A. B. C. D. E. F. G. H. I. J. K. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Asn. Asn. Asn. Asn. Asn. Asn
|
|
- Edgar Gilbert
- 5 years ago
- Views:
Transcription
1 A. B. C. D. E. F. "3 "3!4!3 Ser/Thr "3!4!3!4 Asn Asn Ser/Thr Asn!3!6 Ser/Thr G. H. I. J. K.!3 Ser/Thr Ser/Thr Asn Asn Asn
2 Glycosidases and Glycosyltransferases Introduction to Inverting/Retaining Mechanisms Inhibitor design Chemical Reaction Proposed catalytic mechanisms Multiple slides courtesy of Harry Gilbert with Wells modifications
3 Glycosidic bond cleavage Glycone Aglycone H 2 H H Classic example is lysozyme: cleaves N-acetlymuramic acid-β-4-glcnac Discovered by Alexander Fleming in 1920s Sneezed onto his bacterial agar plate Bacteria found to be lysed next day Potential antimicrobial enzyme He discovered a better antimicrobial agent later; what is it?
4 Glycosidic bond cleavage in free solution Glycone Aglycone H 2 H H + H H H H H H H H H Transition state oxocarbenium ion attacked by hydroxyl ion + H H H H H - H H H H H H
5 Rate of glycosidic bond cleavage The transition state (positively charged oxocarbenium ion) is a very high energy molecule Geometry changes from chair to half-chair Why? So C1 and ring oxygen are in same plane So positive charge is not just at C1 but shared between C1 and ring oxygen This stabilises positive charge. Need lots of energy to cause change in geometry of sugar 5 C1
6 Two different mechanisms of acid-base assisted catalysis Single displacement mechanism Inversion of the anomeric configuration of glycone sugar β-glycosidic bond Bond is equatorial sugar H is axial
7 Two different mechanisms of acid-base assisted catalysis Double displacement mechanism Retention of the anomeric configuration of glycone sugar β-glycosidic bond Bond is equatorial H remains equatorial
8 Two different mechanisms of acid-base assisted catalysis How does an enzyme generate protons and hydroxyl ions? Two amino acids with carboxylic acid side-chains Glutamate or aspartate Two mechanisms are as follows:
9 Acid-base assisted single displacement mechanism Catalytic acid Catalytic base The acid catalyst Uncharged Hydrogen in the perfect position to be donated to the glycosidic oxygen. The catalytic base Extracts a proton from water Hydroxyl ion in the perfect position to attack C1 of the transition state
10 Acid-base assisted double displacement mechanism Catalytic acid-base Catalytic nucleophile Two distinct reactions Glycosylation Formation of a covalent glycosyl-enzyme intermediate (ester bond) The aglycone sugar released from active site Deglycosylation The ester bond between the glycone sugar and the enzyme is hydrolysed and the glycone sugar is released from the active site
11 Hen egg white lysozyme The first enzyme structure solved The textbook example of enzyme catalyzed glycoside hydrolysis Hydrolyses the glycosidic bond via a retaining mechanism
12 And the lysozyme mechanism is revisited: Covalent enzyme intermediate for hen egg white lysozyme H H H AcHN H H F Lysozyme HEWL (E35Q) relative intensity (E) m/z (E-I) min min 50 min 33 min 17 min 150 min 120 min 90 min Asp52 intensity Relative Intensity Vocadlo et al. Nature 412, Da 15000
13 Inhibitors of glycoside hydrolases Glycoside hydrolase activities contribute to significant diseases Flu Type II diabetes Possibly Cancer and Aids To combat diseases need to develop inhibitors
14 Designing glycoside hydrolase inhibitors What comprises a good inhibitor? Mechanistic covalent inhibitors not used Very high affinity non-covalent competitive inhibitors Transition state inhibitors
15 The retaining mechanism H H H H R H H H δ - δ + R δ + H δ - glycosylation Transition state has a positive charged nature as leaving group departure precedes nucleophile attack H H H H H H H H H H H δ - δ + H H H δ + H δ - deglycosylation
