Kevin M. Legg, PhD & Luciano Arantes, MS & Phillip B. Danielson, PhD

Size: px
Start display at page:

Download "Kevin M. Legg, PhD & Luciano Arantes, MS & Phillip B. Danielson, PhD"

Transcription

1 Confirmatory Blood Identification by Mass Spectrometry: Adapting Proteomics to Forensic Biology Kevin M. Legg, PhD & Luciano Arantes, MS & Phillip B. Danielson, PhD This research was supported in part by DNA R&D Grants 2006-DN-BX-K001, 2009-DN-BX-K165, 2011-CD-BX-0205, and 2012-DN-BX-K035 awarded by the National Institute of Justice, Office of Justice Programs, US Department of Justice. Points of view in this presentation are those of the authors and do not necessarily represent the official position or policies of the US Department of Justice.

2 Criminalistics Workflow: Serological Screening Serological screening is the gatekeeper for DNA/STR testing Submission Serological Analysis Which fluids are present? DNA Analysis Who is present? Positive Result Negative Result

3 Forensic Body Fluid Identification Challenges Faced By Serologists Presumptive (Antibody, Chemical Rxn, Enzyme Activity) and/or time consuming assays (Microscopy) Chemical Rxn Kastle-Meyer Enzyme Activity Acid Phosphatase Antibody Test Kits C T S

4 Serology is Critical Serology can resolve ambiguities that cannot be addressed by DNA alone. Saliva vs. Vaginal Secretions present on bottle. Human blood? Animal?

5 Next Gen Serology: Mass Spectrometry Based Proteomics Project Objectives: 1. Identify Protein Biomarkers for body fluid identification 2. Develop a rapid multi-fluid/multiplex mass spectrometry assay Advantages: Confirmatory detection by mass spectrometry Universal sample preparation & multi-fluid multiplexing Project History: Discovery Phase Identify Candidate Biomarkers Validation Phase Evaluate Biomarker Specificity Assess Robustness, Reliability and Performance Limits

6 Project History: Biomarker Discovery Through Comparative Proteomics

7 Biomarker Discovery Comparative Proteomics: 2D-HPLC Biomarker Discovery Strategy: Body Fluid Proteome Mapping Differential Analysis by in-house software Biomarker Identification by nano-electrospray ionization mass spectrometry. 2nd Dimension (Hydrophobicity) Individual Proteins 1 st Dimension (ph)

8 Project History: Validation of Biomarker Specificity for Target Stains

9 Biomarker Specificity and Performance Biomarker Validation Samples from 50 humans/fluid Assess specificity and consistency of detection Evaluate performance on casework-type samples Validation Assay Mass Spectrometry (Targeted Ion Assay) 1260 NanoLC Chip Cube & 6520 Q-TOF Rapid method development Cost effective Readily multiplexed

10 Biomarker Specificity Results Population Study 250 samples assessed by Q-TOF 2 proteins/fluid were unique and consistently detected Body Fluid Protein Biomarker (examples) Accession Number Seminal Fluid Saliva Urine Peripheral Blood Menstrual Blood and Vaginal Fluid Semenogelin I/II Epididymal secretory protein E1 Cystatin_SA Statherin Uromodulin Osteopontin Hemopexin Complement C3 Matrix Metalloproteinase 9 NGAL P04279 P61916 P09228 P02808 P07911 P10451 P02790 P01024 P14780 P80188

11 Backlog Method Development: Developing a Blood ID Assay With the Brasilia Police

12 Developing a Blood ID Assay With the Brasilia Police Instituto De Criminalistica Laboratory serves the Brasilia Federal District Quadrupole Time-of-Flight method Chemical: Kastle Meyer Antibody: OBTI & FOB Requirements Human specific Process ~100 samples/week

13 Implementation Plan Blood is most common fluid Agilent 6540 Q-TOF UHPLC Tasks 1 and 2 completed prior to arriving in Brasilia Tasks 3 and 4 completed in 1 week. Training/Familiarization included Laboratory staff completed case sample data acquisition 1 - Protein Selection 2 - Peptide Selection 3 - Reference Standards 4 - Acquisition Method 5 - Case Sample Analysis

14 Protein Selection Protein targets selected from previous validation data Emphasis on high abundance targets More robust for ID in compromised or trace samples 5 blood protein biomarkers selected Protein Target Accession Number Protein Function Alpha 1 Antitrypsin P01009 Protease Inhibitor. Cellular Protection. Apolipoprotein A1 P02647 Component of high-density lipoprotein (HDL). Lipid transportation. Complement C3 P01024 Innate immunity. Complement system activation. Hemoglobin Beta P68871 Oxygen transportation. Hemopexin P02790 Heme scavenger.

15 Peptide Selection I Proteins Peptides Proteins have enormous molecular weight variability Not possible to characterize complex intact mixtures. Statherin (MW = 7,000 Da) Complement C3 (MW = 190,000 Da) Titin (MW = 3,800,000 Da) Trypsin Digestion Cleaves at carboxyl side of Arginine (R) and Lysine (K) Generates MS-Friendly peptides ~ 8-20 AA lengths with multiple basic moieties (positive ESI)

16 Peptide Selection II Hemopexin FASTA file >sp P02790 HEMO_HUMAN Hemopexin OS=Homo sapiens MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT LDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYP PEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKER SWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN GTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSV DAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH Trypsin NFPSPVDAAFR (MW = 1220 Da) YYCFQGNQFLR (MW = 1438 Da) LVQGTQVYVFLTK (MW = 1772 Da)

17 Peptide Selection III Species Specificity BLAST search the Swissprot database for all proteins containing Hemoglobin β peptide GTFATLSELHCDK Human Bonobo Chimp Hemoglobin β peptide is not human specific.

18 Peptide Selection III Species Specificity BLAST search the Swissprot database for all proteins containing peptide Complement C3 peptide AAVYHHFISDGVR Human Complement C3 peptide is human specific.

