on Non-Consensus Protein Motifs Analytical & Formulation Sciences, Amgen. Seattle, WA
|
|
|
- Octavia Newton
- 5 years ago
- Views:
Transcription
1 N-Linked Glycosylation on Non-Consensus Protein Motifs Alain Balland Analytical & Formulation Sciences, Amgen. Seattle, WA CASSS - Mass Spec 2010 Marina Del Rey, CA. September 8 th, 2010
2 Outline 2 Consensus N-linked Glycosylation: Glycosylation of Asn in the sequence motif NXS/T where X is not Pro. Structural requirements also necessary ( Asparagine turn ). Non-Consensus Glycosylation Discovered on C H 1 domain of recombinant antibody and antibodies pooled from normal human serum Influence of primary sequence around the modification probed by site specific mutants Survey of non-consensus glycosylation sites on recombinant antibodies Protein sequences and structural features of non- consensus glycosylation Conclusion
3 Typical IgG2 structure with N-linked oligosaccharides in the CH 2 domain of Fc 2 V H C H1 V L Glycosylation occurs in the CH 2 domain on Asparagine (N) on the consensus sequence NST IgG1 and IgG2 can carry extra glycan structures due to presence of consensus site in CDRs C L C H2 C H3
4 RP mass analysis of the CEX acidic variants identifies HC population with 2 oligosaccharides 7 x TIC Scan _2.d A B B A John Valliere-Douglass
5 2 nd glycosylation site is localized in CH1 domain (Tryptic peptide H15 aa ) HC Fab H15 H15 Tryptic Peptide 151 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSNFGTQTYTCNVDHKPSNTK 213 Reduced RP-MS Reduced papain RP-MS Tryptic digest peptide map V H15b Chymotryptic Peptide H V C H1 NSGAL N162 W/ 162 NSGAL 166 L C L C H2 C H3 Chymo- tryptic digest H 2 O 18 degly. chymotryptic digest
6 Product ion monitoring of tryptic map profile helps identify glycopeptide gy p 100 % G2F-Sa potential HexNac-Hex product ions ( Da) _ Da 115 HexNac-Hex product ion spectrum (post PNGase F digestion) AMG 393 AV sialidase trypsin Sm (Mn, 1x2) 2: TOF MS ES+ H15+G2F _ Da 777 % HexNac-Hex product ion spectrum (post sialidase digestion) AMG 395 AV trypsin Sm (Mn, 1x2) 2: TOF MS ES+ H15+G2F Sa _ Da 123 H15+G2F H15+G2F-Sa % HexNac-Hex product ion spectrum Time
7 Determination of N-linked site by deglycosylation in the presence of H 2 18 O Conversion of asparagine to aspartic by PNGase F in the presence of H 2 O 18 results in the incorporation of a 3 Da mass tag on the previously occupied asparagine 1 HO HO H 2 N O H O 18 H H 2 N O O PNGase F O NH O 18 H Glycan Gonzalez, J.et al., Anal Biochem Aug 15;205(1):
8 Deglycosylation of Antibody A in H 18 2 O results in 18 O incorporation at HC Asn Valliere-Douglass et al (2009) J. Biol. Chem. 284,
9 Non-consensus glycosylation is observed on the IgG1 C H 1 domain peptide in human serum IgG2 IgG1 IgG2/IgG1 CH1 tryptic peptide amino acids DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 9 Lectin enrichment of natural IgGs: Wesley Wang
10 Site specific mutations to probe influence primary sequence around modification 9/29/2010 C H 1 Consensus mutants C H 1 Non-Consensus Wild Type C H 1 Non-Consensus mutants (expected change) WNSS WNSG ANSG ( ) WNGT WNTG ( ) WNGS WNAG ( 0 ) Statistical analysis of glycoprotein sequence in PDB * Trp in -1 correlated with greater likelihood of occupancy in consensus motifs Ser/Thr in +2functions as proximal hydrogen acceptor, Thr correlated ltdwith greater likelihood of occupancy versus Ser Small hydrophobic amino acids (Ala) are preferred in +1, aromatic amino acids (Trp) correlated with non-occupancy * Petrescu et al., (2004) Glycobiology 14, Site directed mutagenesis and expression in HEK293 cells: Mirna Mujacic and Pranhitha Reddy 10
11 Non-consensus glycosylation is conveniently quantified by reduced capillary electrophoresis C H 1 Wild Type and Mutants LIF - Channel 1 1 HC Heavy Chain C H 1Sequence WNSG / WNAG / ANSG / WNSS RFU U RFU LC NGHC Minutes Minutes Minutes C 1mutant H post-hc 0.4 WNSS % WNGT % WNGS 97.84% RFU RFU U 0.5 ANSG 3.15% WNAG 1.18% WNSG (wt) % WNTG 0.55% Quantitation N-linked glycosylation by CE: Paul Kodama
12 Development of non-consensus glycosylation enrichment and detection strategies Remove consensus C H 2 glycans with endoglycosidase treatment Enrich non-consensus glycosylated species using lectin affinity chromatography Identify the modification sites in enriched populations by ion mapping and electron transfer dissociation (ETD) mass spectrometry Catalogue the 2 o structural motifs associated with nonconsensus glycosylation using IgG2 homology models Goal In-silico prediction of non-consensus glycosylation based on sequence homology and 2 o structure 12
