS IN REFRACTORY ASHERMAN SYNDROME STEM CELLS IN REFRACTORY ASHERMAN SYNDROME Dr Neeta Singh, MD, FICOG, FCPS, FIMSA Professor Division of Reproductive Medicine Department of Obstetrics & Gynecology All India Institute Of Medical Sciences

More information

Review Article Endometrial Stem Cells and Reproduction

Review Article Endometrial Stem Cells and Reproduction Obstetrics and Gynecology International Volume 2012, Article ID 851367, 5 pages doi:10.1155/2012/851367 Review Article Endometrial Stem Cells and Reproduction Sara S. Morelli, Pauline Yi, and Laura T.

More information

Intracrine Androgens Enhance Decidualization and Modulate Expression of Human

Intracrine Androgens Enhance Decidualization and Modulate Expression of Human Intracrine Androgens Enhance Decidualization and Modulate Expression of Human Endometrial Receptivity Genes. Authors: Douglas A Gibson 1, Ioannis Simitsidellis 1, Fiona L Cousins 1*, Hilary O.D. Critchley

More information

UMR 7221CNRS/MNHN Evolution des régulations endocriniennes Muséum National d Histoire Naturelle Paris - France

UMR 7221CNRS/MNHN Evolution des régulations endocriniennes Muséum National d Histoire Naturelle Paris - France Role of Foxl2 and Dlx5/6 on uterine development and function: implications for BPES UMR 7221CNRS/MNHN Evolution des régulations endocriniennes Muséum National d Histoire Naturelle Paris - France TAKE HOME

More information

Meeting Report. From December 8 to 11, 2012 at Atlanta, GA, U.S.A

Meeting Report. From December 8 to 11, 2012 at Atlanta, GA, U.S.A Meeting Report Affiliation Department of Transfusion Medicine and Cell Therapy Name Hisayuki Yao Name of the meeting Period and venue Type of your presentation Title of your presentation The 54 th Annual

More information

Converting Novel Therapeutic Models into Early Phase Clinical Trials

Converting Novel Therapeutic Models into Early Phase Clinical Trials Converting Novel Therapeutic Models into Early Phase Clinical Trials James H. Doroshow, M.D. Deputy Director for Clinical and Translational Research National Cancer Institute, NIH IOM National Cancer Policy

More information

stem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products

stem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products stem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products Stem Cell Qualified Extracellular Matrix Proteins Stem cell research requires the finest

More information

Making Mature Human Islet Cells from Stem Cells to Model Disease and Treat Diabetes

Making Mature Human Islet Cells from Stem Cells to Model Disease and Treat Diabetes University of British Columbia Departments of Surgery and Cellular & Physiological Sciences Making Mature Human Islet Cells from Stem Cells to Model Disease and Treat Diabetes 2016 International Conference

More information

Neuroprotection in preclinical models of Parkinson disease by the NAPVSIPQ peptide

Neuroprotection in preclinical models of Parkinson disease by the NAPVSIPQ peptide Neuroprotection in preclinical models of Parkinson disease by the NAPVSIPQ peptide Bruce H. Morimoto, Ph.D. Executive Director, Applied Translational Medicine Microtubules Microtubules essential for neuronal

More information

Transplanted Donor Cells Rescue Contra-Lateral Chemo-ablated Muscle Bed

Transplanted Donor Cells Rescue Contra-Lateral Chemo-ablated Muscle Bed Only 25% of Nuclei are of Donor Origin! R + BCNU DONOR (i.m.) or MGMTP140K WT L + BCNU SALINE (i.m.) O6BG (i.p.) Transplanted Donor Cells Rescue Contra-Lateral Chemo-ablated Muscle Bed Transplanted Donor

More information

Recombinant adenovirus carrying glial cell line2derived neurotrophic factor gene protect midbra in dopaminergic neurons in mice

Recombinant adenovirus carrying glial cell line2derived neurotrophic factor gene protect midbra in dopaminergic neurons in mice 256 ( ) JOURNAL OF PEKIN G UNIVERSITY( HEAL TH SCIENCES) Vol. 35 No. 3 J une 2003 ( 100083) [ ] ; ;MPTP [ ] : (r GDNF) (DA) 2 2 (MPTP) :LacZ (Ad2LacZ) 24 h 72 h 10 d 30 d X2Gal ;r GDNF (Ad2r GDNF) 72 h

