Supp. Table 1: Summary of RT4 cell recombinant data. Supp. Figure 1: Controls for adenoviral infection of bladder epithelium
|
|
- Ursula Barnett
- 6 years ago
- Views:
Transcription
1 Supplementary Materials for: Inactivation of p53 and Pten promotes invasive bladder cancer Puzio-Kuter et al. Materials & Methods Tables Supp. Table 1: Summary of RT4 cell recombinant data Figures Supp. Figure 1: Controls for adenoviral infection of bladder epithelium Supp. Figure 2: Additional examples of histology of mouse bladder tumors Supp. Figure 3: Immunohistochemical analyses of mouse bladder tumors Supp. Figure 4: Gene deletion in mouse bladder tumors Supp. Figure 5: Histology of bladder epithelium in the single and compound heterozygous p53 flox/flox and Pten flox/flox mutant mice Supp. Figure 6: Bladder phenotype of p53 flox/flox ; Rb flox/flox and Pten flox/flox ; Rb flox/flox mutant mice Supp. Figure 7: RT4 cell recombinants following knock-down of p53 or PTEN Supp. Figure 8: Pre-clinical treatment study 1
2 Supplementary Materials and Methods Mouse model The R26R reporter allele (GT(ROSA)26Sor tm1sor ) (C57Bl6;129SVJ) (Soriano 1999) was obtained from the Jackson Laboratory Induced Mutant Resource (Bar Harbor, Maine). Conditional alleles for Pten (Pten flox/flox, C57Bl6;129SVJ) (Lesche et al. 2002) and p53 (p53 flox/flox, FVB;129SJv) (Jonkers et al. 2001) were obtained from the NCI Mouse Models of Human Cancer Consortium repository ( An adenovirus expressing Cre-recombinase (Adeno-Cre) and control vector (Adeno-empty) were obtained from the University of Iowa Vector Core Facility (Ad5CMVCre). Concentrated virus (25 µl; 4 X10 11 PFU/ml) was mixed with 20 µl of Dulbeccoʼs Modified Eagle Medium (D-MEM) and 5 µl of hexadimethrine bromide (polybrene, 80 µg/ml), and 5 µl of diluted virus was injected into the bladder lumen of adult mice (2-3 months of age) under anesthesia; unless otherwise indicated, male mice were used. At the time of sacrifice, the bladder and relevant tissues were collected and fixed in 10% formalin or snap-frozen in liquid nitrogen. Real-time PCR was done using RNA extracted with Trizol (Invitrogen Carlsbad, California), SuperScript III Reverse Transcriptase (Invitrogen Carlsbad, California ) for 1 st strand cdna synthesis and real-time one step RT-PCR with QuantiTect SYBR Green RT-PCR kit (Qiagen Valencia California ) on a Eppendorf Mastercycle ep realplex 2 S (Eppendorf, Westbury New York). Analyses of bladder tissues Hematoxylin and Eosin (H&E) and immunohistochemical staining were performed on 5-micron paraffin sections. Immunohistochemistry was performed as described (Kinkade et al. 2008) following antigen retrieval in Antigen Unmasking Solution (Vector Laboratories H-3300; Burlingame, California). Slides were blocked and 2
3 incubated overnight at 4 C with primary antibody (see below) followed by secondary antibody (Vector Laboratories, Biotinylated Horse Anti-Mouse IgG (H+L) #BA_2000 or Biotinylated Goat Anti-Rabbit IgG (H+L) #BA_1000) diluted 1:250 or 1:500. Signal enhancement was performed using the Vectastain ABC System, followed by counterstaining with the NovaRed kit (Vector Laboratories). Quantification of proliferating cells with Ki67 was performed as previously (Kinkade et al. 2008); results represent a minimum of 10 sections from 3 mice and are expressed as the percentage of Ki67- labeled epithelial cells relative to total epithelial cells. Western blot analyses were performed using tissues prepared in RIPA buffer as described (Kinkade et al. 2008). Antibodies for immunohistochemistry were as follows: Beta-galactosidase (Rockland rabbit polyclonal, ; 1:20000); Cytokeratin 7 (Abcam mouse monoclonal, ab9021; 1:100 for IHC and 1:50 for IF); Broad Spectrum Cytokeratin (Dako Cytomation rabbit polyclonal, Z0622 1:10); Pten (Cell Signaling rabbit polyclonal, 9552; 1:200), p-akt (Cell Signaling Ser473 rabbit monoclonal, 3787; 1:50); p-s6 Ribosomal Protein (Cell Signaling Ser235/236 rabbit polyclonal, 2211; 1:250); Ki-67 (NovoCastra rabbit polyclonal, NCL-Ki67-p; 1:2000). Antibodies for immunoblotting were as follows: p53 (Santa Cruz rabbit polyclonal, sc6243; 1:500); Pten (Cell Signaling rabbit polyclonal, 9552; 1:500); p-akt (Cell Signaling Ser473 polyclonal 9271, 1:500); p-mtor (Cell Signaling Ser2448 rabbit polyclonal, 2971; 1:100); mtor (Cell Signaling rabbit polyclonal, 2983; 1:100); p-s6 Ribosomal Protein (Cell Signaling Ser235/236 rabbit polyclonal, 2211; 1:500); Raptor (Bethyl Laboratories Inc. rabbit polyclonal, A A; 1:100). Immunofluorescence was done using 5-micron paraffin sections or 12 micron cryosections, which were subjected to antigen retrieval by boiling in Antigen Unmasking Solution (H-3300, Vector Laboratories Burlingame, California). Slides were blocked in 3