16 TS-based inhibitors that mimic charge distribution deoxynojirimycin H Glucosidase Inhibitors isofagamine H H H H NH 2 Both have nm K i values. Affinities are about one million times higher than substrate Why are they transition state mimics? H H NH 2 + Contains a positive charge
17 Mimicking the half-chair Insert a double-bond to enforce planarity
18 Drugs that mainly mimic the half chair All picomolar affinities fold tighter binders than substrates HIV drug: prevents glycosylation in mammalian cells AIDs virus surface proteins are not glycosylated and thus can t evade the immune system Type II diabetes (inhibits human Amylase) H H H H CH 3 HN H H H Acarbose Miglitol H H H H H H N H H H H H H H H AcNH AcNH HN NH NH 2 NH 2 C 2 H Relenza C 2 H Tamiflu Anti-flu drugs
19 Glycosylation reactions Essentials of Glycobiology Second Edition Chapter 5, Figure 1
20 Two folds Both have two Rossman domains GTA strongly linked may look like a single β- sheet GT-B has two separate domains Requirement of nucleotide binding appears to limit number of folds greatly
21 Inverting GT Retaining GT
22 How can we identify the catalytic amino acids Glycoside hydrolases and transferases are grouped in enzyme families based on sequence similarity (i.e. evolved from a common ancestor. Currently 100+ families All members of same family have Evolved from the same progenitor sequence Conserved mechanism Same fold Conserved catalytic apparatus
23 CAZY (for hydrolases and transferases) Several families have ancient ancestral relationship Same fold, mechanism and catalytic residues How does CAZY help us? Tells us what the catalytic residues are Tells us the mechanism Tells us the likely substrate specificity
24 Annual Reviews
25 Catalytic acid Sequence 1:73 QNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSAN 1 UNIPRT:XYNA_PSEFL 1:73 335:407 QNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSAN 2 UNIPRT:Q9AJR9 1:68 111:178 RHNQQVRGHNLCWHE--ELPTwaSEVngNAKEILIQHIQTVAGRYAGRIQSWDVVNEAILPKDGRPDG UNIPRT:GUX_CELFI 3:66 115:176 --GKELYGHTLVWHS--QLPDWAKNLNGsfESAMVNHVTKVADHFEGKVASWDVVNEAFADG-DGP UNIPRT:Q :61 116:173 --GKELYGHTLVWHS--QLPDWAKNLNGsfESAMVNHVTKVADHFEGKVASWDVVNEAFAD UNIPRT:Q :63 324:391 ENNMTVHGHALVWHSDYQVPnwAGSAE-DFLAALDTHITTIVDHYegNLVSWDVVNEAIDDNS UNIPRT:Q :63 343:409 -NNINVHGHALVWHSDYQVPNFmsGSAADFIAEVEDHVTQVVTHFkgNVVSWDVVNEAINDGS UNIPRT:Q :73 111:180 QNGKQVRGHTLAWHS--QQPGWMQssGSSLRQAMIDHINGVMAHYKGKIVQWDVVNEAFADG--NSGGRRDSN 8 UNIPRT:Q7SI98 1:73 73:142 QNGKQVRGHTLAWHS--QQPGWMQssGSTLRQAMIDHINGVMGHYKGKIAQWDVVNEAFSD--DGSGGRRDSN 9 UNIPRT:XYNB_THENE 1:62 96:158 KNDMIVHGHTLVWHN--QLPGWLTgsKEELLNILEDHVKTVVSHFRGRVKIWDVVNEAVSDS UNIPRT:Q :62 96:158 KNDMIVHGHTLVWHN--QLPGWLTgsKEELLNILEDHVKTVVSHFRGRVKIWDVVNEAVSDS UNIPRT:AAN :62 96:158 KNDMIVHGHTLVWHN--QLPGWLTgsKEELLNILEDHVKTVVSHFRGRVKIWDVVNEAVSDS UNIPRT:Q7TM36 8:68 2: GHTVVWHGA--VPTWLNasTDDFRAAFENHIRTVADHFRGKVLAWDVVNEAV---ADDGSG UNIPRT:Q7WVV0 1:62 96:158 ENDMIVHGHTLVWHN--QLPGWITgtKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDS UNIPRT:Q7WUM6 1:62 96:158 ENDMIVHGHTLVWHN--QLPGWITgtKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDS UNIPRT:Q9WXS5 1:62 96:158 ENDMIVHGHTLVWHN--QLPGWITgtKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDS UNIPRT:Q9P973 1:57 120:176 QNGKSIRGHTLIWHS--QLPAWVNnnNAdlRQVIRTHVSTVVGRYKGKIRAWDVVNE UNIPRT:Q9X584 1:63 115:176 QNGKQVRGHTLAWHS--QQPGWMQssGSALRQAMIDHINGVMAHYKGKIAQWDVVNEAFADGS UNIPRT:XYNA_STRLI 1:63 114:175 QNGKQVRGHTLAWHS--QQPGWMQssGSALRQAMIDHINGVMAHYKGKIVQWDVVNEAFADGS UNIPRT:Q8CJQ1 1:63 114:175 QNGKQVRGHTLAWHS--QQPGWMQssGSALRQAMIDHINGVMAHYKGKIVQWDVVNEAFADGS UNIPRT:P :62 93:155 QNGQGLRCHTLIWYS--QLPGWVSSGNWN-RQTLEahIDNVMGHYKGQCYAWDVVNEAVDDN UNIPRT:Q9XDV5 3:71 427:505 --GMKVHGHTLVWHQ--QTPAWMndSGGNirEemRNHIRTVIEHFGDKVISWDVVNEAMSDNPSNpdWRGS-- 22 UNIPRT:Q8GJ37 3:71 427:505 --GMKVHGHTLVWHQ--QTPAWMndSGGNirEemRNHIRTVIEHFGDKVISWDVVNEAMSDNPSNpdWRGS-- 23 UNIPRT:Q7X2C9 1:63 27:88 QNGKQVRGHTLAWHS--QQPGWMQssGSSLRQAMIDHINGVMNHSKGKIAQWDVVNEAFADGS UNIPRT:Q9RJ91 3:61 105:162 --GMDVRGHTLVWHS--QLPSWVSPLGadLRTAMNAHINGLMGHYKGEIHSWDVVNEAFQD UNIPRT:Q :61 119:176 --GMKVRGHTLVWHS--QLPGWVSPLAadLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQD UNIPRT:Q9RMM5 1:61 113:172 QNGKEVRGHTLAWHS--QQPYWMQssGSDLRQAMIDHINGVMNHYKGKIAQWDVVNEAFED UNIPRT:BAD :61 113:172 QNGKEVRGHTLAWHS--QQPYWMQssGSDLRQAMIDHINGVMNHYKGKIAQWDVVNEAFED