19 Peptide Selection IV Final Target List Protein Accession Peptide m/z Alpha 1 Antitrypsin Apolipoprotein A1 Complement C3 Hemoglobin Beta Hemopexin P01009 P02647 P01024 P68871 P02790 DTEEEDFHVDQVTTVK FNKPFVFLMIEQNTK LSITGTYDLK SVLGQLGITK EQLGPVTQEFWDNLEK LLDNWDSVTSTFSK DYVSQFEGSALGK VSFLSALEEYTK ATEHLSTLSEK TELRPGETLNVNFLLR SNLDEDIIAEENIVSR SSLSVPYVIVPLK IHWESASLLR TGLQEVEVK SAVTALWGK VNVDEVGGEALGR GTFATLSELHCDK EFTPPVQAAYQK LLVVYPWTQR LYLVQGTQVYVFLTK YYC[+57.0]FQGNQFLR NFPSPVDAAFR GGYTLVSGYPK

20 Custom Peptide Library Acquisition Method I Reference Standards Cost effective (~$15/peptide) but crude purity (50% purity) Qualitative confirmation of biomarker ID Populate PCDL spectral library & retention time parameters Hemopexin NFPSPVDAAFR [M] = m/z =

21 Acquisition Method I Reference Standards Populating Personal Compound Database Library (PCDL) Manager

22 Acquisition Method II Directed MS/MS Mode Restrict fragmentation to ions present in preferred table 6540 Q-TOF and AJS Conditions 1290 LC Conditions Parameter Value Polarity Positive Capillary Voltage 3500 V Drying gas 300 C, 10 l/min Nebulizer 30 psi sheath gas 300 C, 11 l/min Acquisition Rate 6 (MS) and 3 (MS/MS) spectra/second Acquisition Range m/z (MS) and m/z (MS/MS) Collision Energy Using static formula based off precursor m/z 3.1*(m/z) *(m/z) Internal Refrence Mass and m/z Precursor Selection 2 precursors/cycle Active Exclusion After 2 Spectrim Release After.05 minutes Parameter Value Column 2.1 x 150 mm RRHD Eclipse Plus C18 Column termperature 50 C Mobile Phase A: H2O.1%FA B: ACN.1% FA Flow rate.5 ml/min Gradient Time %B initial Stop time 15 min Post time 3 min Injection volume 20 ul, 10 ug peptide per injection

23 Data Analysis Masshunter + PCDL Library Proteomics software not required Compound List Masshunter ID Parameters Accurate mass < 10 ppm RT.2 minutes DB Score > 65 Accurate Mass & Retention Time MS/MS Library search

24 Backlog Casework Sample Analysis:

25 Casework Sample Analyses 30 suspected bloodstains selected from casework Most of them related to homicides or attempted murders Presumptive tests results were compared to Protein-based Human Blood ID by Mass Spectrometry SOME OF THE SAMPLES AFTER STAIN EXTRACTION FROM SWAB OR GAUZE

26 Case Sample Results I Presumptive Confirmatory

27 S1 S2 S3 S4 S5 S6 S7 S8 S9 S10 S11 S12 S13 S14 S15 S16 S17 S18 S19 S20 S21 S22 S23 S24 S25 S26 S27 S28 S29 S30 N UMBER OF PEPTIDES Case Sample Results II Protein-based Human Blood ID Results Hemopexin A1AT C3 Apo A-1 Hemo beta EVIDENCE

28 Details: Sample 18 & 23 Attempted Murder

29 Details: Sample 18 & 23 Attempted Murder S18: Sample collected from the floor S23: blood splattered plastic bottle

30 Details: Sample 18 & 23 Attempted Murder S18: Sample collected from the floor S18 S18 Presumptive Blood Tests EVIDENCE KASTLE-MEYER OBTI FOB S18 NEG NEG NEG S23 POS POS POS Mass Spectrometry PEPTIDES FOUND RELATED TO Hemo beta Apo A-1 A1AT Hemopexin POS NEG POS POS POS POS POS NEG

31 Details: Sample 18 Attempted Murder Serological screening is the gatekeeper for DNA/STR testing Based only on presumptive test results, sample 18 & 27 would have not been sent to DNA analysis Sample 18 was sent to DNA analysis but did not yield a DNA profile Hemoglobin, A1AT, Hemopexin identified via mass spec Proteins likely remain viable longer than DNA

32 Summary MS method outperformed presumptive tests Human blood was confirmed in all samples Correctly identified false negative results from presumptive tests With added benefits of: Reliable and confirmatory stain ID Batch processing potential Robotics ready

33 Future Directions Department of Defense Grant Award Rapid Innovation Fund Development and deployment Fully automated six fluid multiplex workflow Saliva, Seminal fluid Urine Vaginal fluid Menstrual blood, Peripheral blood

34 Acknowledgements Instituto De Criminalistica (Brasilia, Brazil) Luciano Arantes Eduardo Ramalho Rodrigo Santos Agilent Technologies Andre Santos Tom Gluodenis NMS Labs/Center for Forensic Sci. Dr. Christian Westring Dr. Barry Logan Heather McKiernan University of Denver Danielson Laboratory National Institute of Justice Minh Nguyen and Chad Ernst

Body Fluid ID by Mass Spectrometry

Body Fluid ID by Mass Spectrometry Body Fluid ID by Mass Spectrometry Kevin Legg, PhD & Phillip Danielson, PhD This research was supported in part by DNA R&D Grants 2006-DN-BX-K001, 2009-DN-BX-K165, 2011-CD-BX-0205, and 2012-DN-BX-K035

More information

Development and Testing of a Mass Spectrometry Based Assay for the Identification of Biological Stains. Kevin Legg

Development and Testing of a Mass Spectrometry Based Assay for the Identification of Biological Stains. Kevin Legg Development and Testing of a Mass Spectrometry Based Assay for the Identification of Biological Stains Kevin Legg This project was supported by DNA R&D Grants 2006-DN-BX-K001, 2009-DN-BX-K165, 2011-CD-BX-0205,

More information

Impact of Chromatography on Lipid Profiling of Liver Tissue Extracts

Impact of Chromatography on Lipid Profiling of Liver Tissue Extracts Impact of Chromatography on Lipid Profiling of Liver Tissue Extracts Application Note Clinical Research Authors Mark Sartain and Theodore Sana Agilent Technologies, Inc. Santa Clara, California, USA Introduction

More information

MS/MS Library Creation of Q-TOF LC/MS Data for MassHunter PCDL Manager

MS/MS Library Creation of Q-TOF LC/MS Data for MassHunter PCDL Manager MS/MS Library Creation of Q-TOF LC/MS Data for MassHunter PCDL Manager Quick Start Guide Step 1. Calibrate the Q-TOF LC/MS for low m/z ratios 2 Step 2. Set up a Flow Injection Analysis (FIA) method for

More information

SWATH Acquisition Enables the Ultra-Fast and Accurate Determination of Novel Synthetic Opioids