4 0.1% blocking solution (Invitrogen/Molecular Probes TSA Kit #2 T or TSA Kit #12 T-20922) followed by incubation in primary antibody diluted in 0.1% blocking solution in a humid chamber overnight at 4 C. Slides were then incubated with secondary antibody (Invitrogen/Molecular Probes Carlsbad, California AlexaFluor 555 goat anti-mouse IgG (H+L) #A or AlexaFluor 488 goat anti-rabbit IgG (H+L) #A ) for 1 hour in a dark humid chamber at room temperature and mounted with Vectashield+DAPI (Vector Laboratories # H-1200). If tyramide amplification was used, slides were incubated with secondary antibody HRP goat anti-mouse IgG or HRP goat anti-rabbit IgG (Invitrogen/Molecular Probes Carlsbad, California TSA Kit #2 with HRPgoat anti-mouse IgG and Alexa Fluor 488 tyramide #T or TSA Kit #12 with HRP-goat anti-rabbit IgG and Alexa Fluor 488 tyramide #T-20922) for 1 hour in a dark humid chamber at room temperature followed by incubation with Alexa 488 tyramide (Invitrogen/Molecular Probes Carlsbad, California TSA Kit #2 with HRP-goat antimouse IgG and Alexa Fluor 488 tyramide #T or TSA Kit #12 with HRP-goat anti-rabbit IgG and Alexa Fluor 488 tyramide #T-20922) for 10 minutes at room temperature at RT and mounted with Vectashield+DAPI (Vector Laboratories # H-1200). Immunofluorescence was visualized using a Zeiss LSM 510 META inverted confocal microscope equipped with argon and helium/neon lasers using excitation wavelengths 488 and 543nm. Cell recombination assays For cell recombination assays, RT-4 human bladder cells (ATCC) were grown in McCoyʼs 5a Medium with 1.5 mm L-glutamine and 2.2 g/l sodium bicarbonate supplemented with 10% fetal bovine serum. For knock-down studies, lentiviral particles expressing RNAi for p53 and/or Pten (or control) were obtained from the Mission shrna 4
5 library (Sigma-Aldrich St. Louis, Missouri). For each gene, four alternative RNAi constructs were evaluated, and the two that produced the most significant knock-down (>50%) were selected for analyses (Supp. Table 1). Cells were infected with lentiviral particles at 5 MOI at a low (~20%) density for 12 hours in growth media. Procedures for generating cell recombinants were adapted from (Oottamasathien et al. 2006). Briefly, following lentiviral infection, 1 X 10 5 of the bladder epithelial cells were recombined with rat mesenchyme from a 15.5 dpc embryo obtained from Sprague- Dawley pregnant rats. The recombinants were mixed with 40 µl collagen and plated on Falcon dishes (BD Biosciences/Falcon, San Jose, CA ). Following overnight incubation at 37 C, cell recombinants were surgically implanted under the kidney capsule of NCr nude mice (Taconic) and grown for 2 to 3 months. Following sacrifice, the kidneys were removed and recombinants were fixed in 10% formalin and processed for histological and immunohistochemical analyses as above. Tissue recombinants were made as described for the cell recombinants, with the exception that bladder tumors from the mutant mice provided the source of epithelium. Pre-clinical studies Rapamycin (LC labs Catalog #R-5000, lots #ASW-105 and #ASW-109) was dissolved in 100% ethanol to make a working stock of 25 mg/ml, and diluted to 1.25 mg/ml in a solution of 5.2% Tween 80, 5.2% PEG400. Rapamycin was delivered once daily via i.p. injection at 10 mg/kg into cohorts of Adeno-Cre injected p53 flox/flox ; Pten flox/flox mice or nude mice harboring bladder tumor tissue recombinants as described (Kinkade et al. 2008). At the conclusion of the study, mice were sacrificed and processed for histological analyses as above. 5