26 Glycan-modifying enzymes Essentials of Glycobiology Second Edition Chapter 5, Figure 2
27 Take Home Points CAZY Inverting/Retaining Mechanisms Mechanistic Based Inhibitors
28 References Cantarel et al (2008) Nucleic Acid Res 37:D233-8 (CAZY) Vocadlo at al. (2001) Nature 412: (Mechanistic inhibitors of glycoside hydrolases) Lairson et al. (2008) Ann. Rev. Biochem. 77: (glycosyltransferases) Rye and Withers (2000) Curr. pin. Chem. Biol. 4: (glycoside hydrolases) Tailford (2008) Nature Chem. Biol. Nat. 4: (Transition state geometry)
Glycosidic bond cleavage
Glycosidases and Glycosyltransferases Introduction to Inverting/Retaining Mechanisms Inhibitor design Chemical Reaction Proposed catalytic mechanisms Multiple slides courtesy of Harry Gilbert with Wells
More informationFinding the Sweet Spot- Mechanism Guided Design of Glycosidase Inhibitors. Jahnabi Roy CHEM 575 Seminar 11/01/12
Finding the Sweet Spot- Mechanism Guided Design of Glycosidase Inhibitors Jahnabi Roy CHEM 575 Seminar 11/01/12 Glycans and Glycosyl Hydrolases http://cellbiology.med.unsw.edu.au/units/science/lecture0803.htm
More informationMechanisms of Enzymes
Mechanisms of Enzymes Presented by Dr. Mohammad Saadeh The requirements for the Pharmaceutical Biochemistry I Philadelphia University Faculty of pharmacy How enzymes work * Chemical reactions have an energy
More informationBio 100 Serine Proteases 9/26/11
Assigned Reading: 4th ed. 6.4.1 The Chymotrypsin Mechanism Involves Acylation And Deacylation Of A Ser Residue p. 213 BOX 20-1 Penicillin and β-lactamase p. 779 6.5.7 Some Enzymes Are Regulated By Proteolytic
More informationChymotrypsin Lecture. Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin
Chymotrypsin Lecture Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin What s so great about enzymes? They accomplish large rate accelerations (10 10-10
More informationPAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin
Subject Paper No and Title 16 Bio-organic and Biophysical Module No and Title 22 Mechanism of Enzyme Catalyzed reactions I Module Tag CHE_P16_M22 Chymotrypsin TABLE OF CONTENTS 1. Learning outcomes 2.
More informationPrevious Class. Today. Term test I discussions. Detection of enzymatic intermediates: chymotrypsin mechanism
Term test I discussions Previous Class Today Detection of enzymatic intermediates: chymotrypsin mechanism Mechanistic Understanding of Enzymemediated Reactions Ultimate goals: Identification of the intermediates,
More informationPrevious Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties
Previous Class Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism Today Protein Kinase Catalytic Properties Protein Phosphorylation Phosphorylation: key protein modification
More informationEnzyme Catalysis-Serine Proteases
Enzyme Catalysis-Serine Proteases Concepts to be learned Activation Energy Transition State Example: Proteases Requirements for proteolysis Families of proteases Protein Folds used by proteases for catalysis
More informationProtein Modification Overview DEFINITION The modification of selected residues in a protein and not as a component of synthesis
Lecture Four: Protein Modification & Cleavage [Based on Chapters 2, 9, 10 & 11 Berg, Tymoczko & Stryer] (Figures in red are for the 7th Edition) (Figures in Blue are for the 8th Edition) Protein Modification
More informationCHM 341 C: Biochemistry I. Test 2: October 24, 2014
CHM 341 C: Biochemistry I Test 2: ctober 24, 2014 This test consists of 14 questions worth points. Make sure that you read the entire question and answer each question clearly and completely. To receive
More informationChemical Mechanism of Enzymes
Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.