SWATH Acquisition Enables the Ultra-Fast and Accurate Determination of Novel Synthetic Opioids SWATH Acquisition Enables the Ultra-Fast and Accurate Determination of Novel Synthetic Opioids Data Independent Acquisition on TripleTOF and X-Series QTOF Systems for Seized Drug Analysis Oscar G. Cabrices

More information

LC/MS Method for Comprehensive Analysis of Plasma Lipids

LC/MS Method for Comprehensive Analysis of Plasma Lipids Application Note omics LC/MS Method for Comprehensive Analysis of Plasma s Authors Tomas Cajka and Oliver Fiehn West Coast Metabolomics Center, University of California Davis, 451 Health Sciences Drive,

More information

Cannabinoid Profiling and Quantitation in Hemp Extracts using the Agilent 1290 Infinity II/6230B LC/TOF system

Cannabinoid Profiling and Quantitation in Hemp Extracts using the Agilent 1290 Infinity II/6230B LC/TOF system Cannabinoid Profiling and Quantitation in Hemp Extracts using the Agilent 9 Infinity II/63B LC/TOF system Application Brief Authors Mike Adams, Karen Kaikaris, and A. Roth CWC Labs Joan Stevens, Sue D

More information

Qualitative and quantitative determination of cannabinoid profiles and potency in CBD hemp oil using LC/UV and Mass Selective Detection

Qualitative and quantitative determination of cannabinoid profiles and potency in CBD hemp oil using LC/UV and Mass Selective Detection Application Note Cannabis Qualitative and quantitative determination of cannabinoid profiles and potency in CBD hemp oil using LC/UV and Mass Selective Detection Authors Mike Adams, Annette Roth, Sue D

More information

PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System

PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow

More information

High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column

High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column Application Note BioPharma Authors James Martosella, Phu Duong, and Alex Zhu Agilent Technologies, Inc. Abstract

More information

Profiling of Endogenous Metabolites Using Time-of-Flight LC/MS with Ion Pair Reverse Phase Chromatography

Profiling of Endogenous Metabolites Using Time-of-Flight LC/MS with Ion Pair Reverse Phase Chromatography Profiling of Endogenous Metabolites Using Time-of-Flight LC/MS with Ion Pair Reverse Phase Chromatography Application Note Metabolomics Author Yuqin Dai Agilent Technologies, Inc. 31 Stevens Creek Blvd,

More information

Quantitative Analysis of Underivatized Amino Acids in Plant Matrix by Hydrophilic Interaction Chromatography (HILIC) with LC/MS Detection

Quantitative Analysis of Underivatized Amino Acids in Plant Matrix by Hydrophilic Interaction Chromatography (HILIC) with LC/MS Detection Application Note Food Testing, Metabolomics, Agricultural Chemistry, Environmental Quantitative Analysis of Underivatized Amino Acids in Plant Matrix by Hydrophilic Interaction Chromatography (HILIC) with

More information

Identification of Haemoglobinopathies by LC/MS

Identification of Haemoglobinopathies by LC/MS Identification of Haemoglobinopathies by LC/ Mark Harrison; Senior Scientist, ThermoFisher Scientific Sarah Battle; Senior Biomedical Scientist, Royal Hallamshire Hospital Introduction There are over 2

More information

LC/QTOF Discovery of Previously Unreported Microcystins in Alberta Lake Waters

LC/QTOF Discovery of Previously Unreported Microcystins in Alberta Lake Waters LC/QTOF Discovery of Previously Unreported Microcystins in Alberta Lake Waters Ralph Hindle Vogon Laboratory Services Ltd. Cochrane, Alberta, Canada Xu Zhang David W. Kinniburgh Alberta Centre for Toxicology

More information

Choosing the metabolomics platform

Choosing the metabolomics platform Choosing the metabolomics platform Stephen Barnes, PhD Department of Pharmacology & Toxicology University of Alabama at Birmingham sbarnes@uab.edu Challenges Unlike DNA, RNA and proteins, the metabolome

More information

Extended Mass Range Triple Quadrupole for Routine Analysis of High Mass-to-charge Peptide Ions

Extended Mass Range Triple Quadrupole for Routine Analysis of High Mass-to-charge Peptide Ions Extended Mass Range Triple Quadrupole for Routine Analysis of High Mass-to-charge Peptide Ions Application Note Targeted Proteomics Authors Linfeng Wu, Christine A. Miller, Jordy Hsiao, Te-wei Chu, Behrooz

More information

4-Plex itraq Based Quantitative Proteomic Analysis Using an Agilent Accurate -Mass Q-TOF

4-Plex itraq Based Quantitative Proteomic Analysis Using an Agilent Accurate -Mass Q-TOF 4-Plex itraq Based Quantitative Proteomic Analysis Using an Agilent Accurate -Mass Q-TOF Application Note Authors H. C. Harsha, G. S. S. Kumar, and A. Pandey Institute of Bioinformatics Bangalore India

More information

The Agilent MassHunter Software. One Software for all Agilent Mass Spec Systems

The Agilent MassHunter Software. One Software for all Agilent Mass Spec Systems The Agilent MassHunter Software One Software for all Agilent Mass Spec Systems MassHunter The most innovative MS SW! MassHunter Workstation One software for all Agilent MS Systems Minimize learning (and

More information

Separation of Polyphenols by Comprehensive 2D-LC and Molecular Formula Determination by Coupling to Accurate Mass Measurement

Separation of Polyphenols by Comprehensive 2D-LC and Molecular Formula Determination by Coupling to Accurate Mass Measurement Separation of Polyphenols by Comprehensive 2D-LC and Molecular Formula Determination by Coupling to Accurate Mass Measurement Application Note Food Testing & Agriculture Author Edgar Naegele Agilent Technologies,

More information

Introduction to Proteomics 1.0

Introduction to Proteomics 1.0 Introduction to Proteomics 1.0 CMSP Workshop Pratik Jagtap Managing Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s necessary for success using

More information

Benefits and Characteristic Applications of High Resolution GC/MS and LC/MS. Frank David RIC and Ghent University

Benefits and Characteristic Applications of High Resolution GC/MS and LC/MS. Frank David RIC and Ghent University Benefits and Characteristic Applications of High Resolution GC/MS and LC/MS. Frank David RIC and Ghent University Mass Spectrometry Structure Elucidation Selective and Sensitive Detection Identification

