Strategies for Characterizing Proteins in Proteomics Research

Size: px
Start display at page:

Download "Strategies for Characterizing Proteins in Proteomics Research"

Transcription

1 Strategies for Characterizing Proteins in Proteomics Research Joseph A. Loo Department of Biological Chemistry David Geffen School of Medicine Department of Chemistry and Biochemistry University of California Los Angeles, CA USA

2 Approaches for Protein Identification What is this protein? Molecular weight Isoelectric point (charge) Amino acid composition Other physical/chemical characteristics Partial or complete amino acid sequence Edman (N-terminal sequence) - if N-term. not blocked C-terminal sequence - not commonly performed Mass spectrometry-measured information

3 Electrospray Ionization (ESI) ESI highly charge droplets MS mass/charge (m/z( m/z) Multiple charging More charges for larger molecules MW range > 150 kda Liquid introduction of analyte Interface with liquid separation methods, e.g. liquid chromatography Tandem mass spectrometry (MS/MS) for protein sequencing

4 ESI-MS of Large Proteins distribution of multiply charged molecules (M+15H) (M+14H) (M+16H) 16+ (M+13H) mass m/z ESI-MS (Q-TOF) ph 7.5

5 Matrix-assisted assisted Laser Desorption/Ionization (MALDI) Time-of of-flight (TOF) Analyzer MALDI high voltage v 3 m 3 v 2 m 2 v 1 m 1 detector laser sample drift region m 1 m 2 m 3

6 MALDI Mass Spectrometry of Large Proteins 100 MALDI-MS MS of rat MVP (M+H) + % Intensity (M+2H) m/z

7 Approaches for Protein Sequencing and Identification Top Down MS/MS MIRERICACVLALGMLTGFTHAFGSKDAAADGKPLVVTTIGMIADAVKNIAQGDVHLKGLMGP GVDPHLYTATAGDVEWLGNADLILYNGLHLETKMGEVFSKLRGSRLVVAVSETIPVSQRLSLE EAEFDPHVWFDVKLWSYSVKAVYESLCKLLPGKTREFTQRYQAYQQQLDKLDAYVRRKAQS LPAERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQELAAFIAQRKLPAIFIESSI PHKNVEALRDAVQARGHVVQIGGELFSDAMGDAGTSEGTYVGMVTHNIDTIVAALAR Enzymatic or chemical degradation MS/MS Bottom Up

8 Protein Identification by Mass Spectrometry 2-D Gel Electrophoresis MW x Excise separated protein spots pi 1547 In-gel trypsin digest Peptide mass fingerprint by MALDI-TOF or LC-ESI-MS. Additional sequence information can be obtained by MS/MS Recover tryptic peptides m/z Protein identification by searching proteomic or genomic databases

9

10 Quadrupole - Time-of of-flight (QTOF) MALDI ESI Q0 Q1 Q2 select precursor ion of interest tandem mass spectrometry MS/MS fragment precursor ion detect resulting product ions

11

12 De Novo Protein Sequencing of Heat Resistant Proteins Found in Sacred Lotus Lotus, Nelumbo nucifera, has the distinction of having produced the longest living seed, 1300 yr Seed longevity is attributable to its Fruit coat s impermeability to O 2 and water Rapid adaptability to stress Genome is not known de novo protein sequencing Jane Shen-Miller, Kerry Wooding, Yongming Xie

13 SDS-PAGE Lotus protein (>400 yr) boiled embryo extracts 97 kda 64 kda 51 kda 39 kda 28 kda 19 kda 14 kda Heat hardy proteins are soluble in >100 C enable draught protection Lotus Fe-SOD (oxidative repair) retains 65% activity after 1 hr boiling mass spectrometry and de novo sequencing to identify heat stable proteins

14 Isotope Labeling as an Aid to De Novo Sequencing Trypsin Digestion in H 2 18 O (Arg, Lys) R 1 R 2 R 3 R 4...NH-CH CH-CO-NH-CH-CO-NH-CH-CO-NH-CH-COOHCOOH Trypsin / H 16 2 O / H 18 2 O R 1 R 2 NH 2 -CH-CO-NH-CH-CO- 16 OH R 1 R 2 NH 2 -CH-CO-NH-CH-CO- 18 OH 16 O or 18 O Aids interpretation of MS/MS spectra Distinguish b-ions (from N- terminus) and y-ions (from C- terminus): 2 Da shift

15 MALDI-QqTOF Tryptic Peptide Map trypsin digestion performed in H 2 16 O or H 2 18 O Boiled Embryo Extract 45 kda Band H 16 2 O m/z H O m/z

16

17 Enzyme and Chemical Specificity for Proteolysis Arg/Lys - XX Lys - XX Arg - XX Asp/Glu - XX XX - Asp Met - XX Trypsin Lys-C Arg-C V-8 8 protease Asp-N CNBr

18 New Chemistries for Proteomics: Chemical Modification of Cysteine (Cys-specific specific cleavage) N H 2 Br 2-bromoethyl amine Lindley, H. Nature,, 1956, 178,, 647. OH - HS NH O Cysteine H 2 N S N H O Digest with trypsin to cleave after Lys, Arg, Cys S-aminoethyl cysteine Thevis and Loo J. Proteome Res.,, 2003

19 Chemical Modification of Lysine Block Lys-cleavage H 2 N O NH + C H 3 O O CH 3 Lysine Acetic anhydride MeOH H 3 C O H N NH O Digest with trypsin to cleave after Arg, Cys Digest with Lys-C to cleave after Cys Lysine, acetylated (+ 42 Da)