More informationCHAPTER 9: CATALYTIC STRATEGIES. Chess vs Enzymes King vs Substrate
CHAPTER 9: CATALYTIC STRATEGIES Chess vs Enzymes King vs Substrate INTRODUCTION CHAPTER 9 What are the sources of the catalytic power and specificity of enzymes? Problems in reactions in cells Neutral
More informationChapter 23 Enzymes 1
Chapter 23 Enzymes 1 Enzymes Ribbon diagram of cytochrome c oxidase, the enzyme that directly uses oxygen during respiration. 2 Enzyme Catalysis Enzyme: A biological catalyst. With the exception of some
More informationUNIVERSITY OF GUELPH CHEM 4540 ENZYMOLOGY Winter 2005 Quiz #2: March 24, 2005, 11:30 12:50 Instructor: Prof R. Merrill ANSWERS
UNIVERSITY F GUELPH CHEM 4540 ENZYMLGY Winter 2005 Quiz #2: March 24, 2005, 11:30 12:50 Instructor: Prof R. Merrill ANSWERS Instructions: Time allowed = 80 minutes. Total marks = 30. This quiz represents
More information6. The catalytic mechanism of arylsulfatase A and its theoretical investigation
6. The catalytic mechanism of arylsulfatase A and its theoretical investigation When the crystal structure of arylsulfatase A was solved, a remarkable structural analogy to another hydrolytic enzyme, the
More informationPART IV THE CATALYTIC FUNCTION
PAT IV TE ATALYTI FUNTIN INTDUTIN The life of a cell, of an organism, depends on the multiplicity of the diverse chemical reactions which constitute metabolism. These reactions are carried out with appreciable
More informationMITOCW watch?v=922oig1hwg8
MITOCW watch?v=922oig1hwg8 The following content is provided under a Creative Commons license. Your support will help MIT OpenCourseWare continue to offer high quality educational resources for free. To
More informationFrom Structure to Function (II): Enzyme Structure & Catalysis
BCHS 6229 Protein Structure and Function Lecture 5 (Oct 25, 2011) From Structure to Function (II): Enzyme Structure & Catalysis 1 Outline Catalysis: Overview Active site geometry Proximity and ground-state
More informationBiochemistry: A Short Course
Tymoczko Berg Stryer Biochemistry: A Short Course Second Edition CHAPTER 10 Carbohydrates 2013 W. H. Freeman and Company Chapter 10 Outline Monosaccharides are aldehydes or ketones that contain two or
More informationNotes 11/2. Heather Graehl
Lecture Page 1 Notes 11/2 Friday, November 02, 2007 9:56 AM Heather Graehl Notes 1112 Audio recording started: 10:02 AM Friday, November 02, 2007 Slide 1: Enzymes: Serine Proteases (Nov 7th Midterm will
More information189,311, , ,561, ,639, ,679, Ch13; , Carbohydrates
Lecture 31 (12/8/17) Reading: Ch7; 258-267 Ch10; 371-373 Problems: Ch7 (text); 26,27,28 Ch7 (study-guide: applying); 2,5 Ch7 (study-guide: facts); 6 NEXT (LAST!) Reading: Chs4,6,8,10,14,16,17,18; 128-129,
More informationMITOCW watch?v=xms9dyhqhi0
MITOCW watch?v=xms9dyhqhi0 The following content is provided under a Creative Commons license. Your support will help MIT OpenCourseWare continue to offer high-quality, educational resources for free.
More informationChapter 11. Learning objectives: Structure and function of monosaccharides, polysaccharide, glycoproteins lectins.