More information

4-Fluoroethamphetamine

4-Fluoroethamphetamine NMS Labs 2300 Stratford Ave Willow Grove, PA 19090 4-Fluoroethamphetamine Sample Type: Seized Material Latest Revision: January 3, 2019 Date Received: July 31, 2018 Date of Report: January 3, 2019 1. GENERAL

More information

New Instruments and Services

New Instruments and Services New Instruments and Services Liwen Zhang Mass Spectrometry and Proteomics Facility The Ohio State University Summer Workshop 2016 Thermo Orbitrap Fusion http://planetorbitrap.com/orbitrap fusion Thermo

More information

Vitamin D Metabolite Analysis in Biological Samples Using Agilent Captiva EMR Lipid

Vitamin D Metabolite Analysis in Biological Samples Using Agilent Captiva EMR Lipid Vitamin D Metabolite Analysis in Biological Samples Using Agilent Captiva EMR Lipid Application Note Clinical Research Authors Derick Lucas and Limian Zhao Agilent Technologies, Inc. Abstract Lipids from

More information

Mass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector

Mass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector Mass Spectrometry MALDI-TOF ESI/MS/MS Mass spectrometer Basic components Ionization source Mass analyzer Detector 1 Principles of Mass Spectrometry Proteins are separated by mass to charge ratio (limit

More information

LC/MS/MS SOLUTIONS FOR LIPIDOMICS. Biomarker and Omics Solutions FOR DISCOVERY AND TARGETED LIPIDOMICS

LC/MS/MS SOLUTIONS FOR LIPIDOMICS. Biomarker and Omics Solutions FOR DISCOVERY AND TARGETED LIPIDOMICS LC/MS/MS SOLUTIONS FOR LIPIDOMICS Biomarker and Omics Solutions FOR DISCOVERY AND TARGETED LIPIDOMICS Lipids play a key role in many biological processes, such as the formation of cell membranes and signaling

More information

Sue D Antonio Application Chemist Cedar Creek, TX

Sue D Antonio Application Chemist Cedar Creek, TX Sue D Antonio Application Chemist Cedar Creek, TX What is Hemp Oil? CBD hemp oil is a natural botanical extract of the common hemp plant. CBD hemp oil is derived from the seeds and stem of the Cannabis

More information

Conflict of Interest Statement

Conflict of Interest Statement Utilizing an Accurate Mass and Retention Time Library to Facilitate Biomarker Discovery Nichole Reisdorph, PhD and Cole Michel, BS Mass Spectrometry Facility Skaggs School of Pharmacy and Pharmaceutical

More information

Biological Mass spectrometry in Protein Chemistry

Biological Mass spectrometry in Protein Chemistry Biological Mass spectrometry in Protein Chemistry Tuula Nyman Institute of Biotechnology tuula.nyman@helsinki.fi MASS SPECTROMETRY is an analytical technique that identifies the chemical composition of

More information

Sample Preparation is Key

Sample Preparation is Key PLOS ONE DOI: 10.1371/journal.pone.0117232 February 6, 2015 Presented by Katie Gibbs Sample Preparation is Key Sample extraction and instrumental analysis methods are well documented in metabolomics. Understanding

More information

Dr. Erin E. Chambers Waters Corporation. Presented by Dr. Diego Rodriguez Cabaleiro Waters Europe Waters Corporation 1

Dr. Erin E. Chambers Waters Corporation. Presented by Dr. Diego Rodriguez Cabaleiro Waters Europe Waters Corporation 1 Development of an SPE-LC/MS/MS Assay for the Simultaneous Quantification of Amyloid Beta Peptides in Cerebrospinal Fluid in Support of Alzheimer s Research Dr. Erin E. Chambers Waters Corporation Presented

More information

Agilent 6410 Triple Quadrupole LC/MS. Sensitivity, Reliability, Value

Agilent 6410 Triple Quadrupole LC/MS. Sensitivity, Reliability, Value Agilent 64 Triple Quadrupole LC/MS Sensitivity, Reliability, Value Sensitivity, Reliability, Value Whether you quantitate drug metabolites, measure herbicide levels in food, or determine contaminant levels

More information

Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS. Kayleigh Arthur

Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS. Kayleigh Arthur Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS Kayleigh Arthur K.Arthur@lboro.ac.uk Introduction LC-MS is a highly used technique for untargeted profiling analyses

More information

Lecture 3. Tandem MS & Protein Sequencing

Lecture 3. Tandem MS & Protein Sequencing Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:

More information

Simultaneous Analysis of Amino Acids and Acylcarnitines in Dried Blood Spots

Simultaneous Analysis of Amino Acids and Acylcarnitines in Dried Blood Spots Simultaneous Analysis of Amino Acids and Acylcarnitines in Dried Blood Spots Application Note Authors M.P. George Alere Toxicology Services Gretna, LA USA David Presser Agilent Technologies, Inc Santa

More information

Quantitative Analysis of Drugs of Abuse in Urine using UHPLC Coupled to Accurate Mass AxION 2 TOF Mass Spectrometer

Quantitative Analysis of Drugs of Abuse in Urine using UHPLC Coupled to Accurate Mass AxION 2 TOF Mass Spectrometer application Note Liquid Chromatography/ Mass Spectrometry Authors Sharanya Reddy Blas Cerda PerkinElmer, Inc. Shelton, CT USA Quantitative Analysis of Drugs of Abuse in Urine using UHPLC Coupled to Accurate

More information

The Challenges of Analytical Method Validation for Hallucinogens and Designer Stimulants in Biological Samples Using LC-TOF

The Challenges of Analytical Method Validation for Hallucinogens and Designer Stimulants in Biological Samples Using LC-TOF The Challenges of Analytical Method Validation for Hallucinogens and Designer Stimulants in Biological Samples Using LC-TOF Barry K Logan, Ph.D., NMS Labs National Director, Forensic Services Goals The

More information

Identification of Imidacloprid Metabolites in Onions Using High Resolution Accurate Mass Spectrometry (LC/Q-TOF MS) and Accurate Mass Tools

Identification of Imidacloprid Metabolites in Onions Using High Resolution Accurate Mass Spectrometry (LC/Q-TOF MS) and Accurate Mass Tools Identification of Imidacloprid Metabolites in Onions Using High Resolution Accurate Mass Spectrometry (LC/Q-TOF MS) and Accurate Mass Tools Application ote Food Authors E. Michael Thurman and Imma Ferrer