More information

DISCLOSURE. I have the following financial relationships:

DISCLOSURE. I have the following financial relationships: DISCLOSURE I have the following financial relationships: Consultant for: Fate Therapeutics, GlaxoSmithKline, Bone Therapeutics, G1 Therapeutics Contracted Research for: GlaxoSmithKline Royalties from:

More information

Paracrine Mechanisms in Adult Stem Cell Signaling and Therapy

Paracrine Mechanisms in Adult Stem Cell Signaling and Therapy Paracrine Mechanisms in Adult Stem Cell Signaling and Therapy Massimiliano Gnecchi, Zhiping Zhang, Aiguo Ni, Victor J. Dzau Circulation Research 2008 Nov 21;103(11):1204-19 Introduction(1) After AMI all

More information

Review Article Stem cell and endometriosis: new knowledge may be producing novel therapies

Review Article Stem cell and endometriosis: new knowledge may be producing novel therapies Int J Clin Exp Med 2014;7(11):3853-3858 www.ijcem.com /ISSN:1940-5901/IJCEM0002199 Review Article Stem cell and endometriosis: new knowledge may be producing novel therapies Jing Yang, Fengying Huang Department

More information

β-cell Preservation and Regeneration After Islet Transplantation

β-cell Preservation and Regeneration After Islet Transplantation β-cell Preservation and Regeneration After Islet Transplantation Jyuhn-Huarng Juang, MD Division of Endocrinology and Metabolism, Department of Internal Medicine, Chang Gung University and Memorial Hospital,

More information

Reviewer #1 (Remarks to the Author)

Reviewer #1 (Remarks to the Author) Reviewer #1 (Remarks to the Author) This manuscript presents an engineering system designed to culture and maintain living tissue from female reproductive organs. The modular capacity, reconfigurability,

More information

Secondary Negative Effects of Isolation Enzyme (s) On Human Islets. A.N.Balamurugan

Secondary Negative Effects of Isolation Enzyme (s) On Human Islets. A.N.Balamurugan Secondary Negative Effects of Isolation Enzyme (s) On Human Islets A.N.Balamurugan Human Islets Functional Mass Preservation 18-25 min 10 min 8-12 min 10-15 min 45-60 min pancreas in chamber 37º Sub-Optimal

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

marker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is

marker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels

More information

Islets of Langerhans consist mostly of insulin-producing β cells. They will appear to be densely labeled

Islets of Langerhans consist mostly of insulin-producing β cells. They will appear to be densely labeled Are adult pancreatic beta cells formed by self-duplication or stem cell differentiation? Introduction Researchers have long been interested in how tissues produce and maintain the correct number of cells

More information

Endometriosis. *Chocolate cyst in the ovary

Endometriosis. *Chocolate cyst in the ovary Endometriosis What is endometriosis? Endometriosis is a common condition in young women. It's chronic, painful, and it often progressively gets worse over the time. *Chocolate cyst in the ovary Normally,

More information

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Supplementary Figure 1. Long-term protection studies. 45 minutes of ischemia was induced in wild type (S1pr2 +/+ ) and S1pr2 -/- by MCAO. A) 5 days later brains were harvested

More information

Supporting Information

Supporting Information Supporting Information Chan et al. 1.173/pnas.9654916 A Patient B Xenograft C * remaining feature of normal lymph node * * * D lymphocytes Infiltrating transitional carcinoma cells E Enlarged axillary

More information

Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B)

Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) PCR identified expected hhb-egf band (left panel) and HA tag band (right) in kidneys of transgenic (TG) mice

More information

Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway

Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway Jieyuan Zhang, Xiaolin Liu, Haiyan Li, Chunyuan Chen, Bin Hu, Xin Niu, Qing

More information

Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury

Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Bastian OW, Koenderman L, Alblas J, Leenen LPH, Blokhuis TJ. Neutrophils contribute to

More information

Nasser Aghdami MD., PhD

Nasser Aghdami MD., PhD CONTRIBUTON OF HUMAN INDUCED PLURIPOTENT STEM CELL DERIVED ENDOTHELIAL CELLS IN VASCULAR REGENERATION OF BLEOMYCIN-INDUCED SCLERODERMA MOUSE MODEL Nasser Aghdami MD., PhD Department of Regenerative Medicine