Chapter 11 Learning objectives: Structure and function of monosaccharides, polysaccharide, glycoproteins lectins. Carbohydrates Fuels Structural components Coating of cells Part of extracellular matrix
More informationLecture 18 (10/27/17) Lecture 18 (10/27/17)
Reading: Ch6; 225-232 Lecture 18 (10/27/17) Problems: Ch5 (text); 2 Ch6 (study guide-facts); 5, 6, 7, 14 NEXT Reading: Ch5; 164, 166-169 Problems: none Remember Monday at 6:30 in PHO-206 is the first MB
More informationCHEM121. Unit 6: Enzymes. Lecture 10. At the end of the lecture, students should be able to:
CHEM121 Unit 6: Enzymes Lecture 10 At the end of the lecture, students should be able to: Define the term enzyme Name and classify enzymes according to the: type of reaction catalyzed type of specificity
More information1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: =3x10-5 = 30μM
1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: k 1 = 2 x 10 8 M -1 s -1, k 2 = 1 x 10 3 s -1, k 3 = 5 x 10 3 s -1 a) What
More informationSix Types of Enzyme Catalysts
Six Types of Enzyme Catalysts Although a huge number of reactions occur in living systems, these reactions fall into only half a dozen types. The reactions are: 1. Oxidation and reduction. Enzymes that
More informationEnzyme Catalytic Mechanisms. Dr. Kevin Ahern
Enzyme Catalytic Mechanisms Dr. Kevin Ahern Cleave Peptide Bonds Specificity of Cutting Common Active Site Composition/Structure Mechanistically Well Studied Chymotrypsin Chymotrypsin Catalysis H2O Chymotrypsin
More informationIntroduction to Enzymology
Introduction to Enzymology Functional Properties Nomenclature Enzyme specificity Enzyme regulation Introduction to Enzymology Enzymes - Biological catalysts By definition a Catalyst : - Accelerates the
More informationMahaAbuAjamieh. BahaaNajjar. MamoonAhram
7 MahaAbuAjamieh BahaaNajjar MamoonAhram Carbohydrates (saccharides) can be classified into these main categories: 1. Monosaccharides, they are simplesugars (the simplest units), such as glucose, galactose
More informationEnzymes. Enzyme. Aim: understanding the basic concepts of enzyme catalysis and enzyme kinetics
Enzymes Substrate Enzyme Product Aim: understanding the basic concepts of enzyme catalysis and enzyme kinetics Enzymes are efficient Enzyme Reaction Uncatalysed (k uncat s -1 ) Catalysed (k cat s -1 )
More informationFor questions 1-4, match the carbohydrate with its size/functional group name:
Chemistry 11 Fall 2013 Examination #5 PRACTICE 1 ANSWERS For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the
More informationCatalysis & specificity: Proteins at work
Catalysis & specificity: Proteins at work Introduction Having spent some time looking at the elements of structure of proteins and DNA, as well as their ability to form intermolecular interactions, it
More informationAmino acids. (Foundation Block) Dr. Essa Sabi
Amino acids (Foundation Block) Dr. Essa Sabi Learning outcomes What are the amino acids? General structure. Classification of amino acids. Optical properties. Amino acid configuration. Non-standard amino
More informationCHEM 160A Final Exam. 1. (5 points) What factors influence an enzyme s substrate specificity?
CHEM 160A Final Exam December 17, 2004 Name (1 point) 1. (5 points) What factors influence an enzyme s substrate specificity? 2. (4 points) Why are cofactors required for some enzymatic reactions? 3. (5
More informationPeptide hydrolysis uncatalyzed half-life = ~450 years HIV protease-catalyzed half-life = ~3 seconds
Uncatalyzed half-life Peptide hydrolysis uncatalyzed half-life = ~450 years IV protease-catalyzed half-life = ~3 seconds Life Sciences 1a Lecture Slides Set 9 Fall 2006-2007 Prof. David R. Liu In the absence
More informationChapter 11: Enzyme Catalysis
Chapter 11: Enzyme Catalysis Matching A) high B) deprotonated C) protonated D) least resistance E) motion F) rate-determining G) leaving group H) short peptides I) amino acid J) low K) coenzymes L) concerted
More information2. Which of the following is NOT true about carbohydrates
Chemistry 11 Fall 2011 Examination #5 For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the free response questions
More informationThe MOLECULES of LIFE
The MOLECULES of LIFE Physical and Chemical Principles Solutions Manual Prepared by James Fraser and Samuel Leachman Chapter 16 Principles of Enzyme Catalysis Problems True/False and Multiple Choice 1.
More information2. Which of the following amino acids is most likely to be found on the outer surface of a properly folded protein?