20 Prior to Digestion: Chemical Modification of Cysteine Cys-specific specific cleavage Ionization enhancement of Cys-peptides N H 2 Br OH - HBr N H 2 S R 2-bromoethyl amine S-aminoethyl cysteine Lindley, H. Nature, 1956, 178,, 647. After Digestion: O CH 3 HN NH 2 O-methylisourea H H + N R 2 N N 2 C S H2 NH 2-bromoethyl amine Hale, J.E. et al. Anal. Biochem. 2000, 287,, 110. H H 2 C S + CH 3 OH R homoarginine derivative (improve MALDI response)

21 Human Serum Albumin In-gel derivatization and trypsin digestion MALDI-MS MS % Intensity m/z

22 Human Serum Albumin In-gel derivatization and trypsin digestion (cleavage after Cys, Arg) DAHKSEVAHR FKDLGEENFK ALVLIAFAQY LQQCPFEDHV KLVNEVTEFA KTCVADESAE NCDKSLHTLF GDKLCTVATL RETYGEMADCR CAKQEPERNE CFLQHKDDNP NLPRLVRPEV LVRPEV DVMCTAFHDN EETFLKKYLY EIARRHPYFY APELLFFAKR YKAAFTECCQ AADKAACLLP KLDELRDEGK ASSAKQRLKC ASLQKFGERA FKAWAVARLS QRFPKAEFAE VSKLVTDLTK VHTECCHGDL CHGDL LECADDRADL AKYICENQDS ISSKLKECCE KPLLEKSHCI I AEVENDEMPA DLPSLAADFV ESKDVCKNYA KNYA EAKDVFLGMF LYEYARRHPD YSVVLLLRLA LA KTYETTLEKC CAAADPHECY Y AKVFDEFKPL VEEPQNLIKQ NCELFEQLGE YKFQNALLVR YTKKVPQVST PTLVEVSRNL GKVGSKCCKH PEAKRMPCAE AE DYLSVVLNQL CVLHEKTPVS C DRVTKCCTES LVNRRPCFSA LEVDETYVPK EFNAETFTFH ADICTLSEKE RQIKKQTALV ELVKHKPKAT KEQLKAVMDD FAAFVEKCCK ADDKETCFAE EGKKLVAASQ AALGL Without homoarginine derivatization In addition, with homoarginine derivatization

23 α-lactalbumin In-gel derivatization and trypsin digestion Homoarginine derivatization EQLTKCEVFR ELKDLKGYGG VSLPEWVCTT FHTSGYDTQA IVQNNDSTEY GLFQINNKIW CKDDQNPHSS NICNISC NISCDKF LDDDLTDDIM CVKKILDKVG INYWLAHKAL CSEKLDQWLC EKL 86% sequence coverage D K F L D D D L T D D I M C 14 (homoarg; ) (M+H) + MALDI-MS/MS, MS/MS, QqTOF y 3 y 4 y 7 y 8 y 1 y 2 b 2 b 3 y 5 y 6 y 9 y13 y 10 y 12

24 Why Bother with Intact Protein Masses? The protein s molecular mass defines the native covalent state of a gene s product, including: Post-translational modifications: Glycosylation, Phosphorylation, Oxidation, Deamidation, Lipoylation, Acetylation, Formylation... Post-transcriptional modifications Alternative splicing, Introns/Exons, Frame-shifts, Sequencing Errors Simple confirmation of suspected id s Spotlight the presence of post-translational modifications The fragmentation pattern from proteins can generate sufficient information for identification from sequence databases, particularly when combined with accurate mass measurements of both the intact molecule and its product ions.

25 Combining Gel Electrophoreisis with Mass Spectrometry Building better tools Profiling proteins faster in an automated fashion

26 PAGE-MALDI MALDI-MS: MS: The Virtual 2D Gel Method Potential for automated, high-speed proteomic analysis Rachel Loo

27 Virtual 2-D 2 D Gel Electrophoresis (Analytical Chemistry 73, 4063 (2001)) Identify proteins based on MW and pi Create a database of intact protein masses and provide a direct link to all data produced now and in the future via classical 2D gels Identify proteome-wide posttranslational modifications

28 In-Source Decay (ISD) for Protein Sequencing Peptides and large proteins can be fragmented by ISD Fragmentation occurs in the MALDI ion source not generally well controlled Reflectron TOF not necessary (linear TOF sufficient to measure product ions cut R P F E E D P I T Complete sequence information not present, but extensive stretches of sequence from the N- and/or C-termini observed P E P P E P T P E P T I...TIDE... A G M E N T P E P T I D P E P T I D E

29 Protein ISD from Isoelectric Focusing Gel Counts ptsh 2+ mete S Y W AG N m/z 24 SYWAGNSTREELLAVGRELRARHWDQQKQAGIDLLPVGDFAWYD 67 Counts N-terminal c-ion series S T R E E I/LI/L G R V E I/L R A R H W K/Q D K/Q K/Q K/Q AGIDI/L LP VG D muli F A W Y D Ogorzalek Loo, RR, Cavalcoli, JD, VanBogelen, RA, Mitchell, C, Loo, JA, Moldover, B., and Andrews, PC, Anal. Chem. 73, 4063 (2001). m/z

30 Top-down sequencing of proteins by ESI-MS/MS 100 MW HIV Integrase Catalytic Core (F185K) 827 % m/z

31 Integrase: MS/MS (M+19H) b y % % m/z 764 b y y 2 y 3 y 4 y 5 y 6 y 7 complementary ion pair b Ile -Pro y m/z

32 MS/MS b (m/z 764) b MS/MS/MS or MS 3 can be performed to obtain further sequence information b b b % 1093 b m/z

33 ESI-MS/MS of GroES (97 amino acids) MS/MS yields direct sequence information for the C-terminal 15 amino acid residues. 833 b GroES (Chaperonin-10, MW 10435) b n , n = MS 2 (M+12H) b Difficult to predict fragmentation sites for intact proteins y 5 y y y y y m/z