More information

Cell Therapy for Diabetes: Generating Functional Islets from Human Exocrine Tissue

Cell Therapy for Diabetes: Generating Functional Islets from Human Exocrine Tissue Cell Therapy for Diabetes: Generating Functional Islets from Human Exocrine Tissue Kevin Docherty University of Aberdeen ELRIG Drug Discovery 2016 ACC Liverpool 14 th October 2016 Autoimmune destruction

More information

Mouse Models for Studying Human Islet Transplantation

Mouse Models for Studying Human Islet Transplantation Mouse Models for Studying Human Islet Transplantation Ronald G. Gill, Joshua Beilke,, Nathan Kuhl,, Michelle Kerklo, and Mark M. Nicolls Barbara Davis Center for Childhood Diabetes University of Colorado

More information

Stem cells and Cancer. John Glod. December 2, 2009

Stem cells and Cancer. John Glod. December 2, 2009 Stem cells and Cancer John Glod Lehigh University Lehigh University December 2, 2009 The Tumor Microenvironment Littlepage et al Cancer Cell 2005 Cancer Stem Cells A small group of cells within the larger

More information

Blood 101 Introduction Blood and Marrow & Overview of Bone Marrow Failure Diseases. Dr. M. Sabloff October 16 th 2010

Blood 101 Introduction Blood and Marrow & Overview of Bone Marrow Failure Diseases. Dr. M. Sabloff October 16 th 2010 Blood 101 Introduction Blood and Marrow & Overview of Bone Marrow Failure Diseases Dr. M. Sabloff October 16 th 2010 Normal Marrow knee joint white is articular cartilage Adjacent to this is the red marrow

More information

SDF-1/CXCR4 Axis on Endothelial Progenitor Cells Regulates Bone Fracture Healing

SDF-1/CXCR4 Axis on Endothelial Progenitor Cells Regulates Bone Fracture Healing SDF-1/CXCR4 Axis on Endothelial Progenitor Cells Regulates Bone Fracture Healing Yohei Kawakami, M.D., Ph.D. 1,2, Masaaki Ii 3, Tomoyuki Matsumoto, M.D., Ph.D. 1, Astuhiko Kawamoto, M.D., Ph.D. 2, Yutaka

More information

X P. Supplementary Figure 1. Nature Medicine: doi: /nm Nilotinib LSK LT-HSC. Cytoplasm. Cytoplasm. Nucleus. Nucleus

X P. Supplementary Figure 1. Nature Medicine: doi: /nm Nilotinib LSK LT-HSC. Cytoplasm. Cytoplasm. Nucleus. Nucleus a b c Supplementary Figure 1 c-kit-apc-eflu780 Lin-FITC Flt3-Linc-Kit-APC-eflu780 LSK Sca-1-PE-Cy7 d e f CD48-APC LT-HSC CD150-PerCP-cy5.5 g h i j Cytoplasm RCC1 X Exp 5 mir 126 SPRED1 SPRED1 RAN P SPRED1

More information

Mesenchymal Stem Cells to Repair Vascular Damage after Chemotherapy: Past, Present and Future

Mesenchymal Stem Cells to Repair Vascular Damage after Chemotherapy: Past, Present and Future Mesenchymal Stem Cells to Repair Vascular Damage after Chemotherapy: Past, Present and Future Cell Therapy 2014 Las Vegas, NV, USA Sulaiman Al-Hashmi, PhD Sultan Qaboos University Oman What are MSCs? Stem

More information

The Wnt/βcatenin signaling pathway

The Wnt/βcatenin signaling pathway Wnt signaling is crucial for functioning of the endometrium The Role of Wnt Signaling in Uterus Development (I) and in Homeostasis (II) and Malignancy (III) of the Uterine Endometrium Leen J Blok Erasmus

More information

Hematopoiesis. - Process of generation of mature blood cells. - Daily turnover of blood cells (70 kg human)

Hematopoiesis. - Process of generation of mature blood cells. - Daily turnover of blood cells (70 kg human) Hematopoiesis - Process of generation of mature blood cells - Daily turnover of blood cells (70 kg human) 1,000,000,000,000 total cells 200,000,000,000 red blood cells 70,000,000,000 neutrophils Hematopoiesis

More information

Parkinsonism or Parkinson s Disease I. Symptoms: Main disorder of movement. Named after, an English physician who described the then known, in 1817.