Name: WHITE Student Number: Answer the following questions on the computer scoring sheet. 1 mark each 1. Which of the following amino acids would have the highest relative mobility R f in normal thin layer
More informationFor questions 1-4, match the carbohydrate with its size/functional group name:
Chemistry 11 Fall 2009 Examination #5 ANSWER KEY For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the free response
More informationFor questions 1-4, match the carbohydrate with its size/functional group name:
Chemistry 11 Fall 2013 Examination #5 PRACTICE 1 For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the free response
More informationChapter 20 Carbohydrates Chapter 20
Chapter 20 Carbohydrates Chapter 20 1 Carbohydrates Carbohydrate: A polyhydroxyaldehyde or polyhydroxyketone, or a substance that gives these compounds on hydrolysis. Monosaccharide: A carbohydrate that
More informationTopic 4 - #2 Carbohydrates Topic 2
Topic 4 - #2 Carbohydrates Topic 2 Biologically Important Monosaccharide Derivatives There are a large number of monosaccharide derivatives. A variety of chemical and enzymatic reactions produce these
More informationEnzymes: The Catalysts of Life
Chapter 6 Enzymes: The Catalysts of Life Lectures by Kathleen Fitzpatrick Simon Fraser University Activation Energy and the Metastable State Many thermodynamically feasible reactions in a cell that could
More informationCHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith
CHAPTER 21: Amino Acids, Proteins, & Enzymes General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, Enzymes Learning Objectives: q The 20 common, naturally occurring
More informationLecture 34. Carbohydrate Metabolism 2. Glycogen. Key Concepts. Biochemistry and regulation of glycogen degradation
Lecture 34 Carbohydrate Metabolism 2 Glycogen Key Concepts Overview of Glycogen Metabolism Biochemistry and regulation of glycogen degradation Biochemistry and regulation of glycogen synthesis What mechanisms
More informationChem Lecture 5 Catalytic Strategies Part 3
Chem 52 - Lecture 5 Catalytic Strategies Part 3 Question of the Day: Transition states in enzyme catalyzed reactions are usually very unstable and therefore hard to observe. What was the trick used by
More informationEnzymes. Enzyme Structure. How do enzymes work?
Page 1 of 6 Enzymes Enzymes are biological catalysts. There are about 40,000 different enzymes in human cells, each controlling a different chemical reaction. They increase the rate of reactions by a factor
More informationChemistry 135, First Exam. September 23, Chem 135, Exam 1 SID:
Chemistry 135, First Exam September 23, 2015 This exam will be worth 15% of your overall grade. Please read all instructions/questions carefully and provide answers in the space provided. There should
More informationFigure 1. A ribbon diagram of the aldolase (A) and a close up of the active site (B) including the bound substrate.
Problem Set 4 (C-C bond formation, phosphoryl transfer reactions and the role of ATP) 1. Chemists can use the same strategies as nature to make new carbon-carbon bonds stereospecifically using enzymes
More informationBIOB111 - Tutorial activity for Session 14
BIOB111 - Tutorial activity for Session 14 General topics for week 7 Session 14 Amino acids and proteins Students review the concepts learnt and answer the selected questions from the textbook. General
More informationShort polymer. Dehydration removes a water molecule, forming a new bond. Longer polymer (a) Dehydration reaction in the synthesis of a polymer
HO 1 2 3 H HO H Short polymer Dehydration removes a water molecule, forming a new bond Unlinked monomer H 2 O HO 1 2 3 4 H Longer polymer (a) Dehydration reaction in the synthesis of a polymer HO 1 2 3
More informationAn Introduction to Enzyme and Coenzyme Chemistry, 2nd Ed. T. D. H. Bugg, Blackwell Science, Oxford, 2004
Combinatorial synthesis of linchpin β-turn mimic 1 2 DCC, BT 1 2 n -tbu 1 n -tbu 1) 2 FMC DCC, BT 2) piperidine 1 2 2 n -tbu 3 DCC, BT 1 2 n -tbu 3 1) Ph 3 P 2) cyclization 3) CF 3 C 2 2 1 n 3 2 Evaluated
More information1. For the following reaction, at equilibrium [S] = 5 mm, [P] = 0.5 mm, and k f = 10 s -1. k f
1. For the following reaction, at equilibrium [S] = 5 mm, [P] = 0.5 mm, and k f = 10 s -1. S k f k r P a) Calculate K eq (the equilibrium constant) and k r. b) A catalyst increases k f by a factor of 10
More informationProteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000).
Lecture 2: Principles of Protein Structure: Amino Acids Why study proteins? Proteins underpin every aspect of biological activity and therefore are targets for drug design and medicinal therapy, and in
More informationCompetitive Inhibitor
is a substance that reduces the activity of an enzyme by entering the active site in place of the substrate whose structure it mimics. Competitive Inhibitor Identify the following molecule: Polysaccharide
More informationMacromolecules Chapter 2.3
Macromolecules Chapter 2.3 E.Q. What are the 4 main macromolecues found in living things and what are their functions? Carbon-Based Molecules Why is carbon called the building block of life? Carbon atoms
More informationCarbohydrates. Learning Objective
, one of the four major classes of biomolecules, are aldehyde or ketone compounds with multiple hydroxyl groups. They function as energy stores, metabolic intermediates and important fuels for the body.