6 Analyses of human tissue microarrays Human tissues were obtained following guidelines of the Institutional Review Board. Two independent cohorts were used in this study. The first included 165 patients diagnosed with bladder cancer from whom paraffin embedded specimens had been previously obtained. These included 136 cases of transitional cell carcinoma and 16 cases of squamous cell carcinoma; the remaining 13 cases corresponded to anaplastic, small cell, sarcomatoid or signet ring carcinomas. Tumor stage was assigned according to the Tumor-Node-Metastasis staging system (Sobin 2002) on the basis of the depth of invasion in transurethral resection or cystectomy specimens. Tumors were classified as follows: 1 case of ptcis; 23 cases of pta; 28 cases of pt1; 25 cases of pt2; 75 cases of pt3; 8 cases of pt4, and 6 cases of ptx. 97 tumors showed a high grade (G3) histology. 85 patients were treated by radical cystectomy and pelvic lymphadenectomy with the following N staging: 31 pn0, 54 pn1-2. The second cohort included 86 patients with muscle-invasive bladder cancer (median age 69 years, range 25-86) undergoing radical cystectomy. For these patients, clinical follow-up data was available and entered into a prospective database. Median follow-up time after cystectomy was 6.6 years. Normal bladder tissue samples (N=10) were obtained from non-affected, distant urothelium from cystectomy specimens. For immunohistochemistry, TMA sections (5 µm) processed using the avidin-biotin immunoperoxidase method as above. Antibodies were as follows: p53 (Calbiochem mouse monoclonal, OP09L; 1:500); Pten (Cascade mouse monoclonal, ABM2052; 1:75); p-akt (Ser473 rabbit monoclonal, 3787; 1:50); p70 S6 Kinase (Rabbit polyclonal, 9202; 1:75) from Cell Signaling. Staining was scored by estimating the percentage of tumor cells with immunoreactivity as well as the intensity of the staining was determined using an ordinal 6
7 scale (undetectable = 0, weak = 1, strong = 2, very strong = 3). If different staining intensities were found in a given sample, the most intense (>25% of cells) was used for analysis. Statistical analyses were done using the Mann-Whitney U test, the chix 2 test, or Fisherʼs exact test, and the Spearman correlation, as appropriate. Survival analysis (Kaplan-Meier) was conducted by the log rank test and the Cox proportional hazard model. All calculations were performed using StatView 4.5 software (Abacus Concepts, Inc., Berkeley, CA). References Jonkers, J., Meuwissen, R., van der Gulden, H., Peterse, H., van der Valk, M., and Berns, A Synergistic tumor suppressor activity of BRCA2 and p53 in a conditional mouse model for breast cancer. Nat Genet 29: Kinkade, C.W., Castillo-Martin, M., Puzio-Kuter, A., Yan, J., Foster, T.H., Gao, H., Sun, Y., Ouyang, X., Gerald, W.L., Cordon-Cardo, C., and Abate-Shen, C Targeting AKT/mTOR and ERK MAPK signaling inhibits hormone-refractory prostate cancer in a preclinical mouse model. J Clin Invest 118: Lesche, R., Groszer, M., Gao, J., Wang, Y., Messing, A., Sun, H., Liu, X., and Wu, H Cre/loxP-mediated inactivation of the murine Pten tumor suppressor gene. Genesis 32: Oottamasathien, S., Williams, K., Franco, O.E., Thomas, J.C., Saba, K., Bhowmick, N.A., Staack, A., Demarco, R.T., Brock, J.W., 3rd, Hayward, S.W., and Pope, J.C.t Bladder tissue formation from cultured bladder urothelium. Dev Dyn 235: Sobin, L TNM Classification of Malignant Tumours. John Wiley & Sons, Hoboken, NJ. Soriano, P Generalized lacz expression with the ROSA26 Cre reporter strain. Nat Genet 21:
8 Supplementary Table 1: Summary of cell recombinants of RT4 human bladder cancer cells Experimental groups N Lentivirus RNAi Description Control 4 Control Moderate size grafts with well-organized morphology and histological appearance of of low grade transitional cell carcinoma p53 RNAi 7 Pten RNAi 8 p53 + Pten RNAi 9 p53(h)-clone 1 (N=4) p53(h)-clone 2 (N=3) Pten(h)-clone 1 (N=3) Pten(h)-clone 2 (N=5) p53(h)-clone 1 + Pten(h)-clone 2 (N=5) p53(h)-clone 2 + Pten(h)-clone 2 (N=4) Moderate size grafts with well-organized morphology and histological appearance of of low grade transitional cell carcinoma Moderate size grafts with well-organized morphology and histological appearance of of low grade transitional cell carcinoma Large size grafts with invasive features; histological appearance of high grade transitional cell carcinoma with invasion of the surrounding mesenchyme and host kidney Details of Lentiviral RNAi used in this study Gene Name Species Product number 1 Region targeted Abbreviation Control N/A Control-SHC002V Scrambled Control p53 PTEN Human Human TRCN Coding region p53(h)-clone 1 TRCN Coding region p53(h)-clone 2 TRCN Coding region Pten(h) clone 1 TRCN ʼ UTR Pten(h) clone 2 Notes: (1) Lentiviral particles were purchased from Sigma Aldrich MISSION RNAi.