More information

Ion Source. Mass Analyzer. Detector. intensity. mass/charge

Ion Source. Mass Analyzer. Detector. intensity. mass/charge Proteomics Informatics Overview of spectrometry (Week 2) Ion Source Analyzer Detector Peptide Fragmentation Ion Source Analyzer 1 Fragmentation Analyzer 2 Detector b y Liquid Chromatography (LC)-MS/MS

More information

1. Sample Introduction to MS Systems:

1. Sample Introduction to MS Systems: MS Overview: 9.10.08 1. Sample Introduction to MS Systems:...2 1.1. Chromatography Interfaces:...3 1.2. Electron impact: Used mainly in Protein MS hard ionization source...4 1.3. Electrospray Ioniztion:

More information

Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow

Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Purpose Described herein is a workflow that combines the isobaric tagging reagents, itraq Reagents, with the separation power

More information

PerkinElmer talks at spring TCJJP Meeting Wednesday, Mar. 14, 2012

PerkinElmer talks at spring TCJJP Meeting Wednesday, Mar. 14, 2012 Courtney Phillips Wednesday, March 14, 2012 courtney.phillips@perkinelmer.com 1 In 1996, the FQPA amended the two federal laws governing pesticides Federal Insecticide, Fungicide FIFRA& Rodenticide Act

More information

Biological Mass Spectrometry. April 30, 2014

Biological Mass Spectrometry. April 30, 2014 Biological Mass Spectrometry April 30, 2014 Mass Spectrometry Has become the method of choice for precise protein and nucleic acid mass determination in a very wide mass range peptide and nucleotide sequencing

More information

O O H. Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION EXPERIMENTAL. LC /MS conditions

O O H. Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION EXPERIMENTAL. LC /MS conditions Simplifying Qual/Quan Analysis in Discovery DMPK using UPLC and Xevo TQ MS Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION The determination of the drug metabolism

More information

Application Note # LCMS-89 High quantification efficiency in plasma targeted proteomics with a full-capability discovery Q-TOF platform

Application Note # LCMS-89 High quantification efficiency in plasma targeted proteomics with a full-capability discovery Q-TOF platform Application Note # LCMS-89 High quantification efficiency in plasma targeted proteomics with a full-capability discovery Q-TOF platform Abstract Targeted proteomics for biomarker verification/validation

More information

A NOVEL METHOD OF M/Z DRIFT CORRECTION FOR OA-TOF MASS SPECTROMETERS BASED ON CONSTRUCTION OF LIBRARIES OF MATRIX COMPONENTS.

A NOVEL METHOD OF M/Z DRIFT CORRECTION FOR OA-TOF MASS SPECTROMETERS BASED ON CONSTRUCTION OF LIBRARIES OF MATRIX COMPONENTS. A NOVEL METHOD OF M/Z DRIFT CORRECTION FOR OA-TOF MASS SPECTROMETERS BASED ON CONSTRUCTION OF LIBRARIES OF MATRIX COMPONENTS. Martin R Green*, Keith Richardson, John Chipperfield, Nick Tomczyk, Martin

More information

Metabolomic and Proteomics Solutions for Integrated Biology. Christine Miller Omics Market Manager ASMS 2015

Metabolomic and Proteomics Solutions for Integrated Biology. Christine Miller Omics Market Manager ASMS 2015 Metabolomic and Proteomics Solutions for Integrated Biology Christine Miller Omics Market Manager ASMS 2015 Integrating Biological Analysis Using Pathways Protein A R HO R Protein B Protein X Identifies

More information

Analysis of mycotoxins in food matrices using the Agilent Ultivo Triple Quadrupole LC/MS

Analysis of mycotoxins in food matrices using the Agilent Ultivo Triple Quadrupole LC/MS Application Note Analysis of mycotoxins in food matrices using the Agilent Ultivo Triple Quadrupole LC/MS Figure 1. Agilent Ultivo Integrated into LC stack. Authors Theresa Sosienski 1, Dan Hui Dorothy

More information

Lipidomic Analysis by UPLC-QTOF MS

Lipidomic Analysis by UPLC-QTOF MS Lipidomic Analysis by UPLC-QTOF MS Version: 1 Edited by: Oliver Fiehn Summary Reagents and Materials Protocol Summary:Lipidomic analysis by UPLC-QTOF mass spectrometry Reagents and Materials: Reagent/Material

More information

Comparison of mass spectrometers performances

Comparison of mass spectrometers performances Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion

More information

2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry

2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique

More information

An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27

An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27 An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27 Top-down HRAM Bioanalysis of Native Proteins/Molecules Relative Abundance 100

More information

Efficient Quantitative Analysis of THC and Metabolites in Human Plasma Using Agilent Captiva EMR Lipid and LC-MS/MS

Efficient Quantitative Analysis of THC and Metabolites in Human Plasma Using Agilent Captiva EMR Lipid and LC-MS/MS Application Note Forensic Analysis Efficient Quantitative Analysis of THC and Metabolites in Human Plasma Using Agilent Captiva EMR Lipid and LC-MS/MS Authors Joan Stevens and Limian Zhao Agilent Technologies,

More information

A Robustness Study for the Agilent 6470 LC-MS/MS Mass Spectrometer

A Robustness Study for the Agilent 6470 LC-MS/MS Mass Spectrometer A Robustness Study for the Agilent 7 LC-MS/MS Mass Spectrometer Application Note Clinical Research Authors Linda Côté, Siji Joseph, Sreelakshmy Menon, and Kevin McCann Agilent Technologies, Inc. Abstract

More information

The Detection of Allergens in Food Products with LC-MS

The Detection of Allergens in Food Products with LC-MS The Detection of Allergens in Food Products with LC-MS Something for the future? Jacqueline van der Wielen Scope of Organisation Dutch Food and Consumer Product Safety Authority: Law enforcement Control

More information

Phospholipid characterization by a TQ-MS data based identification scheme

Phospholipid characterization by a TQ-MS data based identification scheme P-CN1716E Phospholipid characterization by a TQ-MS data based identification scheme ASMS 2017 MP-406 Tsuyoshi Nakanishi 1, Masaki Yamada 1, Ningombam Sanjib Meitei 2, 3 1 Shimadzu Corporation, Kyoto, Japan,

More information

Ultra High Definition Optimizing all Analytical Dimensions

Ultra High Definition Optimizing all Analytical Dimensions Ultra High Definition Optimizing all Analytical Dimensions Sensitivity Dynamic Range Signal Response Linearity Separation Speed Peak Capacity Chromatogram Mass Spectrum Mass Accuracy Resolving Power Acquisition