Parkinsonism or Parkinson s Disease I. Symptoms: Main disorder of movement. Named after, an English physician who described the then known, in 1817. Parkinsonism or Parkinson s Disease I. Symptoms: Main disorder of movement. Named after, an English physician who described the then known, in 1817. Four (4) hallmark clinical signs: 1) Tremor: (Note -

More information

Germ Cell Transplantation in Fish

Germ Cell Transplantation in Fish Larvi 2009 Germ Cell Transplantation in Fish Goro Yoshizaki (Tokyo University of Marine Science and Technology, SORST/JST) Tuna Mackerel Body weight; 300 kg 300 g Body length; 3 m 30 cm Scombridae family

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:1.138/nature11463 %Sox17(+) 9 8 7 6 5 4 3 2 1 %Sox17(+) #Sox17(+) d2 d4 d6 d8 d1 d12 d14 d18 25 2 15 1 5 Number of Sox17(+) cells X 1 Supplementary Figure 1: Expression of

More information

Supplementary Figure 1.

Supplementary Figure 1. Supplementary Figure 1. Increased expression of cell cycle pathway genes in insulin + Glut2 low cells of STZ-induced diabetic islets. A) random blood glucose measuers of STZ and vehicle treated MIP-GFP

More information

The Contribution Of Tie2-Lineage Cells To rhbmp-2 Induced Bone Formation

The Contribution Of Tie2-Lineage Cells To rhbmp-2 Induced Bone Formation The Contribution Of Tie2-Lineage Cells To rhbmp-2 Induced Bone Formation Mille P. Kolind, Ph.D 1, Alastair Aiken 1, Kathy Mikulec 1, Lauren Peacock 1, David Little 1,2, Aaron Schindeler, PhD 1,2. 1 Orthopaedic

More information

Tissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science

Tissue renewal and Repair. Nisamanee Charoenchon, PhD   Department of Pathobiology, Faculty of Science Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration

More information

Regenerative Medicine for Cardiomyocytes

Regenerative Medicine for Cardiomyocytes Regenerative Medicine Regenerative Medicine for JMAJ 47(7): 328 332, 2004 Keiichi FUKUDA Assistant Professor, Institute for Advanced Cardiac Therapeutics, Keio University School of Medicine Abstract: Heart

More information

Resident cardiac stem cells: how to find and use them

Resident cardiac stem cells: how to find and use them Resident cardiac stem cells: how to find and use them G. Hasenfuß Cardiology and Pneumology Heart Research Center Göttingen Georg-August-University Göttingen Definition: Stem cell Selfrenewal Stem cell

More information

Endometriosis. Assoc.Prof.Pawin Puapornpong, Faculty of Medicine, Srinakharinwirot University.

Endometriosis. Assoc.Prof.Pawin Puapornpong, Faculty of Medicine, Srinakharinwirot University. Endometriosis Assoc.Prof.Pawin Puapornpong, Faculty of Medicine, Srinakharinwirot University. Endometriosis Definition: Ectopic Endometrial Tissue True Incidence Unknown:? 1-5% Does NOT Discriminate by

More information

Supplementary Figure 1:

Supplementary Figure 1: Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas

More information

Progesterone responsiveness is not downregulated in adenomyosis.

Progesterone responsiveness is not downregulated in adenomyosis. Progesterone responsiveness is not downregulated in adenomyosis. Takehiro Hiraoka Yasushi Hirota Tomoko Saito-Fujita Hirofumi Haraguchi Miyuki Harada Tetsuya Hirata Kaori Koga Osamu Hiraike Tomoyuki Fujii

More information

The Role of Rac Signaling in The Perivascular Niche

The Role of Rac Signaling in The Perivascular Niche The Role of Rac Signaling in The Perivascular Niche Felicia Ciuculescu Diaspora and Higher Education and Research Perspectives in Personalized Medicine- from Concept to Clinical Application Center for

More information

We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors

We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists 3,700 108,500 1.7 M Open access books available International authors and editors Downloads Our