9 Supplementary Figure Legends Supplementary Figure 1: Controls for Adeno-virus Cre injection Shown are examples of β-gal expression staining or H&E staining from sections from p53 flox/flox ; Pten flox/flox ; R26R/+ mice that were injected or not injected with Adeno-Cre. These are control experiments showing that the tumors in the p53 flox/flox ; Pten flox/flox mice are dependent on Adeno-Cre delivery (compare injected and non-injected) and that tumors in the mice having the R26R allele have B-Gal staining and are therefore derived from the bladder epithelium. Supplementary Figure 2: Histology of tumors arising from the p53 flox/flox ; Pten flox/flox mice injected with Adeno-Cre Examples of H&E staining from tumors showing additional examples of the histological phenotypes from bladder tumors from the p53 flox/flox ; Pten flox/flox mice at 4 months following delivery of Adeno-Cre. Supplementary Figure 3: Immunohistochemical analyses of mouse bladder tumors (A-D) Immunohistochemical staining with the indicated antibodies of sections from normal bladder (p53 +/+ ; Pten +/+ ; A, C) or bladder tumors (p53 flox/flox ; Pten flox/flox ; B,D). (E-G) Metastases from p53 flox/flox ; Pten flox/flox mice with large tumors showing gross phenotype (E), and sections from a liver metastases showing H&E staining (F), and immunohistochemical staining for broad cytokeratin (G). Scale bars represent 100 microns. 8
10 Supplementary Figure 4: Gene deletion of Pten and p53 in the mouse bladder tumors Data showing that Pten and p53 are effectively deleted in the mouse bladder tumors. Shown are Real-time PCR analyses (left) and western blot analyses (right) comparing expression in normal bladder versus in the mouse bladder tumors. Supplementary Figure 5: Histology of single and compound heterozygous mutant mice. Examples of H&E staining from mice of the indicated genotypes at 4 months following delivery of Adeno-Cre showing no obvious histological abnormalities. Supplementary Figure 6: Analyses of Analyses of bladder phenotype in Adeno-Cre injected p53 flox/flox ; Rb flox/flox and Pten flox/flox ; Rb flox/flox mutant mice Examples of the gross bladder tumors and H&E staining from mice of the indicated genotypes at 8-12 months following delivery of Adeno-Cre into the bladder lumen showing no gross bladder tumors or gross histological abnormalities. Supplementary Figure 7: RT4 cell recombinants from the single knock-down of p53 or Pten (Top) Diagram of the functional analyses of p53 and PTEN knock-down in human bladder cells. RT4 human bladder cancer cells were infected with lentiviral RNAi (MOI=5) for p53 and/or PTEN, recombined with rat embryonic bladder mesenchyme, 9
11 and grown under the renal capsule of a nude mouse for 3 months. Right, Western blot showing the efficacy of knock-down using two different RNAis. (Bottom) Renal grafts from cell recombinants made following knock-down in RT4 cells of p53 or Pten individually with lentiviral RNAi showing that the histology is similar to the control RT4 cells (see Fig. 3). Supplementary Figure 8: Pre-clinical analyses (A-D) Immunostaining for activated p-akt and p-s6 kinase in non-invasive or invasive human bladder cancer. (E-N) Treatment Study: Mouse bladder tumors were combined with rat embryonic bladder mesenchyme, and grown as renal grafts in nude mouse hosts; one week following grafting, the mice were randomly enrolled into vehicle and rapamycin groups and delivered rapamycin (or vehicle) via daily i.p. injection for up to 3 months. (E,F) Gross morphology. (G,H) H&E stained sections; (I-L) immunostained sections. (M) Summary of bladder weights. (N) Summary of proliferation rates. Scale bars represent 100 microns. 10
12 Supp. Figure 1 11
13 Supp. Figure 2 12
14 Supp. Figure 3 13
15 Supp. Figure 4 14
16 Supp. Figure 5 15
17 Supp. Figure 6 16
18 Supp. Figure 7 17
19 Supp. Figure 8 18
(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationSupplementary Figure 1. A. Bar graph representing the expression levels of the 19 indicated genes in the microarrays analyses comparing human lung
Supplementary Figure 1. A. Bar graph representing the expression levels of the 19 indicated genes in the microarrays analyses comparing human lung immortalized broncho-epithelial cells (AALE cells) expressing
More informationSupplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2
Supplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2 activity. Upper panel: Representative histograms for FACS
More informationLayered-IHC (L-IHC): A novel and robust approach to multiplexed immunohistochemistry So many markers and so little tissue
Page 1 The need for multiplex detection of tissue biomarkers. There is a constant and growing demand for increased biomarker analysis in human tissue specimens. Analysis of tissue biomarkers is key to
More informationRNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using
Supplementary Information Materials and Methods RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Trizol reagent (Invitrogen,Carlsbad, CA) according to the manufacturer's instructions.
More informationSupplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated,
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated, embedded in matrigel and exposed
More informationEffec<ve Use of PI3K and MEK Inhibitors to Treat Mutant K Ras G12D and PIK3CA H1047R Murine Lung Cancers
Effec
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationSupplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the
Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student
More informationCell lines and tissue samples. The 18 human NSCLC cell lines used in this. study included eight adenocarcinoma cell lines (ADCs; A427, A549, LC319,
Supplementary Materials and Methods Cell lines and tissue samples. The 18 human NSCLC cell lines used in this study included eight adenocarcinoma cell lines (ADCs; A427, A549, LC319, NCI-H1373, PC-3, PC-9,
More informationIslet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot
Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationImmunostaining was performed on tumor biopsy samples arranged in a tissue-microarray format or on
Supplemental Methods Immunohistochemical Analyses Immunostaining was performed on tumor biopsy samples arranged in a tissue-microarray format or on prostatectomy sections obtained post-study. Briefly,
More informationSupplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
More informationSupplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right
More informationSupplementary Table 1. Characterization of HNSCC PDX models established at MSKCC
Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC Supplementary Table 2. Drug content and loading efficiency estimated with F-NMR and UV- Vis Supplementary Table 3. Complete
More informationSupplementary Materials. for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis
Supplementary Materials for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis 1 Supplementary Figure Legends Supplementary Figure 1: Integrin expression
More informationTargeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics. For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from
Supplementary Methods: Targeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from mouse tumor samples and analyzed as
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2697 Figure S1 Cytokeratin 5 is a specific marker for basal and intermediate cells in all mouse prostate lobes. (a) Immunofluorescence staining showing co-localization of YFP with p63 in
More informationSupplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse
Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic
More informationEpithelial cell death is an important contributor to oxidant-mediated acute lung injury SUPPORTING INFORMATION 60611, USA
Epithelial cell death is an important contributor to oxidant-mediated acute lung injury SUPPORTING INFORMATION G.R. Scott Budinger 1,2 *, Gökhan M. Mutlu 1 *, Daniela Urich 2, Saul Soberanes 1, Leonard
More informationAndrogen Receptor Expression in Renal Cell Carcinoma: A New Actionable Target?
Androgen Receptor Expression in Renal Cell Carcinoma: A New Actionable Target? New Frontiers in Urologic Oncology Juan Chipollini, MD Clinical Fellow Department of Genitourinary Oncology Moffitt Cancer
More informationSupplementary Figure 1.
Supplementary Figure 1. Increased β cell mass and islet diameter in βtsc2 -/- mice up to 35 weeks A: Reconstruction of multiple anti-insulin immunofluorescence images showing differences in β cell mass
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationSupplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION
Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION X. Shawn Liu 1, 3, Bing Song 2, 3, Bennett D. Elzey 3, 4, Timothy L. Ratliff 3, 4, Stephen F. Konieczny
More informationSupporting Information
Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)
More information(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
More informationPREPARED FOR: U.S. Army Medical Research and Materiel Command Fort Detrick, Maryland
Page 1 09/10/2013 AD Award Number: W81XWH-12-1-0453 TITLE: The cytoplasm translocation of the androgen receptor cofactor p44 as a target for prostate cancer treatment PRINCIPAL INVESTIGATOR: Zhengxin Wang
More informationSupplementary Materials and Methods
Supplementary Materials and Methods Hepatocyte toxicity assay. Freshly isolated hepatocytes were incubated for overnight with varying concentrations (-25 µm) of sodium glycochenodeoxycholate (GCDC) or
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationSupplementary Information Supplementary Fig. 1. Elevated Usp9x in melanoma and NRAS mutant melanoma cells are dependent on NRAS for 3D growth.