34 Peptide fragmentation in nozzle-skimmer region of ESI interface Often called nozzleskimmer dissociation Fragmentation can be controlled by adjustment of nozzle-skimmer voltage Low energy CAD peptide fragmentation in atmosphere / vacuum interface Useful for obtaining sequence information for relatively pure samples without the need for a tandem mass spectrometer

35

36

37 Mass Spectrometry as a Tool for Protein Crystallography (see Cohen & Chait, Annu. Rev. Biophys. Biomol. Struct. 2001) Construct Verification Domain Elucidation Define folding domains Improve chances to generate high quality diffracting crystals Limited proteolysis cleaves flexible chains, leaving a more compact folding domain

38 ESI-MS of Intact Protein: ~ 59 kda 3 phosphorylation sites? MW MW Da ESI-MS % m/z

39 Limited Proteolysis for Domain Elucidation ESI-MS Trypsinolysis (15 min) Where are the cleavage sites? Da mass

40 MW MS/MS of Intact Proteins Complex spectra Confirm primary sequence Confirm termini, posttranslational modifications MW (M+18H) 18+ (M+18H) 18+ y-ions b-ions m/z

41 MS/MS of (M+18H) 18+ y-ions similar, but shifted by 80 Da same C-termini, C but phosphorylated MW residues (M+18H) MW residues phospho-site site (M+18H) 18+ y 14+ n y 15+ n y 13+ n m/z

42 Based on homology modeling and limited proteolysis... ESI-MS Trypsinolysis (15 min) (1-150) 150) (1-169) 169) (1-169) 169)-P (1-171) 171)-P ( ) 508)-P mass

43 Conclusions Bottom-up and top-down approaches for protein characterization are complementary Bottom-up methods are robust and lead to efficient processes for identifying proteins Top-down methods are not mature, both experimentally and computationally. Protein fragmentation is not predictable (yet). However, information on protein processing and modifications may be flagged by the top-down approach.

Biological Mass Spectrometry. April 30, 2014

Biological Mass Spectrometry. April 30, 2014 Biological Mass Spectrometry April 30, 2014 Mass Spectrometry Has become the method of choice for precise protein and nucleic acid mass determination in a very wide mass range peptide and nucleotide sequencing

More information

Mass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications

Mass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications Adapted from Mass Spectrometry in Biotechnology Gary Siuzdak,, Academic Press 1996 1 Introduction

More information

Mass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector

Mass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector Mass Spectrometry MALDI-TOF ESI/MS/MS Mass spectrometer Basic components Ionization source Mass analyzer Detector 1 Principles of Mass Spectrometry Proteins are separated by mass to charge ratio (limit

More information

2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry

2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique

More information

Double charge of 33kD peak A1 A2 B1 B2 M2+ M/z. ABRF Proteomics Research Group - Qualitative Proteomics Study Identifier Number 14146

Double charge of 33kD peak A1 A2 B1 B2 M2+ M/z. ABRF Proteomics Research Group - Qualitative Proteomics Study Identifier Number 14146 Abstract The 2008 ABRF Proteomics Research Group Study offers participants the chance to participate in an anonymous study to identify qualitative differences between two protein preparations. We used

More information

Comparison of mass spectrometers performances

Comparison of mass spectrometers performances Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion

More information

REDOX PROTEOMICS. Roman Zubarev.

REDOX PROTEOMICS. Roman Zubarev. REDOX PROTEOMICS Roman Zubarev Roman.Zubarev@ki.se Physiological Chemistry I, Department for Medical Biochemistry & Biophysics, Karolinska Institutet, Stockholm What is (RedOx) Proteomics? Proteomics -

More information

Lecture 3. Tandem MS & Protein Sequencing

Lecture 3. Tandem MS & Protein Sequencing Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:

More information

Introduction to Proteomics 1.0

Introduction to Proteomics 1.0 Introduction to Proteomics 1.0 CMSP Workshop Pratik Jagtap Managing Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s necessary for success using

More information

Biomolecular Mass Spectrometry

Biomolecular Mass Spectrometry Lipids ot different than other organic small molecules Carbohydrates Polymers of monosaccharides linked via glycosidic bonds (acetals/ ketals) many different combinationsvery interesting no time ucleic

More information

Ion Source. Mass Analyzer. Detector. intensity. mass/charge

Ion Source. Mass Analyzer. Detector. intensity. mass/charge Proteomics Informatics Overview of spectrometry (Week 2) Ion Source Analyzer Detector Peptide Fragmentation Ion Source Analyzer 1 Fragmentation Analyzer 2 Detector b y Liquid Chromatography (LC)-MS/MS

More information

PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System

PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow

More information

Peptide sequencing using chemically assisted fragmentation (CAF) and Ettan MALDI-ToF Pro mass spectrometry

Peptide sequencing using chemically assisted fragmentation (CAF) and Ettan MALDI-ToF Pro mass spectrometry application note Ett MALDI-ToF Pro Peptide sequencing using chemically assisted fragmentation (CAF) d Ett MALDI-ToF Pro mass spectrometry Key words: MALDI-ToF, PSD, peptide sequencing, chemically assisted

More information

Chapter 3. Protein Structure and Function

Chapter 3. Protein Structure and Function Chapter 3 Protein Structure and Function Broad functional classes So Proteins have structure and function... Fine! -Why do we care to know more???? Understanding functional architechture gives us POWER