More information

Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC

Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC Supplementary Table 2. Drug content and loading efficiency estimated with F-NMR and UV- Vis Supplementary Table 3. Complete

More information

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Chapter 04 Boek 1_Gie.indb 55 21-05-2007 12:27:33 Chapter 04 Abstract Goal: TGF-b and IGF-I

More information

To this end, we performed immunofluorescent staining for GSCs (Fig.3). All the spheroidforming cells showed immunoreactivity for

To this end, we performed immunofluorescent staining for GSCs (Fig.3). All the spheroidforming cells showed immunoreactivity for H.Yoshioka et al. lished for isolation ofneural stem cells. Within 24-48 hours of primary culture, murine brain tumors yielded a minority fraction of cells that formed neurosphere-like clusters (tumor

More information

Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals

Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Stem cells move to injured area, differentiate into neighboring cells, and replace the damaged cells Cell Eons Stem cells

More information

Chronic variable stress activates hematopoietic stem cells

Chronic variable stress activates hematopoietic stem cells SUPPLEMENTARY INFORMATION Chronic variable stress activates hematopoietic stem cells Timo Heidt *, Hendrik B. Sager *, Gabriel Courties, Partha Dutta, Yoshiko Iwamoto, Alex Zaltsman, Constantin von zur

More information

What is endometrial cancer?

What is endometrial cancer? Uterine cancer What is endometrial cancer? Endometrial cancer is the growth of abnormal cells in the lining of the uterus. The lining is called the endometrium. Endometrial cancer usually occurs in women

More information

Chapter 3 Theories on Endometriosis

Chapter 3 Theories on Endometriosis Chapter 3 Theories on Endometriosis Sajal Gupta, Avi Harlev, Ashok Agarwal, and Elizabeth Pandithurai 3.1 Sampson s Theory There are several theories as to how endometriosis develops, but the most widely

More information

GBME graduate course. Chapter 43. The Basal Ganglia

GBME graduate course. Chapter 43. The Basal Ganglia GBME graduate course Chapter 43. The Basal Ganglia Basal ganglia in history Parkinson s disease Huntington s disease Parkinson s disease 1817 Parkinson's disease (PD) is a degenerative disorder of the

More information

Early cell death (FGF) B No RunX transcription factor produced Yes No differentiation

Early cell death (FGF) B No RunX transcription factor produced Yes No differentiation Solution Key - Practice Questions Question 1 a) A recent publication has shown that the fat stem cells (FSC) can act as bone stem cells to repair cavities in the skull, when transplanted into immuno-compromised

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Pleiotrophin Regulates the Expansion and Regeneration of Hematopoietic Stem Cells Heather A Himburg 1, Garrett G Muramoto 1 *, Pamela Daher 1*, Sarah K Meadows 1, J. Lauren Russell

More information

Pearson r = P (one-tailed) = n = 9

Pearson r = P (one-tailed) = n = 9 8F4-Specific Lysis, % 1 UPN1 UPN3 8 UPN7 6 Pearson r =.69 UPN2 UPN5 P (one-tailed) =.192 4 UPN8 n = 9 2 UPN9 UPN4 UPN6 5 1 15 2 25 8 8F4, % Max MFI Supplementary Figure S1. AML samples UPN1-UPN9 show variable

More information

Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.

Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte

More information

The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells

The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells 1 SUPPLEMENTARY INFORMATION The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells Karin Loser 1,2,6, Thomas Vogl 2,3, Maik Voskort 1, Aloys

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Haematopoietic stem cell release is regulated by circadian oscillations Simón Méndez-Ferrer *, Daniel Lucas *, Michela Battista * and Paul S. Frenette * Mount Sinai School of Medicine, *Departments of

More information

Stem cells. -Dr Dinesh Bhurani, MD, DM, FRCPA. Rajiv Gandhi Cancer Institute, Delhi, -Director, Department of Haematology and BMT

Stem cells. -Dr Dinesh Bhurani, MD, DM, FRCPA. Rajiv Gandhi Cancer Institute, Delhi, -Director, Department of Haematology and BMT Stem cells -Dr Dinesh Bhurani, MD, DM, FRCPA -Director, Department of Haematology and BMT Rajiv Gandhi Cancer Institute, Delhi, Flow of presentation Update on stem cell uses Haematopoietic stem cell transplantation