Supplementary Information Supplementary Fig. 1. Elevated Usp9x in melanoma and NRAS mutant melanoma cells are dependent on NRAS for 3D growth. a. Immunoblot for Usp9x protein in NRAS mutant melanoma cells
More informationMaterial and Methods. Flow Cytometry Analyses:
Material and Methods Flow Cytometry Analyses: Immunostaining of breast cancer cells for HER2 was performed by incubating cells with anti- HER2/neu APC (Biosciences, Cat# 340554), anti-her2/neu PE (Biosciences,
More informationErzsebet Kokovay, Susan Goderie, Yue Wang, Steve Lotz, Gang Lin, Yu Sun, Badrinath Roysam, Qin Shen,
Cell Stem Cell, Volume 7 Supplemental Information Adult SVZ Lineage Cells Home to and Leave the Vascular Niche via Differential Responses to SDF1/CXCR4 Signaling Erzsebet Kokovay, Susan Goderie, Yue Wang,
More informationSupplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were
Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES
More informationSupplementary Materials and Methods
Supplementary Materials and Methods Whole Mount X-Gal Staining Whole tissues were collected, rinsed with PBS and fixed with 4% PFA. Tissues were then rinsed in rinse buffer (100 mm Sodium Phosphate ph
More informationMitosis. Single Nano Micro Milli Macro. Primary. PCNA expression
a b c DAPI YFP CC3 DAPI YFP PCNA DAPI YFP ph3 DAPI YFP KI67 e 6 Mitosis f 1 PCNA expression %ph3 + /YFP + n= 63 87 61 3 13 8 n= 15 3 9 1 5 %PCNA+/YFP+ 8 6 Supplementary Figure 1. Proliferation/apoptosis
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding
More informationArgininosuccinate synthetase 1 suppression and arginine restriction inhibit cell
Argininosuccinate synthetase 1 suppression and arginine restriction inhibit cell migration in gastric cancer cell lines Yan-Shen Shan 1, Hui-Ping Hsu 1, Ming-Derg Lai 2,3, Meng-Chi Yen 2,4, Wei-Ching Chen
More informationSupplementary Information. Detection and delineation of oral cancer with a PARP1 targeted optical imaging agent
Supplementary Information Detection and delineation of oral cancer with a PARP1 targeted optical imaging agent Authors: Susanne Kossatz a, Christian Brand a, Stanley Gutiontov b, Jonathan T.C. Liu c, Nancy
More informationFigure S1: Effects on haptotaxis are independent of effects on cell velocity A)
Supplemental Figures Figure S1: Effects on haptotaxis are independent of effects on cell velocity A) Velocity of MV D7 fibroblasts expressing different GFP-tagged Ena/VASP family proteins in the haptotaxis
More informationSupplementary Figure 1
CD31 FN Supplementary Figure 1 a Multivariate Cox regression analysis of predicting factors for disease-free and overall survival in 435 HNSCC patients b FN staining in whole sections of HNSCC c FN expression
More informationB16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small
More informationSupplemental Information
Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationEpithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive
Online Data Supplement: Epithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive asthma Dan Cheng, Zheng Xue, Lingling Yi, Huimin Shi, Kan Zhang, Xiaorong Huo, Luke R. Bonser,
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationA Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS
A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism Arlee Fafalios, Jihong Ma, Xinping Tan, John Stoops, Jianhua Luo, Marie C. DeFrances and Reza Zarnegar
More informationSupplementary Materials for
immunology.sciencemag.org/cgi/content/full/2/16/eaan6049/dc1 Supplementary Materials for Enzymatic synthesis of core 2 O-glycans governs the tissue-trafficking potential of memory CD8 + T cells Jossef
More informationSupplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-
More informationSUPPLEMENTARY INFORMATION
Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with
More informationSUPPLEMENTARY INFORMATION
DOI: 1.138/ncb3355 a S1A8 + cells/ total.1.8.6.4.2 b S1A8/?-Actin c % T-cell proliferation 3 25 2 15 1 5 T cells Supplementary Figure 1 Inter-tumoral heterogeneity of MDSC accumulation in mammary tumor
More informationSupplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.
More information(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment
SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.
More informationBreeding scheme, transgenes, histological analysis and site distribution of SB-mutagenized osteosarcoma.