More information

Robust extraction, separation, and quantitation of structural isomer steroids from human plasma by SPE-UHPLC-MS/MS

Robust extraction, separation, and quantitation of structural isomer steroids from human plasma by SPE-UHPLC-MS/MS TECHNICAL NOTE 21882 Robust extraction, separation, and quantitation of structural isomer steroids human plasma by SPE-UHPLC-MS/MS Authors Jon Bardsley 1, Kean Woodmansey 1, and Stacy Tremintin 2 1 Thermo

More information

[ APPLICATION NOTE ] APPLICATION BENEFITS INTRODUCTION WATERS SOLUTIONS KEYWORDS

[ APPLICATION NOTE ] APPLICATION BENEFITS INTRODUCTION WATERS SOLUTIONS KEYWORDS [ APPLICATI TE ] Ion Mobility-enabled Data-dependent Experiments Distinguishing Co-eluting Isomeric Metabolites Using an IMS-QTof Mass Spectrometer Jayne Kirk, 1 Russell Mortishire Smith, 1 Robert Beecher,

More information

Proteomics of body liquids as a source for potential methods for medical diagnostics Prof. Dr. Evgeny Nikolaev

Proteomics of body liquids as a source for potential methods for medical diagnostics Prof. Dr. Evgeny Nikolaev Proteomics of body liquids as a source for potential methods for medical diagnostics Prof. Dr. Evgeny Nikolaev Institute for Biochemical Physics, Rus. Acad. Sci., Moscow, Russia. Institute for Energy Problems

More information

Fat-Soluble Vitamins Analysis on an Agilent ZORBAX Eclipse PAH Polymeric C18 Bonded Column

Fat-Soluble Vitamins Analysis on an Agilent ZORBAX Eclipse PAH Polymeric C18 Bonded Column Fat-Soluble Vitamins Analysis on an Agilent ZORBAX Eclipse PAH Polymeric C8 Bonded Column Application Note Food Authors Rongjie FU Agilent Technologies (Shanghai) Co. Ltd. Ying Lun Road Waigaoqiao Free

More information

ANALYTICAL REPORT 1. N-methyl-2AI ( C10H13N) Remark other NPS detected: none. N-methyl-2,3-dihydro-1H-inden-2-amine. Sample ID:

ANALYTICAL REPORT 1. N-methyl-2AI ( C10H13N) Remark other NPS detected: none. N-methyl-2,3-dihydro-1H-inden-2-amine. Sample ID: Vodovodna 95 1000 Ljubljana SLOVENIJA T: +386 (0)1 428 44 93 E: nfl@policija.si www.policija.si Remark other NPS detected: none ANALYTICAL REPORT 1 N-methyl-2AI ( C10H13N) N-methyl-2,3-dihydro-1H-inden-2-amine

More information

Edgar Naegele. Abstract

Edgar Naegele. Abstract Simultaneous determination of metabolic stability and identification of buspirone metabolites using multiple column fast LC/TOF mass spectrometry Application ote Edgar aegele Abstract A recent trend in

More information

LC/MS/MS Separation of Cholesterol and Related Sterols in Plasma on an Agilent InfinityLab Poroshell 120 EC C18 Column

LC/MS/MS Separation of Cholesterol and Related Sterols in Plasma on an Agilent InfinityLab Poroshell 120 EC C18 Column Application Note Clinical Research LC/MS/MS Separation of Cholesterol and Related Sterols in Plasma on an Agilent InfinityLab Poroshell EC C8 Column Authors Rongjie Fu and Zhiming Zhang Agilent Technologies

More information

Advancing your Forensic Toxicology Analyses; Adopting the Latest in Mass Spectrometry Innovations

Advancing your Forensic Toxicology Analyses; Adopting the Latest in Mass Spectrometry Innovations Advancing your Forensic Toxicology Analyses; Adopting the Latest in Mass Spectrometry Innovations For Research Use Only. Not for use in diagnostic procedures. 1 2015 AB Sciex RUO-MKT-11-1018-A For research

More information

ANALYTICAL REPORT 1, 2

ANALYTICAL REPORT 1, 2 Vodovodna 95 1000 Ljubljana SLOVENIJA T: +386 (0)1 428 44 93 E: nfl@policija.si www.policija.si Remark other NPS detected: none ANALYTICAL REPORT 1, 2 Phenibut (C10H13NO2) 4-amino-3-phenylbutanoic acid

More information

Agilent s LC/MS Portfolio and Applications Examples

Agilent s LC/MS Portfolio and Applications Examples Agilent s LC/MS Portfolio and Applications Examples Sean Orlowicz LC/MS Product Specialist Agilent Technologies 31August Agilent s > 40 year heritage in mass spectrometry 1971, 5930A GC/MS 1971-2011 2005,

More information

Mass Spectrometry. Actual Instrumentation

Mass Spectrometry. Actual Instrumentation Mass Spectrometry Actual Instrumentation August 2017 See also http://www.uni-bielefeld.de/chemie/analytik/ms f additional infmation 1. MALDI TOF MASS SPECTROMETRY ON THE ULTRAFLEX 2 2. ESI MASS SPECTROMETRY

More information

New Developments in LC-IMS-MS Proteomic Measurements and Informatic Analyses

New Developments in LC-IMS-MS Proteomic Measurements and Informatic Analyses New Developments in LC-IMS-MS Proteomic Measurements and Informatic Analyses Erin Shammel Baker Kristin E. Burnum-Johnson, Xing Zhang, Cameron P. Casey, Yehia M. Ibrahim, Matthew E. Monroe, Tao Liu, Brendan

More information

Metabolomics: quantifying the phenotype

Metabolomics: quantifying the phenotype Metabolomics: quantifying the phenotype Metabolomics Promises Quantitative Phenotyping What can happen GENOME What appears to be happening Bioinformatics TRANSCRIPTOME What makes it happen PROTEOME Systems

More information

Development of a Bioanalytical Method for Quantification of Amyloid Beta Peptides in Cerebrospinal Fluid

Development of a Bioanalytical Method for Quantification of Amyloid Beta Peptides in Cerebrospinal Fluid Development of a Bioanalytical Method for Quantification of Amyloid Beta Peptides in Cerebrospinal Fluid Joanne ( 乔安妮 ) Mather Senior Scientist Waters Corporation Data courtesy of Erin Chambers and Mary

More information

ANALYTICAL REPORT 1 DPT (C16H24N2) [2-(1H-indol-3-yl)ethyl]dipropylamine.