More information

Protein Identification and Phosphorylation Site Determination by de novo sequencing using PepFrag TM MALDI-Sequencing kit

Protein Identification and Phosphorylation Site Determination by de novo sequencing using PepFrag TM MALDI-Sequencing kit Application Note Tel: +82-54-223-2463 Fax : +82-54-223-2460 http://www.genomine.com venture ldg 306 Pohang techno park Pohang, kyungbuk, Korea(ROK) Protein Identification and Phosphorylation Site Determination

More information

MALDI-TOF. Introduction. Schematic and Theory of MALDI

MALDI-TOF. Introduction. Schematic and Theory of MALDI MALDI-TOF Proteins and peptides have been characterized by high pressure liquid chromatography (HPLC) or SDS PAGE by generating peptide maps. These peptide maps have been used as fingerprints of protein

More information

Biological Mass spectrometry in Protein Chemistry

Biological Mass spectrometry in Protein Chemistry Biological Mass spectrometry in Protein Chemistry Tuula Nyman Institute of Biotechnology tuula.nyman@helsinki.fi MASS SPECTROMETRY is an analytical technique that identifies the chemical composition of

More information

Mass Spectrometry and Proteomics. Professor Xudong Yao Bioanalytical Chemistry Spring 2007

Mass Spectrometry and Proteomics. Professor Xudong Yao Bioanalytical Chemistry Spring 2007 Mass Spectrometry and Proteomics Professor Xudong Yao Bioanalytical Chemistry Spring 2007 Proteomics and -omics Roles of mass spectrometry Comparative proteomics Chemical proteomics Protein, Proteome and

More information

Solving practical problems. Maria Kuhtinskaja

Solving practical problems. Maria Kuhtinskaja Solving practical problems Maria Kuhtinskaja What does a mass spectrometer do? It measures mass better than any other technique. It can give information about chemical structures. What are mass measurements

More information

Supplementary Information. Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels

Supplementary Information. Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels Supplementary Information Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels Nobuaki Takemori,,* Ayako Takemori,, Piriya Wongkongkathep, Michael Nshanian, Rachel R. Ogorzalek

More information

Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University

Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk previously Peptide fragmentation Hybrid instruments 117 The Building Blocks of Life DNA RNA Proteins

More information

Mass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010

Mass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010 Mass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010 Introduction, Ionization Methods Mass Analyzers, Ion Activation Methods

More information

Proteins. Amino acids, structure and function. The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka

Proteins. Amino acids, structure and function. The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka Proteins Amino acids, structure and function The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka O O HO N N HN OH Ser65-Tyr66-Gly67 The Nobel prize in chemistry 2008 Osamu Shimomura,

More information

Methods in Mass Spectrometry. Dr. Noam Tal Laboratory of Mass Spectrometry School of Chemistry, Tel Aviv University

Methods in Mass Spectrometry. Dr. Noam Tal Laboratory of Mass Spectrometry School of Chemistry, Tel Aviv University Methods in Mass Spectrometry Dr. Noam Tal Laboratory of Mass Spectrometry School of Chemistry, Tel Aviv University Sample Engineering Chemistry Biology Life Science Medicine Industry IDF / Police Sample

More information

Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow

Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Purpose Described herein is a workflow that combines the isobaric tagging reagents, itraq Reagents, with the separation power

More information

Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD

Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD 4-7117 sbarnes@uab.edu Overview A mass spectrum Electrospray MS Analysis of intact proteins Molecular weight calculations

More information

1. Sample Introduction to MS Systems:

1. Sample Introduction to MS Systems: MS Overview: 9.10.08 1. Sample Introduction to MS Systems:...2 1.1. Chromatography Interfaces:...3 1.2. Electron impact: Used mainly in Protein MS hard ionization source...4 1.3. Electrospray Ioniztion:

More information

Fundamentals of Soft Ionization and MS Instrumentation

Fundamentals of Soft Ionization and MS Instrumentation Fundamentals of Soft Ionization and MS Instrumentation Ana Varela Coelho varela@itqb.unl.pt Mass Spectrometry Lab Analytical Services Unit Index Mass spectrometers and its components Ionization methods:

More information

Chapter 3. Structure of Enzymes. Enzyme Engineering

Chapter 3. Structure of Enzymes. Enzyme Engineering Chapter 3. Structure of Enzymes Enzyme Engineering 3.1 Introduction With purified protein, Determining M r of the protein Determining composition of amino acids and the primary structure Determining the

More information

Quantitative LC-MS/MS Analysis of Glucagon. Veniamin Lapko, Ph.D June 21, 2011

Quantitative LC-MS/MS Analysis of Glucagon. Veniamin Lapko, Ph.D June 21, 2011 Quantitative LC-MS/MS Analysis of Glucagon Veniamin Lapko, Ph.D June 21, 2011 Contents Comparison with small molecule LC-MS/MS LC-MS/MS sensitivity of peptides detection Stability: neat vs. matrix solutions

More information

Proteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000).

Proteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000). Lecture 2: Principles of Protein Structure: Amino Acids Why study proteins? Proteins underpin every aspect of biological activity and therefore are targets for drug design and medicinal therapy, and in

More information

Metabolomics: quantifying the phenotype

Metabolomics: quantifying the phenotype Metabolomics: quantifying the phenotype Metabolomics Promises Quantitative Phenotyping What can happen GENOME What appears to be happening Bioinformatics TRANSCRIPTOME What makes it happen PROTEOME Systems

More information

Introduction to Peptide Sequencing

Introduction to Peptide Sequencing Introduction to Peptide equencing Quadrupole Ion Traps tructural Biophysics Course December 3, 2014 12/8/14 Introduction to Peptide equencing - athan Yates 1 Why are ion traps used to sequence peptides?