Supplementary Figure 1 Breeding scheme, transgenes, histological analysis and site distribution of SB-mutagenized osteosarcoma. (a) Breeding scheme. R26-LSL-SB11 homozygous mice were bred to Trp53 LSL-R270H/+
More informationStudy of the H-Ras-Rb Axis in Oncogene Induced Senescence. Honors Research Thesis. Presented in partial fulfillment of the requirements for graduation
Study of the H-Ras-Rb Axis in Oncogene Induced Senescence Honors Research Thesis Presented in partial fulfillment of the requirements for graduation with honors research distinction in Biology in the undergraduate
More informationCells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2],
Supplementary information Methods Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2], and A/Hong Kong/213/03 [H5N1]) were grown in Madin-Darby canine kidney (MDCK) cells
More informationSupplemental Data Table 1 Characteristics of the MHH BC cohort number percent cases histology IDBC ILBC others 6 3 pt status pt1
Supplemental Data Table 1 Characteristics of the MHH BC cohort number percent cases 183 100 histology IDBC 128 70 ILBC 49 27 others 6 3 pt status pt1 98 54 pt2 56 31 pt3 14 8 pt4 14 8 ptx 1 1 pn status
More informationHCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation
SUPPLEMENTARY INFORMATION Materials and Methods Human cell lines and culture conditions HCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation in exon 20 of BRCA1
More informationAn epithelial-to-mesenchymal transition-inducing potential of. granulocyte macrophage colony-stimulating factor in colon. cancer
An epithelial-to-mesenchymal transition-inducing potential of granulocyte macrophage colony-stimulating factor in colon cancer Yaqiong Chen, Zhi Zhao, Yu Chen, Zhonglin Lv, Xin Ding, Renxi Wang, He Xiao,
More informationSupplementary data Supplementary Figure 1 Supplementary Figure 2
Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationBoucher et al NCOMMS B
1 Supplementary Figure 1 (linked to Figure 1). mvegfr1 constitutively internalizes in endothelial cells. (a) Immunoblot of mflt1 from undifferentiated mouse embryonic stem (ES) cells with indicated genotypes;
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationDevelopment Supplementary information
Supplemental Materials and Methods Mosaic clonal analysis GSC and SP clones were induced with the FLP/FRT-mediated mitotic recombination technique (Xu and Rubin, 1993) in files with following genotypes:
More informationMTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)
Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum
More informationSupplementary Figure 1. Validation of astrocytes. Primary astrocytes were
Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were separated from the glial cultures using a mild trypsinization protocol. Anti-glial fibrillary acidic protein (GFAP) immunofluorescent
More informationExpression of acid base transporters in the kidney collecting duct in Slc2a7 -/-
Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.
More informationSUPPLEMENTARY FIGURE LEGENDS
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Hippocampal sections from new-born Pten+/+ and PtenFV/FV pups were stained with haematoxylin and eosin (H&E) and were imaged at (a) low and (b) high
More informationSupplementary Figure 1
Supplementary Figure 1 Control Pancreatitis Supplementary Figure 2 A Panc Liver SI Spleen H 2 O B EZH2 fl/fl C EZH2 fl/fl 37bp EZH2 ERK2 D E 5 EZH2 fl/fl Fasting Glucose (mg/dl) 2 18 16 14 12 1 8 6 4 2
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Eremina V, Jefferson JA, Kowalewska J, et al. VEGF inhibition
More informationA549 and A549-fLuc cells were maintained in high glucose Dulbecco modified
Cell culture and animal model A549 and A549-fLuc cells were maintained in high glucose Dulbecco modified Eagle medium supplemented with 10% fetal bovine serum at 37 C in humidified atmosphere containing
More informationProduct Datasheet. EMMPRIN/CD147 Antibody (MEM-M6/1) NB Unit Size: 0.1 mg. Store at 4C. Do not freeze. Publications: 2
Product Datasheet EMMPRIN/CD147 Antibody (MEM-M6/1) NB500-430 Unit Size: 0.1 mg Store at 4C. Do not freeze. Publications: 2 Protocols, Publications, Related Products, Reviews, Research Tools and Images
More informationBRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information)
BRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information) David Dankort, David P. Curley, Robert A. Cartlidge, Betsy Nelson, Anthony N. Karnezis,
More informationGeneral Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:
General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSOPten flox/flox (KO) Pten flox/flox (WT) flox allele 6.0 kb. Pten. Actin. ! allele 2.3 kb. Supplementary Figure S1. Yanagi, et al.