ANALYTICAL REPORT 1 DPT (C16H24N2) [2-(1H-indol-3-yl)ethyl]dipropylamine. Vodovodna 95 1000 Ljubljana SLOVENIJA T: +386 (0)1 428 44 93 E: nfl@policija.si www.policija.si Remark other NPS detected: none ANALYTICAL REPORT 1 DPT (C16H24N2) [2-(1H-indol-3-yl)ethyl]dipropylamine

More information

Advantages of Ion Mobility Q-TOF for Characterization of Diverse Biological Molecules

Advantages of Ion Mobility Q-TOF for Characterization of Diverse Biological Molecules Advantages of Ion Mobility Q-TOF for Characterization of Diverse Biological Molecules Add a New Dimension to your Research Capability with Agilent s New Drift Ion Mobility Q-TOF System Overview: 6560 IM

More information

Improving Coverage of the Plasma Lipidome Using Iterative MS/MS Data Acquisition Combined with Lipid Annotator Software and 6546 LC/Q-TOF

Improving Coverage of the Plasma Lipidome Using Iterative MS/MS Data Acquisition Combined with Lipid Annotator Software and 6546 LC/Q-TOF Application Note Lipidomics Improving Coverage of the Plasma Lipidome Using Iterative MS/MS Data Acquisition Combined with Lipid Annotator Software and 6546 LC/Q-TOF Authors Jeremy Koelmel Department of

More information

Chemical Analysis Business Operations Waters Corporation Milford MA

Chemical Analysis Business Operations Waters Corporation Milford MA The Detection and Identification of Unknown Contaminants During ToF Screening and Structural Elucidation for Pesticides in River Water Using an Integrated Software Approach Chemical Analysis Business Operations

More information

MS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine

MS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine Application Note: 346 MS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine Gargi Choudhary and Diane Cho, Thermo Fisher Scientific, San Jose, CA Wayne Skinner and

More information

DETERMINATION OF CANNABINOIDS, THC AND THC-COOH, IN ORAL FLUID USING AN AGILENT 6490 TRIPLE QUADRUPOLE LC/MS

DETERMINATION OF CANNABINOIDS, THC AND THC-COOH, IN ORAL FLUID USING AN AGILENT 6490 TRIPLE QUADRUPOLE LC/MS FORENSICS AND TOXICOLOGY ANALYSIS DETERMINATION OF CANNABINOIDS, THC AND THC-COOH, IN ORAL FLUID USING AN AGILENT 6490 TRIPLE QUADRUPOLE LC/MS Solutions for Your Analytical Business Markets and Applications

More information

dtolabs FOOD ANALYSIS Solutions for Your Analytical Business Markets and Applications Programs Authors

dtolabs FOOD ANALYSIS Solutions for Your Analytical Business Markets and Applications Programs Authors FOOD ANALYSIS ANALYTICAL STRATEGY FOR THE DETECTION OF UNDECLARED STIMULANTS AND ANORECTIC COMPOUNDS IN DIETARY SUPPLEMENTS USING THE AGILENT 6550 IFUNNEL Q-TOF LC/MS Solutions for Your Analytical Business

More information

MASS SPECTROMETRY BASED METABOLOMICS. Pavel Aronov. ABRF2010 Metabolomics Research Group March 21, 2010

MASS SPECTROMETRY BASED METABOLOMICS. Pavel Aronov. ABRF2010 Metabolomics Research Group March 21, 2010 MASS SPECTROMETRY BASED METABOLOMICS Pavel Aronov ABRF2010 Metabolomics Research Group March 21, 2010 Types of Experiments in Metabolomics targeted non targeted Number of analyzed metabolites is limited

More information

ANALYTICAL REPORT 1. bk-2c-b ( C10H12BrNO3) 2-amino-1-(4-bromo-2,5-dimethoxyphenyl)ethan-1-one

ANALYTICAL REPORT 1. bk-2c-b ( C10H12BrNO3) 2-amino-1-(4-bromo-2,5-dimethoxyphenyl)ethan-1-one Vodovodna 95 1000 Ljubljana SLOVENIJA T: +386 (0)1 428 44 93 E: nfl@policija.si www.policija.si Remark other NPS detected: none ANALYTICAL REPORT 1 bk-2c-b ( C10H12BrNO3) 2-amino-1-(4-bromo-2,5-dimethoxyphenyl)ethan-1-one

More information

Time-of-Flight LC/MS Identification and Confirmation of a Kairomone in Daphnia magna Cultured Medium. Application. Authors. Abstract.

Time-of-Flight LC/MS Identification and Confirmation of a Kairomone in Daphnia magna Cultured Medium. Application. Authors. Abstract. Time-of-Flight LC/MS Identification and Confirmation of a Kairomone in Daphnia magna Cultured Medium Application Natural Product Chemistry Authors Hideaki Uchida Agilent Technologies Japan, Ltd. Tokyo

More information

LC/MS/MS of Trichothecenes and Zearalenone in Wheat Using Different Sample Prep Methods

LC/MS/MS of Trichothecenes and Zearalenone in Wheat Using Different Sample Prep Methods LC/MS/MS of Trichothecenes and Zearalenone in Wheat Using Different Sample Prep Methods Application Note Food Testing & Agriculture Authors Nick Byrd and Danielle Sweeney Campden BRI Gloucestershire UK

More information

Analysis of anti-epileptic drugs in human serum using an Agilent Ultivo LC/TQ

Analysis of anti-epileptic drugs in human serum using an Agilent Ultivo LC/TQ Application Note Clinical Research Analysis of anti-epileptic drugs in human serum using an Agilent Ultivo LC/TQ Authors Jennifer Hitchcock 1, Lauren Frick 2, Peter Stone 1, and Vaughn Miller 2 1 Agilent

More information

Workflow for Screening and Quantification of the SAMHSA (NIDA) Panel in Urine Using UHPLC-TOF

Workflow for Screening and Quantification of the SAMHSA (NIDA) Panel in Urine Using UHPLC-TOF APPLICATIO OTE Liquid Chromatography/ Mass Spectrometry Authors: Avinash Dalmia Joanne Mather PerkinElmer, Inc. Shelton, CT Workflow for Screening and Quantification of the SAMHSA (IDA) Panel in Urine

More information

New Mass Spectrometry Tools to Transform Metabolomics and Lipidomics

New Mass Spectrometry Tools to Transform Metabolomics and Lipidomics New Mass Spectrometry Tools to Transform Metabolomics and Lipidomics July.3.13 Ken Miller Vice President of Marketing, Life Sciences Mass Spectrometry 1 The world leader in serving science Omics & the

More information

ANALYTICAL REPORT 1 3C-P (C14H23NO3) 1-(3,5-dimethoxy-4-propoxylphenyl)propan-2-amine.