More information

Chemical Mechanism of Enzymes

Chemical Mechanism of Enzymes Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.

More information

Nature Biotechnology: doi: /nbt Supplementary Figure 1

Nature Biotechnology: doi: /nbt Supplementary Figure 1 Supplementary Figure 1 The timeline of the NGAG method for extraction of N-linked glycans and glycosite-containing peptides. The timeline can be changed based on the number of samples. Supplementary Figure

More information

Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g.

Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g. Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g., casein more interestingly, in most other cases, it is a transient

More information

Proteins: Proteomics & Protein-Protein Interactions Part I

Proteins: Proteomics & Protein-Protein Interactions Part I Proteins: Proteomics & Protein-Protein Interactions Part I Jesse Rinehart, PhD Department of Cellular & Molecular Physiology Systems Biology Institute DNA RNA PROTEIN DNA RNA PROTEIN Proteins: Proteomics

More information

Previous Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties

Previous Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties Previous Class Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism Today Protein Kinase Catalytic Properties Protein Phosphorylation Phosphorylation: key protein modification

More information

Mass Spectrometry Introduction

Mass Spectrometry Introduction Mass Spectrometry Introduction Chem 744 Spring 2013 What MS is and is not MS is NOT a spectroscopic method. Molecules are not absorbing EM radiation MS is the generation, separation and characterization

More information

NIH Public Access Author Manuscript J Proteome Res. Author manuscript; available in PMC 2014 July 05.

NIH Public Access Author Manuscript J Proteome Res. Author manuscript; available in PMC 2014 July 05. NIH Public Access Author Manuscript Published in final edited form as: J Proteome Res. 2013 July 5; 12(7): 3071 3086. doi:10.1021/pr3011588. Evaluation and Optimization of Mass Spectrometric Settings during

More information

The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold

The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold Anthony C.G. Dossang * 1, Precious G. Motshwene * 1, Yang Yang* 1, Martyn F. Symmons*, Clare E.

More information

Nature Methods: doi: /nmeth.3177

Nature Methods: doi: /nmeth.3177 Supplementary Figure 1 Characterization of LysargiNase, trypsin and LysN missed cleavages. (a) Proportion of peptides identified in LysargiNase and trypsin digests of MDA-MB-231 cell lysates carrying 0,

More information

ABSTRACT. Dr. Catherine Fenselau, Department of Chemistry and Biochemistry. Presented in this work is a novel bottom up proteomics approach to

ABSTRACT. Dr. Catherine Fenselau, Department of Chemistry and Biochemistry. Presented in this work is a novel bottom up proteomics approach to ABSTRACT Title of Document: INTEGRATION OF ASP-SPECIFIC MICROWAVE-ACCELERATED ACID HYDROLYSIS INTO PROTEOMIC ANALYSES Stephen J. Swatkoski, Ph.D., 2007 Directed By: Dr. Catherine Fenselau, Department of

More information

Mass Spectrometry and Proteomics Xudong Yao

Mass Spectrometry and Proteomics Xudong Yao Mass Spectrometry and Proteomics Xudong Yao Dept of Chemistry University of Connecticut Storrs, CT April 19, 2005 Proteomics and -omics Roles of mass spectrometry Comparative proteomics Gel or non-gel

More information

Quadrupole and Ion Trap Mass Analysers and an introduction to Resolution

Quadrupole and Ion Trap Mass Analysers and an introduction to Resolution Quadrupole and Ion Trap Mass Analysers and an introduction to Resolution A simple definition of a Mass Spectrometer A Mass Spectrometer is an analytical instrument that can separate charged molecules according

More information

Supporting Information. Lysine Propionylation to Boost Proteome Sequence. Coverage and Enable a Silent SILAC Strategy for

Supporting Information. Lysine Propionylation to Boost Proteome Sequence. Coverage and Enable a Silent SILAC Strategy for Supporting Information Lysine Propionylation to Boost Proteome Sequence Coverage and Enable a Silent SILAC Strategy for Relative Protein Quantification Christoph U. Schräder 1, Shaun Moore 1,2, Aaron A.

More information

One Gene, Many Proteins. Applications of Mass Spectrometry to Proteomics. Why Proteomics? Raghothama Chaerkady, Ph.D.

One Gene, Many Proteins. Applications of Mass Spectrometry to Proteomics. Why Proteomics? Raghothama Chaerkady, Ph.D. Applications of Mass Spectrometry to Proteomics Raghothama Chaerkady, Ph.D. McKusick-Nathans Institute of Genetic Medicine and the Department of Biological Chemistry Why Proteomics? One Gene, Many Proteins

More information

Protein Analysis using Electrospray Ionization Mass Spectroscopy *

Protein Analysis using Electrospray Ionization Mass Spectroscopy * OpenStax-CNX module: m38341 1 Protein Analysis using Electrospray Ionization Mass Spectroscopy * Wilhelm Kienast Andrew R. Barron This work is produced by OpenStax-CNX and licensed under the Creative Commons

More information

A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization

A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization Amina S. Woods and Marilyn A. Huestis Chemistry and Drug Metabolism, NIDA Intramural Research Program, NIDA, NIH, Baltimore,

More information

Protein sequence mapping is commonly used to

Protein sequence mapping is commonly used to Reproducible Microwave-Assisted Acid Hydrolysis of Proteins Using a Household Microwave Oven and Its Combination with LC-ESI MS/MS for Mapping Protein Sequences and Modifications Nan Wang and Liang Li