13 Enrichment scheme results in the discovery of additional non-consensus Glycosylation y sites Lectin Enriched Antibody-A Did Not Have Detectable Glycosylated CH2 Glycopeptide Retention on Ricin Column is Thus Due to the Presence of Non-Consensus N-Links 13 Valliere-Douglass et al. (2010) J. Biol. Chem. 285,
14 Non-consensus N-linked site ID strategy Lectin enriched fractions are digested with endo-f2 Peptide maps run on nanomate LTQ-ETD with fraction collection Peptides modified with GlcNAc-Fuc are fragmented by CID-MS 2 and then by ETD-MS 3 CID-MS 2 N 14 ETD-MS 3 Endo-F2 GlcNAc = 203 Da digestion on modified aa
15 Non-Consensus Glycosylation Site Identification in Antibody A Lectin Eluate V L CDR L 1 15
16 9/29/2010 Sites of Glycosylation y on Antibody A Motif Modified Domain Sequence Residue Asn (Non Cons) N162 C H 1 VSWNSGAL Asn (NC) N360 C H 3 MTKNQVSLTC Asn (NC) N35 CDR L 1 SSSNENFL Asn (NC) N164 C L QSGNSQE Gln (C) Q106 V L TFGQGTR Asn (C) N296* C H 2 EQFNSTF 16
17 Non-consensus glycosylation occurs on loops and turns near transitions in secondary structure Antibody A Fab Antibody A Fc Asn 164 (9/9 loop) Gln 106 (11/12 loop) LC Asn 35 (11/14 loop) HC HC HC Asn 360 (3/3 turn) 17 IgG2 homology models generated from known crystal structure Catherine Eakin
18 The Non-Consensus sequence motif is a reverse Consensus motif with S/T in position (-2) 9/29/2010 Asn Ser Modified Residue Sequence Distance S/T to N (Angstroms) Distance N to S/T (Angstroms) N162 (C H 1) VSWNSGA N360 (C H 3) MTKNQVS N164 (C L ) QSGNSQ Ser N35 (CDR L 1) SSSNENF Distances Reported N (Consensus) PDB database* N X (S/T) (avg) * Petrescu et al., (2006) Curr. Opin. Struct. Biol. 10, 980-
19 Conclusions Non-consensus glycosylation Found on antibodies from various recombinant expression systems as well as from natural human sources occurs on Asn residues preceded by S/T in the -2 position (reverse consensus motif (S/T)X N) is observed on loops and turns within 3 residues of a change in 2 o structure Can occur in CDR s; the consequences to potency are under evaluation The presence of non-consensus glycosylation on antibodies from human serum indicates it is likely not immunogenic The in-vivo half life and stability of recombinant mabs with non-consensus glycosylation in C H 1 domain are under evaluation Glycosylation can occur on Glutamine residues (Q-glycosylation) Enrichment strategy and sensitive mass spectrometry techniques instrumental in showing that protein glycosylation governed by more diversified requirements than previously appreciated 19
20 9/29/2010 Acknowledgements John Valliere-Douglass Boxu Yan, Lowell Brady Jennifer Kerr Wesley Wang Mirna Mujacic, Pranhitha Reddy Paul Kodama Catherine Eakin, Randy Ketchem Alison Wallace, Mike Treuheit Confidential l Internal Amgen Use Only 20
Can we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016
Can we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016 2015 Waters Corporation 1 Overview 1. 2D RP RP LC of peptides 2. RP-LC
Glycosylation analyses of recombinant proteins by LC-ESI mass spectrometry
Glycosylation analyses of recombinant proteins by LC-ESI mass spectrometry Dr Malin Bäckström Mammalian Protein Expression Core Facility P4EU meeting Porto Nov 11-12, 2013 MPE - A tissue culture facility
Profiling the Distribution of N-Glycosylation in Therapeutic Antibodies using the QTRAP 6500 System
Profiling the Distribution of N-Glycosylation in Therapeutic Antibodies using the QTRAP 6500 System Scheduled MRM Pro Algorithm for Increased Efficiency of Targeted Detection Jenny Albanese 1, Christie
Nature Biotechnology: doi: /nbt Supplementary Figure 1
Supplementary Figure 1 The timeline of the NGAG method for extraction of N-linked glycans and glycosite-containing peptides. The timeline can be changed based on the number of samples. Supplementary Figure
Unbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM
Unbiased in-depth characterization of CEX fractions from a stressed mab by MS Matthias Berg, Novartis Pharma, BTDM Characterization of CEX fractions Biopharmaceuticals like IgGs show a certain degree of
Chemical Mechanism of Enzymes
Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.
Supplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random
S1 Supplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random Conical Tilt (RCT) reconstruction (left: -50,right:
Extended Mass Range Triple Quadrupole for Routine Analysis of High Mass-to-charge Peptide Ions
Extended Mass Range Triple Quadrupole for Routine Analysis of High Mass-to-charge Peptide Ions Application Note Targeted Proteomics Authors Linfeng Wu, Christine A. Miller, Jordy Hsiao, Te-wei Chu, Behrooz
Linear Growth of Glycomics
2/7/17 Glycomics & Glycoproteomics Lance Wells, omplex arbohydrate Research enter, Department of Biochemistry & Molecular Biology, and hemistry University of Georgia lwells@ccrc.uga.edu NIGMS Biomedical
A chemical and computational approach to comprehensive glycation characterization on antibodies
mabs ISSN: 1942-0862 (Print) 1942-0870 (Online) Journal homepage: https://www.tandfonline.com/loi/kmab20 A chemical and computational approach to comprehensive glycation characterization on antibodies
Detailed Analysis of Polyclonal IgG with Emphasis on Sialylation and Sub-Classes After Fractionation on a Sialic-Acid Binding Lectin
Universität für Bodenkultur Wien Institute of Biochemistry Detailed Analysis of Polyclonal IgG with Emphasis on Sialylation and Sub-Classes After Fractionation on a Sialic-Acid Binding Lectin by Friedrich
TECHNICAL BULLETIN. R 2 GlcNAcβ1 4GlcNAcβ1 Asn
GlycoProfile II Enzymatic In-Solution N-Deglycosylation Kit Product Code PP0201 Storage Temperature 2 8 C TECHNICAL BULLETIN Product Description Glycosylation is one of the most common posttranslational
Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis
Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis of PD-L1 in ovarian cancer cells. (c) Western blot analysis
Supplementary Information
Supplementary Information Two common structural motifs for TCR recognition by staphylococcal enterotoxins Karin Erica Johanna Rödström 1, Paulina Regenthal 1, Christopher Bahl 2, Alex Ford 2, David Baker
PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System
Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow
Practical application of analytical tools for characterization of an impurity-related particle formation mechanism
Practical application of analytical tools for characterization of an impurity-related particle formation mechanism Jared S. Bee, Ph.D. Protein aggregation measurement in biotherapeutics Maryland Center
Automating Mass Spectrometry-Based Quantitative Glycomics using Tandem Mass Tag (TMT) Reagents with SimGlycan
PREMIER Biosoft Automating Mass Spectrometry-Based Quantitative Glycomics using Tandem Mass Tag (TMT) Reagents with SimGlycan Ne uaca2-3galb1-4glc NAcb1 6 Gal NAca -Thr 3 Ne uaca2-3galb1 Ningombam Sanjib
2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry
Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique
Arginine side chain interactions and the role of arginine as a mobile charge carrier in voltage sensitive ion channels. Supplementary Information
Arginine side chain interactions and the role of arginine as a mobile charge carrier in voltage sensitive ion channels Craig T. Armstrong, Philip E. Mason, J. L. Ross Anderson and Christopher E. Dempsey
RAPID SAMPLE PREPARATION METHODS FOR THE ANALYSIS OF N-LINKED GLYCANS
RAPID SAMPLE PREPARATION METHODS FOR THE ANALYSIS OF N-LINKED GLYCANS Zoltan Szabo, András Guttman, Tomas Rejtar and Barry L. Karger Barnett Institute, Boston, MA, USA PCT Workshop,Boston, 21 May, 2010.