ANALYTICAL REPORT 1 3C-P (C14H23NO3) 1-(3,5-dimethoxy-4-propoxylphenyl)propan-2-amine. Vodovodna 95, 1000 LJUBLJANA, SLOVENIA T: +386 (0)1 428 44 93 E: nfl@policija.si www.policija.si Remark other NPS detected: none ANALYTICAL REPORT 1 3C-P (C14H23NO3) 1-(3,5-dimethoxy-4-propoxylphenyl)propan-2-amine

More information

Moving from targeted towards non-targeted approaches

Moving from targeted towards non-targeted approaches Gesundheitsdirektion Moving from targeted towards non-targeted approaches Anton Kaufmann Official Food Control Authority of the Canton of Zurich () Switzerland 2 Overview I From single residue to multi

More information

Application of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast

Application of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast Application of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast Application note Food supplements Authors Juliusz Bianga and Joanna Szpunar

More information

Small Molecule Science: Experimental designs for achieving ultra trace analysis

Small Molecule Science: Experimental designs for achieving ultra trace analysis Small Molecule Science: Experimental designs for achieving ultra trace analysis Michael P. Balogh Principal scientist Waters Corporation 211 Waters Corporation 1 www.cosmoscience.org The Society for Small

More information

Research to Routine Workflows for Large and Small Molecules using the Q Exactive HR/MS

Research to Routine Workflows for Large and Small Molecules using the Q Exactive HR/MS Research to Routine Workflows for Large and Small Molecules using the Q Exactive HR/MS Sept. 22, 2011 Patrick Bennett Director Pharma Strategic Marketing Thermo Fisher Scientific Agenda Definitions Research

More information

Quantitation of Protein Phosphorylation Using Multiple Reaction Monitoring

Quantitation of Protein Phosphorylation Using Multiple Reaction Monitoring Quantitation of Protein Phosphorylation Using Multiple Reaction Monitoring Application Note Authors Ning Tang, Christine A. Miller and Keith Waddell Agilent Technologies, Inc. Santa Clara, CA USA This

More information

2D-LC as an Automated Desalting Tool for MSD Analysis

2D-LC as an Automated Desalting Tool for MSD Analysis 2D-LC as an Automated Desalting Tool for MSD Analysis Direct Mass Selective Detection of a Pharmaceutical Peptide from an MS-Incompatible USP Method Application Note Biologics and Biosimilars Author Sonja

More information

MALDI Imaging Mass Spectrometry

MALDI Imaging Mass Spectrometry MALDI Imaging Mass Spectrometry Nan Kleinholz Mass Spectrometry and Proteomics Facility The Ohio State University Mass Spectrometry and Proteomics Workshop What is MALDI Imaging? MALDI: Matrix Assisted

More information

INTRODUCTION CH 3 CH CH 3 3. C 37 H 48 N 6 O 5 S 2, molecular weight Figure 1. The Xevo QTof MS System.

INTRODUCTION CH 3 CH CH 3 3. C 37 H 48 N 6 O 5 S 2, molecular weight Figure 1. The Xevo QTof MS System. Fast and Sensitive in vitro Metabolism Study of Rate and Routes of Clearance for Ritonavir using UPLC CUPLED with the Xevo QTof MS System Jose Castro-Perez, Kate Yu, John Shockcor, Henry Shion, Emma Marsden-Edwards,

More information

Agilent 6460 LC-QQQ Highly Sensitive and Robust Analysis for Lipophilic Marine Toxins in Shellfish

Agilent 6460 LC-QQQ Highly Sensitive and Robust Analysis for Lipophilic Marine Toxins in Shellfish Agilent 6460 LC-QQQ ighly Sensitive and Robust Analysis for Lipophilic Marine Toxins in Shellfish Application Note Environmental, Food Safety Authors liver Keuth Chemical and Veterinary Analytical Institute

More information

Using Software Tools to Improve the Detection of Impurities by LC/MS. Application Note. Christine Miller Agilent Technologies.

Using Software Tools to Improve the Detection of Impurities by LC/MS. Application Note. Christine Miller Agilent Technologies. Using Software Tools to Improve the Detection of Impurities Application Note Christine Miller Introduction The analysis of raw materials and finished products for or impurities presents a challenge in

More information

High-Resolution Analysis of Intact Triglycerides by Reversed Phase HPLC Using the Agilent 1290 Infinity LC UHPLC System

High-Resolution Analysis of Intact Triglycerides by Reversed Phase HPLC Using the Agilent 1290 Infinity LC UHPLC System High-Resolution Analysis of Intact Triglycerides by Reversed Phase HPLC Using the Agilent 1290 Infinity LC UHPLC System Application Note Food, Hydrocarbon Processing Authors Michael Woodman Agilent Technologies,

More information

ANALYTICAL REPORT 5F-MDMB-PINACA (C20H28FN3O3) methyl 2-{[1-(5-fluoropentyl)-1H-indazol-3-yl]formamido}-3,3-dimethylbutanoate

ANALYTICAL REPORT 5F-MDMB-PINACA (C20H28FN3O3) methyl 2-{[1-(5-fluoropentyl)-1H-indazol-3-yl]formamido}-3,3-dimethylbutanoate Vodovodna 95 1000 Ljubljana SLOVENIJA ANALYTICAL REPORT 5F-MDMB-PINACA (C20H28FN3O3) methyl 2-{[1-(5-fluoropentyl)-1H-indazol-3-yl]formamido}-3,3-dimethylbutanoate Remark other NPS detected: none Sample

More information

ANALYTICAL REPORT 1, 2

ANALYTICAL REPORT 1, 2 Vodovodna 95 1000 Ljubljana SLOVENIJA T: +386 (0)1 428 44 93 E: nfl@policija.si www.policija.si Remark other NPS detected: none ANALYTICAL REPORT 1, 2 4-MEAP (C14H21NO) 2-(ethylamino)-1-(4-methylphenyl)pentan-1-one

More information