More information

Agilent Protein In-Gel Tryptic Digestion Kit

Agilent Protein In-Gel Tryptic Digestion Kit Agilent 5188-2749 Protein In-Gel Tryptic Digestion Kit Agilent Protein In-Gel Tryptic Digestion Kit Instructions Kit Contents The Protein In-Gel Tryptic Digestion Kit includes sufficient reagents for approximately

More information

Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information

Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt

More information

Impurity Identification using a Quadrupole - Time of Flight Mass Spectrometer QTOF

Impurity Identification using a Quadrupole - Time of Flight Mass Spectrometer QTOF Impurity Identification using a Quadrupole - Time of Flight Mass Spectrometer QTOF PUSHER TOF DETECTOR ZSPRAY TM Ion Source SAMPLING CONE SKIMMER RF HEXAPOLE RF HEXAPOLE QUADRUPOLE IN NARROW BANDPASS MODE

More information

Improve Protein Analysis with the New, Mass Spectrometry- Compatible ProteasMAX Surfactant

Improve Protein Analysis with the New, Mass Spectrometry- Compatible ProteasMAX Surfactant Improve Protein Analysis with the New, Mass Spectrometry- Compatible Surfactant ABSTRACT Incomplete solubilization and digestion and poor peptide recovery are frequent limitations in protein sample preparation

More information

Introduction to LC/MS/MS

Introduction to LC/MS/MS Trends in 2006 Introduction to LC/MS/MS By Crystal Holt, LC/MS Product Specialist, Varian Inc. Toxicology laboratories Increased use of LC/MS Excellent LD Cheaper (still expensive) Much more robust Solves

More information

PROTEINS. Building blocks, structure and function. Aim: You will have a clear picture of protein construction and their general properties

PROTEINS. Building blocks, structure and function. Aim: You will have a clear picture of protein construction and their general properties PROTEINS Building blocks, structure and function Aim: You will have a clear picture of protein construction and their general properties Reading materials: Compendium in Biochemistry, page 13-49. Microbiology,

More information

In-Gel Tryptic Digestion Kit

In-Gel Tryptic Digestion Kit INSTRUCTIONS In-Gel Tryptic Digestion Kit 3747 N. Meridian Road P.O. Box 117 Rockford, IL 61105 89871 1468.2 Number Description 89871 In-Gel Tryptic Digestion Kit, sufficient reagents for approximately

More information

Measuring Lipid Composition LC-MS/MS

Measuring Lipid Composition LC-MS/MS Project: Measuring Lipid Composition LC-MS/MS Verification of expected lipid composition in nanomedical controlled release systems by liquid chromatography tandem mass spectrometry AUTHORED BY: DATE: Sven

More information

This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is worth 2 points.

This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is worth 2 points. MBB 407/511 Molecular Biology and Biochemistry First Examination - October 1, 2002 Name Social Security Number This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is

More information

Mass Spectrometry Infrastructure

Mass Spectrometry Infrastructure Mass Spectrometry Infrastructure Todd Williams, Ph.D. Director KU Mass Spectrometry and Analytical Proteomics Laboratory Mass Spectrometry Lab B025 Malott Hall Mission The Mass Spectrometry and analytical

More information

Gentilucci, Amino Acids, Peptides, and Proteins. Peptides and proteins are polymers of amino acids linked together by amide bonds CH 3

Gentilucci, Amino Acids, Peptides, and Proteins. Peptides and proteins are polymers of amino acids linked together by amide bonds CH 3 Amino Acids Peptides and proteins are polymers of amino acids linked together by amide bonds Aliphatic Side-Chain Amino Acids - - H CH glycine alanine 3 proline valine CH CH 3 - leucine - isoleucine CH

More information

Metabolite identification in metabolomics: Metlin Database and interpretation of MSMS spectra

Metabolite identification in metabolomics: Metlin Database and interpretation of MSMS spectra Metabolite identification in metabolomics: Metlin Database and interpretation of MSMS spectra Jeevan K. Prasain, PhD Department of Pharmacology and Toxicology, UAB jprasain@uab.edu Outline Introduction

More information

CHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith

CHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, & Enzymes General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, Enzymes Learning Objectives: q The 20 common, naturally occurring

More information

SUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T

SUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2019 SUPPORTING INFORMATION Lysine Carbonylation is a Previously Unrecognized Contributor to

More information

Mass spectrometry based proteomics

Mass spectrometry based proteomics Practice-oriented, student-friendly modernization of the biomedical education for strengthening the international competitiveness of the rural Hungarian universities TÁMOP-4.1.1.C-13/1/KONV-2014-0001 Mass

More information

New Instruments and Services

New Instruments and Services New Instruments and Services http://planetorbitrap.com/orbitrap fusion Combining the best of quadrupole, Orbitrap, and ion trap mass analysis in a revolutionary Tribrid architecture, the Orbitrap Fusion

More information

TECHNICAL BULLETIN. R 2 GlcNAcβ1 4GlcNAcβ1 Asn

TECHNICAL BULLETIN. R 2 GlcNAcβ1 4GlcNAcβ1 Asn GlycoProfile II Enzymatic In-Solution N-Deglycosylation Kit Product Code PP0201 Storage Temperature 2 8 C TECHNICAL BULLETIN Product Description Glycosylation is one of the most common posttranslational

More information

MALDI Imaging Mass Spectrometry

MALDI Imaging Mass Spectrometry MALDI Imaging Mass Spectrometry Nan Kleinholz Mass Spectrometry and Proteomics Facility The Ohio State University Mass Spectrometry and Proteomics Workshop What is MALDI Imaging? MALDI: Matrix Assisted

More information

(III) MALDI instrumentation

(III) MALDI instrumentation Dr. Sanjeeva Srivastava (I) Basics of MALDI-TF (II) Sample preparation In-gel digestion Zip-tip sample clean-up Matrix and sample plating (III) MALDI instrumentation 2 1 (I) Basics of MALDI-TF Analyte