LC-MS/MS for the quantification of Peptide biomarker and mixture of closely related Protein in formulation
EUROPEAN BIOANALYSIS FORUM Barcelona, November 14-16, 2012 LC-MS/MS for the quantification of Peptide biomarker and mixture of closely related Protein in formulation Luc-Alain SAVOY CONTENT Part I: SGS
A systematic investigation of CID Q-TOF-MS/MS collision energies to allow N- and O-glycopeptide identification by LC-MS/MS
A systematic investigation of CID Q-TO-MS/MS collision energies A systematic investigation of CID Q-TO-MS/MS collision energies to allow N- and O-glycopeptide identification by LC-MS/MS Abstract The MS
Supplementary Figure 1. Heavy chain sequences of 2G1 and 8M2 aligned with V H 1-69
Supplementary Figure 1. Heavy chain sequences of 2G1 and 8M2 aligned with V H 1-69 germline gene sequence. 2G1 and 8M2 acquired 14 and 18 mutations from the germline gene sequence, respectively. In 2G1,
Properties of amino acids in proteins
Properties of amino acids in proteins one of the primary roles of DNA (but far from the only one!!!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids
Analysis of N-Linked Glycans from Coagulation Factor IX, Recombinant and Plasma Derived, Using HILIC UPLC/FLR/QTof MS
Analysis of N-Linked Glycans from Coagulation Factor IX, Recombinant and Plasma Derived, Using HILIC UPLC/FLR/QTof MS Ying Qing Yu Waters Corporation, Milford, MA, U.S. A P P L I C AT ION B E N E F I T
Supporting Information. Post translational Modifications of Serotonin Type 4 Receptor Heterologously Expressed in. Mouse Rod Cells
Supporting Information Post translational Modifications of Serotonin Type 4 Receptor Heterologously Expressed in Mouse Rod Cells David Salom,, Benlian Wang,, Zhiqian Dong, Wenyu Sun, Pius Padayatti, Steven
Introduction to Peptide Sequencing
Introduction to Peptide equencing Quadrupole Ion Traps tructural Biophysics Course December 3, 2014 12/8/14 Introduction to Peptide equencing - athan Yates 1 Why are ion traps used to sequence peptides?
A. B. C. D. E. F. G. H. I. J. K. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Asn. Asn. Asn. Asn. Asn. Asn
A. B. C. D. E. F. "3 "3!4!3 Ser/Thr "3!4!3!4 Asn Asn Ser/Thr Asn!3!6 Ser/Thr G. H. I. J. K.!3 Ser/Thr Ser/Thr 4 4 2 2 6 3 6 Asn Asn Asn Glycosidases and Glycosyltransferases Introduction to Inverting/Retaining
Flow-Through Electron Capture Dissociation in a novel Branched RF Ion Trap
Flow-Through Electron Capture Dissociation in a novel Branched RF Ion Trap Takashi Baba, J. Larry Campbell, Yves Le Blanc, Jim. W. Hager and Bruce A. Thomson ASMS, June 18 / 2014 1 2014 AB SCIEX Trapping
Dr Mark Hilliard, NIBRT. Waters THE SCIENCE OF WHAT S POSSIBLE TM
RFMS Glycan Characterization Techniques for Biotherapeutics Dr Mark Hilliard, NIBRT Waters THE SCIENCE OF WHAT S POSSIBLE TM The Complexity of Glycosylation Glycosylation is the most common posttranslational
CS612 - Algorithms in Bioinformatics
Spring 2016 Protein Structure February 7, 2016 Introduction to Protein Structure A protein is a linear chain of organic molecular building blocks called amino acids. Introduction to Protein Structure Amine
Don t miss a thing on your peptide mapping journey How to get full coverage peptide maps using high resolution accurate mass spectrometry
Don t miss a thing on your peptide mapping journey How to get full coverage peptide maps using high resolution accurate mass spectrometry Kai Scheffler, PhD BioPharma Support Expert,LSMS Europe The world
MS/MS Scan Modes. Eötvös University, Budapest April 16, MS/MS Scan Modes. Árpád Somogyi. Product Ion Scan Select. Scan. Precursor Ion Scan Scan
MS/MS Modes Árpád Somogyi Eötvös University, Budapest April 16, 2012 MS/MS Modes Product Ion Precursor Ion Neutral Loss Δ ed Reaction Monitoring (SRM) 1 modes in a triple quadrupole (QqQ) (one quadrupole
Multiple-Choice Questions Answer ALL 20 multiple-choice questions on the Scantron Card in PENCIL
Multiple-Choice Questions Answer ALL 20 multiple-choice questions on the Scantron Card in PENCIL For Questions 1-10 choose ONE INCORRECT answer. 1. Which ONE of the following statements concerning the
Proteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000).