s1 A Pten flox/flox () SOPten flox/flox () flox allele 6. kb B Pten flox/flox () SOPten flox/flox () Pten Actin! allele 2.3 kb Supplementary Figure S1. Yanagi, et al. A B BrdU BrdU positive cells ( ) 3
More informationFang et al. NMuMG. PyVmT unstained Anti-CCR2-PE MDA-MB MCF MCF10A
A NMuMG PyVmT 16.5+.5 47.+7.2 Fang et al. unstained Anti-CCR2-PE 4T1 Control 37.6+6.3 56.1+.65 MCF1A 16.1+3. MCF-7 3.1+5.4 MDA-M-231 42.1+5.5 unstained Secondary antibody only Anti-CCR2 SUPPLEMENTAL FIGURE
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationOriginal Article CREPT expression correlates with esophageal squamous cell carcinoma histological grade and clinical outcome
Int J Clin Exp Pathol 2017;10(2):2030-2035 www.ijcep.com /ISSN:1936-2625/IJCEP0009456 Original Article CREPT expression correlates with esophageal squamous cell carcinoma histological grade and clinical
More informationRabbit Polyclonal antibody to NFkB p65 (v-rel reticuloendotheliosis viral oncogene homolog A (avian))
Datasheet GeneTex, Inc : Toll Free 1-877-GeneTex (1-877-436-3839) Fax:1-949-309-2888 info@genetex.com GeneTex International Corporation : Tel:886-3-6208988 Fax:886-3-6208989 infoasia@genetex.com Date :
More informationSupplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were
Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were isolated from wild type (PKC-θ- WT) or PKC-θ null (PKC-θ-KO)
More informationSupplementary Material for
Supplementary Material for Parathyroid Hormone Signaling through Low-density-lipoprotein-related Protein 6 Mei Wan, Chaozhe Yang, Jun Li, Xiangwei Wu, Hongling Yuan, Hairong Ma, Xi He, Shuyi Nie, Chenbei
More informationSupplementary Figure 1
Supplementary Figure 1 The average sigmoid parametric curves of capillary dilation time courses and average time to 50% peak capillary diameter dilation computed from individual capillary responses averaged
More informationMATERIALS AND METHODS. Neutralizing antibodies specific to mouse Dll1, Dll4, J1 and J2 were prepared as described. 1,2 All
MATERIALS AND METHODS Antibodies (Abs), flow cytometry analysis and cell lines Neutralizing antibodies specific to mouse Dll1, Dll4, J1 and J2 were prepared as described. 1,2 All other antibodies used
More informationSupporting Information
Supporting Information Fujishita et al. 10.1073/pnas.0800041105 SI Text Polyp Scoring. Intestinal polyps were counted as described (1). Briefly, the small and large intestines were excised, washed with
More informationCell Culture. The human thyroid follicular carcinoma cell lines FTC-238, FTC-236 and FTC-
Supplemental material and methods Reagents. Hydralazine was purchased from Sigma-Aldrich. Cell Culture. The human thyroid follicular carcinoma cell lines FTC-238, FTC-236 and FTC- 133, human thyroid medullary
More informationSupporting Information
Supporting Information Chan et al. 1.173/pnas.9654916 A Patient B Xenograft C * remaining feature of normal lymph node * * * D lymphocytes Infiltrating transitional carcinoma cells E Enlarged axillary
More informationReason for Dissection. Pleomorphic adenoma. Tongue base adenocarcinoma
Supplementary Table S1 Human Patients Patient Sample No. Gender Age Additional Medication Treatment 1 Reason for Dissection Total Irradiation Dose Estimated Irradiation Dose to SG Gland Time of Resection
More informationSupplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as
Supplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as well as their downstream effectors across a panel of ESCC
More informationSupplementary Figure 1
Supplementary Figure 1 a Percent of body weight! (%) 4! 3! 1! Epididymal fat Subcutaneous fat Liver SD Percent of body weight! (%) ** 3! 1! SD Percent of body weight! (%) 6! 4! SD ** b Blood glucose (mg/dl)!
More informationFAK Copy Number. tumor 79. tumor 78. tumor 73. tumor 75. n=79 R 2 =0.09 P= FAK mrna (Log 2 ) MYC mrna (A.U.) n=79 R 2 =0.04 P=0.
A 25 Copy Number 2 15 1 5 B tumor 72 tumor 73 tumor 74 tumor 75 tumor 76 tumor 77 tumor 78 tumor 79 mrna (Log 2 ) 11 1 9 n=79 R 2 =.9 P=.5 C 15 1 2 3 / CEP8 Ratio MYC mrna (A.U.) 1 5 n=79 R 2 =.4 P=.7
More informationSupplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier
Supplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier curves for progression-free survival (PFS) and overall survival (OS) in a cohort of patients (N=52) with stage III primary ovarian
More informationProteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival
Supplementary Information for Proteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival Tatsuro Kawamura 1, Makoto Kawatani 1, Makoto Muroi, Yasumitsu Kondoh,
More informationSupplemental Information. Tissue Myeloid Progenitors Differentiate. into Pericytes through TGF-b Signaling. in Developing Skin Vasculature
Cell Reports, Volume 18 Supplemental Information Tissue Myeloid Progenitors Differentiate into Pericytes through TGF-b Signaling in Developing Skin Vasculature Tomoko Yamazaki, Ani Nalbandian, Yutaka Uchida,
More informationSupplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections
Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections of normal cartilage were stained with safranin O-fast
More informationSupplementary Methods: Omalizumab Trial This double-blind, randomized, placebo-controlled trial was conducted at the University of Utah Hospital and
Supplementary Methods: Omalizumab Trial This double-blind, randomized, placebo-controlled trial was conducted at the University of Utah Hospital and Primary Children s Hospital, Salt Lake City, UT, both
More information