More informationAn aldose contains an aldehyde functionality A ketose contains a ketone functionality
RCT Chapter 7 Aldoses and Ketoses; Representative monosaccharides. (a)two trioses, an aldose and a ketose. The carbonyl group in each is shaded. An aldose contains an aldehyde functionality A ketose contains
More informationThe Structure and Function of Macromolecules
The Structure and Function of Macromolecules Macromolecules are polymers Polymer long molecule consisting of many similar building blocks. Monomer the small building block molecules. Carbohydrates, proteins
More informationLab 5: Proteins and the small molecules that love them (AKA Computer Modeling with PyMol #2)
Lab 5: Proteins and the small molecules that love them (AKA Computer Modeling with PyMol #2) Goals: The objective of this lab is to provide you with an understanding of: 1. Catalysis 2. Small molecule
More informationDetails of Organic Chem! Date. Carbon & The Molecular Diversity of Life & The Structure & Function of Macromolecules
Details of Organic Chem! Date Carbon & The Molecular Diversity of Life & The Structure & Function of Macromolecules Functional Groups, I Attachments that replace one or more of the hydrogens bonded to
More informationSection 1 Lecture 1- Origins of Life Life probably started by Hydrothermal Vents.
Section 1 Lecture 1- Origins of Life Life probably started by Hydrothermal Vents. Photosynthesis originated around 3GA, as cells figured out how to fix CO2 and release O2. Eukaryotes originates 1.5-2.5
More informationFarah Al-Khaled. Razi Kittaneh. Mohammad Omari
7 Farah Al-Khaled Razi Kittaneh Mohammad Omari Dr. Mamoun Ahram In this lecture we are going to talk about modified sugars. Remember: The Fischer projection can be turned into a ring structure (which is
More informationChemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins
Chemical Nature of the Amino Acids All peptides and polypeptides are polymers of alpha-amino acids. There are 20 a- amino acids that are relevant to the make-up of mammalian proteins (see below). Several
More informationHuman Biochemistry Option B
Human Biochemistry Option B A look ahead... Your body has many functions to perform every day: Structural support, genetic information, communication, energy supply, metabolism Right now, thousands of
More informationExams written in pencil or erasable ink will not be re-graded under any circumstances.
Biochemistry 461, Section I May 21, 1998 Final Exam Prof. Jason D. Kahn Your Printed ame: Your SS#: Your Signature: You have 120 minutes for this exam. The exam has 7 questions, worth 200 points. Do all
More informationQuestions- Carbohydrates. A. The following structure is D-sorbose. (Questions 1 7) CH 2 OH C = O H C OH HO C H H C OH
Questions- Carbohydrates A. The following structure is D-sorbose. (Questions 1 7) CH 2 C = O H C HO C H H C CH 2 1. 2. 3. 4. 5. Which characteristic is different when comparing the open-chain forms of
More informationMacromolecules of Life -3 Amino Acids & Proteins
Macromolecules of Life -3 Amino Acids & Proteins Shu-Ping Lin, Ph.D. Institute of Biomedical Engineering E-mail: splin@dragon.nchu.edu.tw Website: http://web.nchu.edu.tw/pweb/users/splin/ Amino Acids Proteins
More informationChapter Three (Biochemistry)
Chapter Three (Biochemistry) 1 SECTION ONE: CARBON COMPOUNDS CARBON BONDING All compounds can be classified in two broad categories: organic compounds and inorganic compounds. Organic compounds are made
More informationHydrolysis From Wikipedia, the free encyclopedia
Page 1 of 7 Hydrolysis From Wikipedia, the free encyclopedia Hydrolysis (/haɪˈdrɒlᵻsɪs/; from Greek hydro-, meaning "water", and lysis, meaning "to unbind") usually means the cleavage of chemical bonds
More informationBiological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A
Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A Homework Watch the Bozeman video called, Biological Molecules Objective:
More information1-To know what is protein 2-To identify Types of protein 3- To Know amino acids 4- To be differentiate between essential and nonessential amino acids
Amino acids 1-To know what is protein 2-To identify Types of protein 3- To Know amino acids 4- To be differentiate between essential and nonessential amino acids 5-To understand amino acids synthesis Amino
More informationP450 CYCLE. All P450s follow the same catalytic cycle of;
P450 CYCLE All P450s follow the same catalytic cycle of; 1. Initial substrate binding 2. First electron reduction 3. Oxygen binding 4. Second electron transfer 5 and 6. Proton transfer/dioxygen cleavage