Lecture 2: Principles of Protein Structure: Amino Acids Why study proteins? Proteins underpin every aspect of biological activity and therefore are targets for drug design and medicinal therapy, and in
Application of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast
Application of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast Application note Food supplements Authors Juliusz Bianga and Joanna Szpunar
Oligosaccharide Analysis by High-Performance Anion- Exchange Chromatography with Pulsed Amperometric Detection
Oligosaccharide Analysis by High-Performance Anion- Exchange Chromatography with Pulsed Amperometric Detection Jeff Rohrer, Ph.D. Director, Applications Development, Dionex Products 1 The world leader
Factors impacting the SC bioavailability of therapeutic antibodies
Factors impacting the SC bioavailability of therapeutic antibodies How can we improve it? Saileta Prabhu 19 May 2014 SC bioavailability (%) of therapeutic antibodies in humans varies to a large extent
Bioinformation Volume 5
Do N-glycoproteins have preference for specific sequons? R Shyama Prasad Rao 1, 2, *, Bernd Wollenweber 1 1 Aarhus University, Department of Genetics and Biotechnology, Forsøgsvej 1, Slagelse 4200, Denmark;
Current Glycoprotein Analysis. Glycan Characterization: Oligosaccharides. Glycan Analysis: Sample Preparation. Glycan Analysis: Chromatography
Bio Day DENMARK MARCH 2013 Analysis of N-linked Glycans of GlycoProteins marleen_van_wingerden@waters.com Agenda Importance of Glycan Analysis Current Glycoprotein Analysis Glycan Characterization: Oligosaccharides
4th Multidimensional Chromatography Workshop Toronto (January, 2013) Herman C. Lam, Ph.D. Calibration & Validation Group
4th Multidimensional Chromatography Workshop Toronto (January, 2013) Herman C. Lam, Ph.D. Calibration & Validation Group MDLC for Shotgun Proteomics Introduction General concepts Advantages Challenges
2. Which of the following amino acids is most likely to be found on the outer surface of a properly folded protein?
Name: WHITE Student Number: Answer the following questions on the computer scoring sheet. 1 mark each 1. Which of the following amino acids would have the highest relative mobility R f in normal thin layer
This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is worth 2 points.
MBB 407/511 Molecular Biology and Biochemistry First Examination - October 1, 2002 Name Social Security Number This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is
Nature Methods: doi: /nmeth Supplementary Figure 1
Supplementary Figure 1 Subtiligase-catalyzed ligations with ubiquitin thioesters and 10-mer biotinylated peptides. (a) General scheme for ligations between ubiquitin thioesters and 10-mer, biotinylated
Application Note # ET-17 / MT-99 Characterization of the N-glycosylation Pattern of Antibodies by ESI - and MALDI mass spectrometry
Bruker Daltonics Application Note # ET-17 / MT-99 Characterization of the N-glycosylation Pattern of Antibodies by ESI - and MALDI mass spectrometry Abstract Analysis of the N-glycosylation pattern on
Thank you for joining us! Our session will begin shortly Waters Corporation 1
UPLC and HPLC Separation Strategies for Successful Characterization of Glycans Derived from Therapeutic Proteins Thank you for joining us! Our session will begin shortly 2013 Waters Corporation 1 Friendly
Enzymatic Removal of N- and O-glycans using PNGase F or the Protein Deglycosylation Mix
be INSPIRED drive DISCOVERY stay GENUINE APPLICATION NOTE Enzymatic Removal of N- and O-glycans using PNGase F or the Protein Deglycosylation Mix Alicia Bielik and Paula Magnelli, New England Biolabs,
Nature Biotechnology: doi: /nbt Supplementary Figure 1. RNAseq expression profiling of selected glycosyltransferase genes in CHO.