More information

Cahn - Ingold - Prelog system. Proteins: Evolution, and Analysis Lecture 7 9/15/2009. The Fischer Convention (1) G (2) (3)

Cahn - Ingold - Prelog system. Proteins: Evolution, and Analysis Lecture 7 9/15/2009. The Fischer Convention (1) G (2) (3) Chapter 4 (1) G Proteins: Evolution, and Analysis Lecture 7 9/15/2009 A V L I M P F W Chapter 4 (2) S (3) T N Q Y C K R H D E The Fischer Convention Absolute configuration about an asymmetric carbon related

More information

An Introduction. 1 Introduction MALDI-TOF/TOF_version100623

An Introduction. 1 Introduction MALDI-TOF/TOF_version100623 MALDI-TOF/TOF mass spectrometry An Introduction 1 Introduction MALDI-TOF/TOF_version100623 MALDI-TOF(/TOF) mass spectrometry MALDI ion source Time-of of-flight (TOF) mass analyzer detector 2 Introduction

More information

CHAPTER 3 Amino Acids, Peptides, Proteins

CHAPTER 3 Amino Acids, Peptides, Proteins CHAPTER 3 Amino Acids, Peptides, Proteins Learning goals: Structure and naming of amino acids Structure and properties of peptides Ionization behavior of amino acids and peptides Methods to characterize

More information

Polymer Additive Analysis by EI and APCI

Polymer Additive Analysis by EI and APCI Polymer Additive Analysis by EI and APCI Kate Yu, Eric Block LC/MS Waters Corporation Introduction to polymer additive analysis by LC/MS. Electron Ionization (EI) Advantages Classical spectra Library searchable

More information

Edman Sample Preparation Part 2. Bill Henzel Genentech Inc.

Edman Sample Preparation Part 2. Bill Henzel Genentech Inc. Edman Sample Preparation Part 2 Bill Henzel Genentech Inc. Determining a Protein is Blocked Estimate the amount of protein applied to the protein sequencer. Compare the staining intensity of the band of

More information

Amino acids. Side chain. -Carbon atom. Carboxyl group. Amino group

Amino acids. Side chain. -Carbon atom. Carboxyl group. Amino group PROTEINS Amino acids Side chain -Carbon atom Amino group Carboxyl group Amino acids Primary structure Amino acid monomers Peptide bond Peptide bond Amino group Carboxyl group Peptide bond N-terminal (

More information

5 Identification of Binding Partners of the Annexin A2 / P11 Complex by Chemical Cross-Linking

5 Identification of Binding Partners of the Annexin A2 / P11 Complex by Chemical Cross-Linking 5 Identification of Binding Partners of the Annexin A2 / P11 Complex by Chemical Cross-Linking In the quest of the omics sciences for holistic schemes, the identification of binding partners of proteins

More information

The Detection of Allergens in Food Products with LC-MS

The Detection of Allergens in Food Products with LC-MS The Detection of Allergens in Food Products with LC-MS Something for the future? Jacqueline van der Wielen Scope of Organisation Dutch Food and Consumer Product Safety Authority: Law enforcement Control

More information

An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27

An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27 An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27 Top-down HRAM Bioanalysis of Native Proteins/Molecules Relative Abundance 100

More information

Mass Spectrometry based metabolomics

Mass Spectrometry based metabolomics Mass Spectrometry based metabolomics Metabolomics- A realm of small molecules (

More information

Sequence Identification And Spatial Distribution of Rat Brain Tryptic Peptides Using MALDI Mass Spectrometric Imaging

Sequence Identification And Spatial Distribution of Rat Brain Tryptic Peptides Using MALDI Mass Spectrometric Imaging Sequence Identification And Spatial Distribution of Rat Brain Tryptic Peptides Using MALDI Mass Spectrometric Imaging AB SCIEX MALDI TOF/TOF* Systems Patrick Pribil AB SCIEX, Canada MALDI mass spectrometric

More information

AA s are the building blocks of proteins

AA s are the building blocks of proteins Chamras Chemistry 106 Lecture otes Chapter 24: Amino Acids, Peptides, and Proteins General Formula: () n (') α-amino Acids: (n = 1) Example: Amino Acids and Proteins: Glycine Alanine Valine AA s are the

More information

Proteomics/Peptidomics

Proteomics/Peptidomics Proteomics/Peptidomics System biology tools and preclinical models for translational research in endometriosis, ESHRE Campus workshop, 4-5 September 2009 E. Waelkens Proteomics: What? Proteins Proteomics

More information

Applications of HPLC-MALDI-TOF MS/MS Phosphoproteomic Analysis in Oncological Clinical Diagnostics

Applications of HPLC-MALDI-TOF MS/MS Phosphoproteomic Analysis in Oncological Clinical Diagnostics Current Proteomics, 2011, 8, 153-167 153 Applications of HPLC-MALDI-TOF MS/MS Phosphoproteomic Analysis in Oncological Clinical Diagnostics Courtney L. Haddock*,1, Barry Holtz 1, Neil Senzer 1,2,3,4 and

More information

Advances in Hybrid Mass Spectrometry

Advances in Hybrid Mass Spectrometry The world leader in serving science Advances in Hybrid Mass Spectrometry ESAC 2008 Claire Dauly Field Marketing Specialist, Proteomics New hybrids instruments LTQ Orbitrap XL with ETD MALDI LTQ Orbitrap

More information

RDP Cores Highlights: the CF Analytics Core. Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology

RDP Cores Highlights: the CF Analytics Core. Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology CF@LANTA RDP Cores Highlights: the CF Analytics Core Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology CF@LANTA RDP Center The CF@LANTA RDP Center at Emory University

More information

Ionization Methods. Neutral species Charged species. Removal/addition of electron(s) Removal/addition of proton(s)

Ionization Methods. Neutral species Charged species. Removal/addition of electron(s) Removal/addition of proton(s) Ionization Methods Neutral species Charged species Removal/addition of electron(s) M + e - (M +. )* + 2e - electron ionization Removal/addition of proton(s) M + (Matrix)-H MH + + (Matrix) - chemical ionization

More information

Can we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016

Can we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016 Can we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016 2015 Waters Corporation 1 Overview 1. 2D RP RP LC of peptides 2. RP-LC

More information

Shotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance.

Shotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance. Abundance Abundance Abundance Abundance Abundance Shotgun Proteomics Protein Mixture 1 2 3 MS/MS proteolysis m/z 2 3 Time µlc m/z MS 1 m/z Peptide Mixture m/z Block Diagram of a Mass Spectrometer Sample

More information

Components of a Mass Spectrometer

Components of a Mass Spectrometer Components of a Mass Spectrometer Sample Introduction Inlet GC LC Direct Insertion (Syringe/Probe) Ionization Ion Separation Ion Detection Ion Source EI,CI,,, MALDI Mass Analyzer Under vacuum TOF, Quadrupole,

More information

MASS SPECTROMETRIC CHARACTERIZATION OF ELASTIN PEPTIDES AND THE EFFECT OF SOLAR RADIATION ON ELASTIN. Dissertation

MASS SPECTROMETRIC CHARACTERIZATION OF ELASTIN PEPTIDES AND THE EFFECT OF SOLAR RADIATION ON ELASTIN. Dissertation MASS SPECTROMETRIC CHARACTERIZATION OF ELASTIN PEPTIDES AND THE EFFECT OF SOLAR RADIATION ON ELASTIN Dissertation zur Erlangung des akademischen Grades Doktor rerum naturalium (Dr. rer. nat.) vorgelegt

More information

New Instruments and Services

New Instruments and Services New Instruments and Services Liwen Zhang Mass Spectrometry and Proteomics Facility The Ohio State University Summer Workshop 2016 Thermo Orbitrap Fusion http://planetorbitrap.com/orbitrap fusion Thermo

More information

Proteomic Analysis of Bovine Brain G Protein Subunit Processing Heterogeneity* S

Proteomic Analysis of Bovine Brain G Protein Subunit Processing Heterogeneity* S Research Proteomic Analysis of Bovine Brain G Protein Subunit Processing Heterogeneity* S Lana A. Cook, Kevin L. Schey, Michael D. Wilcox, Jane Dingus, Rebecca Ettling, Troy Nelson, Daniel R. Knapp, and

More information

Mass Spectrometry at the Laboratory of Food Chemistry. Edwin Bakx Laboratory of Food Chemistry Wageningen University

Mass Spectrometry at the Laboratory of Food Chemistry. Edwin Bakx Laboratory of Food Chemistry Wageningen University Mass Spectrometry at the Wageningen University Mass Spectrometry at the 3 UPLC/CE - ESI - Ion trap MS systems UPLC Thermo Acella with a Velos or VelosPro CE Beckman PA800 with a Thermo VelosPro 1 UPLC-

More information

LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES. Gilles Frache Materials Characterization Day October 14 th 2016

LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES. Gilles Frache Materials Characterization Day October 14 th 2016 LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES Gilles Frache Materials Characterization Day October 14 th 2016 1 MOLECULAR ANALYSES Which focus? LOCALIZATION of molecules by Mass Spectrometry

More information

Section 1 Proteins and Proteomics

Section 1 Proteins and Proteomics Section 1 Proteins and Proteomics Learning Objectives At the end of this assignment, you should be able to: 1. Draw the chemical structure of an amino acid and small peptide. 2. Describe the difference

More information

SCS Mass Spectrometry Laboratory

SCS Mass Spectrometry Laboratory SCS Mass Spectrometry Laboratory Contact Information Staff 31 Noyes Laboratory (8:00-5:00 M-F) 217-333-2545 http://scs.illinois.edu/massspec/ Furong Sun (frs@illinois.edu) Furong Sun Director Training

More information

Metabolite identification in metabolomics: Database and interpretation of MSMS spectra

Metabolite identification in metabolomics: Database and interpretation of MSMS spectra Metabolite identification in metabolomics: Database and interpretation of MSMS spectra Jeevan K. Prasain, PhD Department of Pharmacology and Toxicology, UAB jprasain@uab.edu utline Introduction Putative

More information

Figure S6. A-J) Annotated UVPD mass spectra for top ten peptides found among the peptides identified by Byonic but not SEQUEST + Percolator.

Figure S6. A-J) Annotated UVPD mass spectra for top ten peptides found among the peptides identified by Byonic but not SEQUEST + Percolator. Extending Proteome Coverage by Combining MS/MS Methods and a Modified Bioinformatics Platform adapted for Database Searching of Positive and Negative Polarity 193 nm Ultraviolet Photodissociation Mass

More information

Trypsin Mass Spectrometry Grade

Trypsin Mass Spectrometry Grade 058PR-03 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Trypsin Mass Spectrometry Grade A Chemically Modified, TPCK treated, Affinity Purified

More information

Levels of Protein Structure:

Levels of Protein Structure: Levels of Protein Structure: PRIMARY STRUCTURE (1 ) - Defined, non-random sequence of amino acids along the peptide backbone o Described in two ways: Amino acid composition Amino acid sequence M-L-D-G-C-G

More information