More information

Supplemental Table 1. Primer sequences for transcript analysis

Supplemental Table 1. Primer sequences for transcript analysis Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )

More information

Endometriosis and Infertility - FAQs

Endometriosis and Infertility - FAQs Published on: 8 Apr 2013 Endometriosis and Infertility - FAQs Introduction The inner lining of the uterus is called the endometrium and it responds to changes that take place during a woman's monthly menstrual

More information

Pathogenesis of Degenerative Diseases and Dementias. D r. Ali Eltayb ( U. of Omdurman. I ). M. Path (U. of Alexandria)

Pathogenesis of Degenerative Diseases and Dementias. D r. Ali Eltayb ( U. of Omdurman. I ). M. Path (U. of Alexandria) Pathogenesis of Degenerative Diseases and Dementias D r. Ali Eltayb ( U. of Omdurman. I ). M. Path (U. of Alexandria) Dementias Defined: as the development of memory impairment and other cognitive deficits

More information

Highly Efficient CRISPR/Cas9 Gene Editing and Long-Term Engraftment of Human Hematopoietic Stem and Progenitor Cells

Highly Efficient CRISPR/Cas9 Gene Editing and Long-Term Engraftment of Human Hematopoietic Stem and Progenitor Cells Highly Efficient CRISPR/Cas9 Gene Editing and Long-Term Engraftment of Human Hematopoietic Stem and Progenitor Cells J. M. Heath, A. Chalishazar, C.S. Lee, W. Selleck, C. Cotta-Ramusino, D. Bumcrot, J.L.

More information

DIP.G.O. EXAMINATION 2007

DIP.G.O. EXAMINATION 2007 DIP.G.O. EXAMINATION 2007 GYNAECOLOGY Batch A/07 Time : 2 hrs. Question 1. a. Define Dysfunctional Uterine Bleeding 10 b. What are the various terms used to describe menstrual disorder? 10 Question 2.

More information

What s (new) and Important in Reporting of Uterine Cancers Katherine Vroobel The Royal Marsden

What s (new) and Important in Reporting of Uterine Cancers Katherine Vroobel The Royal Marsden What s (new) and Important in Reporting of Uterine Cancers Katherine Vroobel The Royal Marsden Maastricht Pathology 2018 Wednesday 20 th June Endometrioid adenocarcinoma High grade carcinomas (common)

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2610 Figure S1 FSMCs derived from MSLN CLN transgenic mice express smooth muscle-specific proteins. Beta-galactosidase is ubiquitously expressed within cultured FSMCs derived from MSLN

More information

DAX1, testes development role 7, 8 DFFRY, spermatogenesis role 49 DMRT genes, male sex differentiation role 15

DAX1, testes development role 7, 8 DFFRY, spermatogenesis role 49 DMRT genes, male sex differentiation role 15 Subject Index N-Acetylcysteine, sperm quality effects 71 Ambiguous genitalia, origins 1, 2 Anti-Müllerian hormone function 13 receptors 13 Sertoli cell secretion 10, 38 Apoptosis assays in testes 73, 74

More information

Accelerate Your Research with Conversant Bio

Accelerate Your Research with Conversant Bio Accelerate Your Research with Conversant Bio 400+ Participating MDs 50+ Partner sites for tissue procurement Continuous expansion of sourcing capabilities Closely monitored chain of custody Full regulatory

More information

Supplementary Figure 1. Chimeric analysis of inner ears. (A-H) Chimeric inner ears with fluorescent ES cells and (I,J) Rainbow inner ears.

Supplementary Figure 1. Chimeric analysis of inner ears. (A-H) Chimeric inner ears with fluorescent ES cells and (I,J) Rainbow inner ears. Supplementary Figure 1. himeric analysis of inner ears. (A-H) himeric inner ears with fluorescent ES cells and (I,J) Rainbow inner ears. (A,B) omposite images showing three colors in different vestibular

More information

Figure legends Supplemental Fig.1. Glucose-induced insulin secretion and insulin content of islets. Supplemental Fig. 2.