Supplementary Figure 1 RNAseq expression profiling of selected glycosyltransferase genes in CHO. RNAseq analysis was performed on two common CHO lines (CHO-K1, CHO-GS) and two independent CHO-GS triple
A computational framework for discovery of glycoproteomic biomarkers
A computational framework for discovery of glycoproteomic biomarkers Haixu Tang, Anoop Mayampurath, Chuan-Yih Yu Indiana University, Bloomington Yehia Mechref, Erwang Song Texas Tech University 1 Goal:
Application Note. Abstract. Author. Biotherapeutics & Biosimilars. Sonja Schneider Agilent Technologies, Inc. Waldbronn, Germany
Sensitive and Reproducible Glycan Analysis of Human Immunoglobulin G The Agilent 1260 Infi nity Bio-inert Quaternary LC System with an Agilent AdvanceBio 2.7 µm Glycan Mapping Column and Fluorescence Detection
Primary Structure Analysis. Automated Evaluation. LC-MS Data Sets
Primary Structure Analysis by Automated Evaluation of LC-MS Data Sets Mass Spec 29 Dr. Wozny, MassMap GmbH & Co. KG 1 LC-MS Peptide Mapping Origin of Signals Peptides with and without post-translational
MASS SPECTROMETRY BASED METABOLOMICS. Pavel Aronov. ABRF2010 Metabolomics Research Group March 21, 2010
MASS SPECTROMETRY BASED METABOLOMICS Pavel Aronov ABRF2010 Metabolomics Research Group March 21, 2010 Types of Experiments in Metabolomics targeted non targeted Number of analyzed metabolites is limited
SUPPLEMENTAL INFORMATION
SUPPLEMENTAL INFORMATION EXPERIMENTAL PROCEDURES Tryptic digestion protection experiments - PCSK9 with Ab-3D5 (1:1 molar ratio) in 50 mm Tris, ph 8.0, 150 mm NaCl was incubated overnight at 4 o C. The
PROTEINS. Building blocks, structure and function. Aim: You will have a clear picture of protein construction and their general properties
PROTEINS Building blocks, structure and function Aim: You will have a clear picture of protein construction and their general properties Reading materials: Compendium in Biochemistry, page 13-49. Microbiology,
Molecular Biology. general transfer: occurs normally in cells. special transfer: occurs only in the laboratory in specific conditions.
Chapter 9: Proteins Molecular Biology replication general transfer: occurs normally in cells transcription special transfer: occurs only in the laboratory in specific conditions translation unknown transfer:
Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g.
Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g., casein more interestingly, in most other cases, it is a transient
SUPPORTING INFORMATION FOR. A Computational Approach to Enzyme Design: Using Docking and MM- GBSA Scoring
SUPPRTING INFRMATIN FR A Computational Approach to Enzyme Design: Predicting ω- Aminotransferase Catalytic Activity Using Docking and MM- GBSA Scoring Sarah Sirin, 1 Rajesh Kumar, 2 Carlos Martinez, 2
Glycosylation analysis of blood plasma proteins
Glycosylation analysis of blood plasma proteins Thesis booklet Eszter Tóth Doctoral School of Pharmaceutical Sciences Semmelweis University Supervisor: Károly Vékey DSc Official reviewers: Borbála Dalmadiné
Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis
Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis Ying Qing Yu Waters Corporation, Milford, MA, USA APPLICATION BENEFITS
Use of Derivatization for LC- MS/MS Analysis in the Clinical Lab
Use of Derivatization for LC- MS/MS Analysis in the Clinical Lab Asian Pacific Conference on Chromatography & Mass Spectrometry 2010 15 January 2010 Alan L. Rockwood and Mark M. Kushnir ARUP Laboratories,
Lecture 3. Tandem MS & Protein Sequencing
Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:
Detergent solubilised 5 TMD binds pregnanolone at the Q245 neurosteroid potentiation site.
Supplementary Figure 1 Detergent solubilised 5 TMD binds pregnanolone at the Q245 neurosteroid potentiation site. (a) Gel filtration profiles of purified 5 TMD samples at 100 nm, heated beforehand for
Glycosidic bond cleavage
Glycosidases and Glycosyltransferases Introduction to Inverting/Retaining Mechanisms Inhibitor design Chemical Reaction Proposed catalytic mechanisms Multiple slides courtesy of Harry Gilbert with Wells
1-To know what is protein 2-To identify Types of protein 3- To Know amino acids 4- To be differentiate between essential and nonessential amino acids
Amino acids 1-To know what is protein 2-To identify Types of protein 3- To Know amino acids 4- To be differentiate between essential and nonessential amino acids 5-To understand amino acids synthesis Amino
A Novel HILIC Column for High Speed N-linked Glycan Analysis
A Novel HILIC for High Speed N-linked Glycan Analysis Application Note Biotherapeutics and Biosimilars Authors James Martosella, Oscar Potter, Danny Mancheno, and Jia Liu Agilent Technologies, Inc. Introduction
Complex Carbohydrate Society '89. Poster Presentation
4 r? Essentials in " Complex Carbohydrate Society '89 Poster Presentation Characterization of Glycoproteins by HPLC -- Peptide Mapping and Analysis of Site Specific Glycosylation G. Vella, C. Phoebe, N.
Structural Characterization of Prion-like Conformational Changes of the Neuronal Isoform of Aplysia CPEB
Structural Characterization of Prion-like Conformational Changes of the Neuronal Isoform of Aplysia CPEB Bindu L. Raveendra, 1,5 Ansgar B. Siemer, 2,6 Sathyanarayanan V. Puthanveettil, 1,3,7 Wayne A. Hendrickson,
Analysis of Glycopeptides Using Porous Graphite Chromatography and LTQ Orbitrap XL ETD Hybrid MS
Analysis of Glycopeptides Using Porous Graphite Chromatography and LTQ Orbitrap XL ETD Hybrid MS Terry Zhang, Rosa Viner, Zhiqi Hao, Vlad Zabrouskov, Thermo Fisher Scientific, San Jose, CA, USA Introduction
Supplementary Materials for
advances.sciencemag.org/cgi/content/full/2/1/e1500678/dc1 Supplementary Materials for Chemical synthesis of erythropoietin glycoforms for insights into the relationship between glycosylation pattern and
Isomer Separation of Positively Labeled N-glycans by CE-ESI-MS
Isomer Separation of Positively Labeled N-glycans by CE-ESI-MS G.S.M. Kammeijer Center for Proteomics and Metabolomics CE IN THE BIOTECHNOLOGY & PHARMACEUTICAL INDUSTRIES 19 TH SYMPOSIUM ON THE PRACTICAL
Thank you for joining us! Our Webinar will begin shortly.
Complementary HILIC Techniques for the Successful Characterization of Therapeutic Protein Glycosylation Thank you for joining us! Our Webinar will begin shortly. While you are waiting, please feel free
3.2 Ligand-Binding at Nicotinic Acid Receptor Subtypes GPR109A/B
3.2 Ligand-Binding at Nicotinic Acid Receptor Subtypes GPR109A/B 3.2.1 Characterization of the Ligand Binding Site at GPR109A Receptor Ligands of GPR109A Receptor are Carboxylic Acids Nicotinic acid (pyridine-3-carboxylic
Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information
Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt
Bringing Glycan Analysis to a New Age of Enlightenment
Bringing Glycan Analysis to a New Age of Enlightenment A discussion of disruptive LCMS technologies and workflows for released glycan and glycoprotein analysis. 2015 Waters Corporation 1 RapiFluor-MS:
Protein Reports CPTAC Common Data Analysis Pipeline (CDAP)
Protein Reports CPTAC Common Data Analysis Pipeline (CDAP) v. 05/03/2016 Summary The purpose of this document is to describe the protein reports generated as part of the CPTAC Common Data Analysis Pipeline
Simple modification of a protein database for mass spectral identification of N-linked glycopeptides
RAPID COMMUNICATIONS IN MASS SPECTROMETRY Rapid Commun. Mass Spectrom. 2005; 19: 3002 3006 Published online in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/rcm.2162 Simple modification
High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column
High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column Application Note BioPharma Authors James Martosella, Phu Duong, and Alex Zhu Agilent Technologies, Inc. Abstract
Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS
Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS Jenny Chen, Hongxia Wang, Zhiqi Hao, Patrick Bennett, and Greg Kilby Thermo Fisher
One Gene, Many Proteins. Applications of Mass Spectrometry to Proteomics. Why Proteomics? Raghothama Chaerkady, Ph.D.
Applications of Mass Spectrometry to Proteomics Raghothama Chaerkady, Ph.D. McKusick-Nathans Institute of Genetic Medicine and the Department of Biological Chemistry Why Proteomics? One Gene, Many Proteins
Identification of Haemoglobinopathies by LC/MS
Identification of Haemoglobinopathies by LC/ Mark Harrison; Senior Scientist, ThermoFisher Scientific Sarah Battle; Senior Biomedical Scientist, Royal Hallamshire Hospital Introduction There are over 2
Oligosaccharide Profiling of O-linked Oligosaccharides Labeled with 2 Aminobenzoic Acid (2-AA)
Oligosaccharide Profiling of O-linked Oligosaccharides Labeled with 2 Aminobenzoic Acid (2-AA) Elisabeth A. Kast and Elizabeth A. Higgins GlycoSolutions Corporation, Worcester, MA Data originally presented
Proteins? Protein function. Protein folding. Protein folding diseases. Protein interactions. Macromolecular assemblies. The end product of Genes
Proteins? Protein function Protein folding Protein folding diseases Protein interactions Macromolecular assemblies The end product of Genes Protein Unfolding DOD Acid Catalysis DOD HDOD + N H N D C N C
Ludger Guide to Sialylation: II. Highly Sialylated Glycoproteins
Ludger Guide to Sialylation: II Highly Sialylated Glycoproteins Ludger has over 15 years experience providing products and services for the biopharmaceutical industry and in that time we have noticed that
The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold
The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold Anthony C.G. Dossang * 1, Precious G. Motshwene * 1, Yang Yang* 1, Martyn F. Symmons*, Clare E.