Figure legends Supplemental Fig.1. Glucose-induced insulin secretion and insulin content of islets. Supplemental Fig. 2. Figure legends Supplemental Fig.. Glucose-induced insulin secretion and insulin content of islets. Insulin secretory responses to.,., and. mm glucose (A) (n = 7-), and the insulin content in the islets

More information

Supplementary Information

Supplementary Information Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1

More information

Protective effect of ginsenoside Rg1 against MPTP-induced apoptosis in mouse substantia nigra neurons 1

Protective effect of ginsenoside Rg1 against MPTP-induced apoptosis in mouse substantia nigra neurons 1 Chen XC et al / Acta Pharmacol Sin 2002 Sep; 23 (9): 829-834 829 2002, Acta Pharmacologica Sinica ISSN 1671-4083 Shanghai Institute of Materia Medica Chinese Academy of Sciences http://www.chinaphar.com

More information

Updates in Gynecologic Oncology. Todd Boren, MD Gynecologic Oncologist Chattanooga s Program in Women s Oncology Sept 8 th, 2018

Updates in Gynecologic Oncology. Todd Boren, MD Gynecologic Oncologist Chattanooga s Program in Women s Oncology Sept 8 th, 2018 Updates in Gynecologic Oncology Todd Boren, MD Gynecologic Oncologist Chattanooga s Program in Women s Oncology Sept 8 th, 2018 COI I have no conflict of interest to report Endometrial Cancer: Risk Factors

More information

Research Article Investigation of Tenascin Expression in Endometriosis

Research Article Investigation of Tenascin Expression in Endometriosis International Scholarly Research Network ISRN Pathology Volume 2012, Article ID 873759, 5 pages doi:10.5402/2012/873759 Research Article Investigation of Tenascin Expression in Endometriosis Zehra Sema

More information

Endometrial tissue in peritoneal fluid

Endometrial tissue in peritoneal fluid FERTILITY AND STERILITY Copyright c 1986 The American Fertility Society Printed in UBA. Endometrial tissue in peritoneal fluid Delphine Bartosik, M.D. *t Samuel L. Jacobs, M.D.* Lynda J. Kelly, C.T.:J:

More information

SUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences.

SUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences. Supplementary Table 2. Antibodies used for Immunofluoresence. Antibody Dilution Source Goat anti-pdx1 1:100 R&D Systems Rabbit anti-hnf6 1:100 Santa Cruz Biotechnology Mouse anti-nkx6.1 1:200 Developmental

More information

CRIPTO-1 A POSSIBLE NEW BIOMARKER IN GLIOBLASTOMA MULTIFORME PIA OLESEN, MD, PHD STUDENT

CRIPTO-1 A POSSIBLE NEW BIOMARKER IN GLIOBLASTOMA MULTIFORME PIA OLESEN, MD, PHD STUDENT CRIPTO-1 A POSSIBLE NEW BIOMARKER IN GLIOBLASTOMA MULTIFORME PIA OLESEN, MD, PHD STUDENT Glioblastoma WHO Grade IV Glioma Heterogenic Undiffenrentiated phenotype 50% of all Gliomas Around 600 patients

More information

Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice

Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice Supplementary Methods: Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice and gently meshed in DMEM containing 10% FBS to prepare for single cell suspensions. CD4 + CD25

More information

Interactions between cancer stem cells and their niche govern metastatic colonization

Interactions between cancer stem cells and their niche govern metastatic colonization Correction Interactions between cancer stem cells and their niche govern metastatic colonization Ilaria Malanchi, Albert Santamaria-Martínez, Evelyn Susanto, Hong Peng, Hans-Anton Lehr, Jean-Francois Delaloye

More information

Received, June 29, 1904; accepted for publication

Received, June 29, 1904; accepted for publication THE AMEBICAN JOURNAL OF CLINICAL PATHOLOGY Copyright 1964 by The Williams & Wilkins Co. Vol. 42, No. 0 Printed in U.S.A. CARCINOMA IN SITU OF THE ENDOMETRIUM ISABELLE A. BUEHL, M.D., PRANK VELLIOS, M.D.,

More information

Intracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation

Intracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining Btk activation Xingguang Liu, Zhenzhen Zhan, Dong Li, Li Xu, Feng Ma, Peng Zhang, Hangping Yao and Xuetao

More information