Biomolecules: amino acids
Biomolecules: amino acids Amino acids Amino acids are the building blocks of proteins They are also part of hormones, neurotransmitters and metabolic intermediates There are 20 different amino acids in
Crystal structure of the neutralizing antibody HK20 in complex with its gp41 antigen
Crystal structure of the neutralizing antibody HK20 in complex with its gp41 antigen David Lutje Hulsik Unit for Virus Host Cell Interaction UMI 3265 University Joseph Fourier-EMBL-CNRS, Grenoble Env catalyzed
Learning Objectives. Overview of topics to be discussed 10/25/2013 HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS
HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS A clinical proteomics perspective Michael L. Merchant, PhD School of Medicine, University of Louisville Louisville, KY Learning Objectives
N-Glycosidase F Deglycosylation Kit
For life science research only. Not for use in diagnostic procedures. FOR IN VITRO USE ONLY. N-Glycosidase F Deglycosylation Kit Kit for the deglycosylation of asparagine-linked glycan chains on glycoproteins.
Amino acids-incorporated nanoflowers with an
Amino acids-incorporated nanoflowers with an intrinsic peroxidase-like activity Zhuo-Fu Wu 1,2,+, Zhi Wang 1,+, Ye Zhang 3, Ya-Li Ma 3, Cheng-Yan He 4, Heng Li 1, Lei Chen 1, Qi-Sheng Huo 3, Lei Wang 1,*
Significance and Functions of Carbohydrates. Bacterial Cell Walls
Biochemistry 462a - Carbohydrate Function Reading - Chapter 9 Practice problems - Chapter 9: 2, 4a, 4b, 6, 9, 10, 13, 14, 15, 16a, 17; Carbohydrate extra problems Significance and Functions of Carbohydrates
Pr oducts List Ludger Ltd Culham Science Centre Oxford OX14 3EB United Kingdom
Pr oducts List 2018 Ludger Ltd Culham Science Centre Oxford OX14 3EB United Kingdom Email: lily.wang@ludger.com cindy.li@ludger.com www.ludger.com www.ludgersh.com Enzymes for Glycan Release E-PNG01 PNGase
Chemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins
Chemical Nature of the Amino Acids All peptides and polypeptides are polymers of alpha-amino acids. There are 20 a- amino acids that are relevant to the make-up of mammalian proteins (see below). Several
Study of On-Resin Convergent Synthesis of N-Linked. Glycopeptides Containing a Large High Mannose N- Linked Oligosaccharide
Supporting Information Study of On-Resin Convergent Synthesis of N-Linked Glycopeptides Containing a Large High Mannose N- Linked Oligosaccharide Rui Chen and Thomas J. Tolbert* Department of Chemistry,
Defining HbA1c: the indispensable decision to approach measurement standardization
Defining HbA1c: the indispensable decision to approach measurement standardization Jan-Olof Jeppsson IFCC WG for HbA1c standardization Clinical Chemistry, Malmö University Hospital Sweden 6 November, 2007
Introduction. Methods RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES. TCW Poon *, HLY Chan, HWC Leung, A Lo, RHY Lau, AY Hui, JJY Sung
RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES Liver specific glycoforms of serum proteins in chronic hepatitis B infection: identification by lectin affinity chromatography and quantitative proteomic
REDOX PROTEOMICS. Roman Zubarev.
REDOX PROTEOMICS Roman Zubarev Roman.Zubarev@ki.se Physiological Chemistry I, Department for Medical Biochemistry & Biophysics, Karolinska Institutet, Stockholm What is (RedOx) Proteomics? Proteomics -
HCV infects over 170 million people worldwide.
Mass Spectrometric Characterization of Glycosylation of Hepatitis C Virus E2 Envelope Glycoprotein Reveals Extended Microheterogeneity of N-Glycans Roxana E. Iacob, a Irina Perdivara, a,b Michael Przybylski,
Supporting Information for MassyTools-assisted data analysis of total serum N-glycome changes associated with pregnancy
Supporting Information for MassyTools-assisted data analysis of total serum N-glycome changes associated with pregnancy Bas C. Jansen 1, Albert Bondt 1,2, Karli R. Reiding 1, Coen J. de Jong 1, David Falck
Chapter 3: Amino Acids and Peptides
Chapter 3: Amino Acids and Peptides BINF 6101/8101, Spring 2018 Outline 1. Overall amino acid structure 2. Amino acid stereochemistry 3. Amino acid sidechain structure & classification 4. Non-standard
Glycoproteins and N-glycans from exosomes
Glycoproteins and N-glycans from exosomes Júlia Costa Laboratory of Glycobiology WP3: Exosome specific glycosignatures defining specificity in exosomes targeting GlioEx University Medical Center Hamburg