More informationi. II. Alpha-L-Ribose Aldose i. III. Beta-D-Mannose Aldose i. IV. Beta-L-Fructose Ketose
BMB170, Fall 2017 Problem Set 5: Carbohydrates Due: 12/01/2017 by 5pm, as PDF. OH: 11/30, 3:00-5:00PM, Broad Café Please email questions and PDF files to Jingzhou Wang (jingzhou@caltech.edu) Problem 1:
More informationSection 2.1: Enzymes and Digestion
Section 2.1: Enzymes and Digestion Glands produce enzymes that are used to break down large molecules into smaller ones that are ready for abortion. The digestive system provides an interface between the
More informationGentilucci, Amino Acids, Peptides, and Proteins. Peptides and proteins are polymers of amino acids linked together by amide bonds CH 3
Amino Acids Peptides and proteins are polymers of amino acids linked together by amide bonds Aliphatic Side-Chain Amino Acids - - H CH glycine alanine 3 proline valine CH CH 3 - leucine - isoleucine CH
More informationMoorpark College Chemistry 11 Fall Instructor: Professor Gopal. Examination #5: Section Five December 7, Name: (print) Section:
Moorpark College Chemistry 11 Fall 2011 Instructor: Professor Gopal Examination #5: Section Five December 7, 2011 Name: (print) Section: alkene < alkyne < amine < alcohol < ketone < aldehyde < amide
More informationAdenosine triphosphate (ATP)
Adenosine triphosphate (ATP) 1 High energy bonds ATP adenosine triphosphate N NH 2 N -O O P O O P O- O- O O P O- O CH 2 H O H N N adenine phosphoanhydride bonds (~) H OH ribose H OH Phosphoanhydride bonds
More informationObjective: You will be able to explain how the subcomponents of
Objective: You will be able to explain how the subcomponents of nucleic acids determine the properties of that polymer. Do Now: Read the first two paragraphs from enduring understanding 4.A Essential knowledge:
More informationMCB 102 Discussion, Spring 2012
MB Discussion, Spring 2012 Practice Problems 1. Effect of enzymes on reactions Which of the listed effects would be brought about by any enzyme catalyzing the following simple reaction? k 1 S P where K
More informationBiomolecules. Unit 3
Biomolecules Unit 3 Atoms Elements Compounds Periodic Table What are biomolecules? Monomers vs Polymers Carbohydrates Lipids Proteins Nucleic Acids Minerals Vitamins Enzymes Triglycerides Chemical Reactions
More informationEnzymes Topic 3.6 & 7.6 SPEED UP CHEMICAL REACTIONS!!!!!!!
Enzymes Topic 3.6 & 7.6 SPEED UP CHEMICAL REACTIONS!!!!!!! Key Words Enzyme Substrate Product Active Site Catalyst Activation Energy Denature Enzyme-Substrate Complex Lock & Key model Induced fit model
More informationMITOCW MIT7_01SCF11_track13_300k.mp4
MITOCW MIT7_01SCF11_track13_300k.mp4 HAZEL SIVE: All right. Let's move on to the second topic of our discussion today, which we will start today and then continue on Friday. And this is a discussion of
More informationIntroduction to Biochemistry Midterm exam )ومن أحياها(
Introduction to Biochemistry Midterm exam 2016-2017 )ومن أحياها( 1. Which of the following amino (in a peptide chain) would probably be found at a beta bend or turn? a. lysine * b. Gly c. arg d. asn 2.
More informationSlide 1. Slide 2. Slide 3. Chapter 5- Enzymes. State Standard. Enzymes Speed Up Chemical Reactions. Standard 1.b.
Slide 1 Chapter 5- Enzymes Slide 2 State Standard Standard 1.b. Slide 3 Enzymes Speed Up Chemical Reactions Most of the essential chemical reactions in cells must occur quickly and precisely for the cell
More informationBiochemistry - I. Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture 1 Amino Acids I
Biochemistry - I Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture 1 Amino Acids I Hello, welcome to the course Biochemistry 1 conducted by me Dr. S Dasgupta,
More informationLesson 5 Proteins Levels of Protein Structure
Lesson 5 Proteins Levels of Protein Structure Primary 1º Structure The primary structure is simply the sequence of amino acids in a protein. Chains of amino acids are written from the amino terminus (N-terminus)
More informationBIOCHEMISTRY 460 FIRST HOUR EXAMINATION FORM A (yellow) ANSWER KEY February 11, 2008
WRITE YOUR AND I.D. NUMBER LEGIBLY ON EVERY PAGE PAGES WILL BE SEPARATED FOR GRADING! CHECK TO BE SURE YOU HAVE 6 PAGES, (print): ANSWERS INCLUDING COVER PAGE. I swear/affirm that I have neither given
More informationEssential Biology 3.2 Carbohydrates, Lipids, Proteins. 1. Define organic molecule.
1. Define organic molecule. An organic molecule is a molecule that contains carbon and is found in living things. There are many organic molecules in living things. The same (or very similar) molecules
More informationBIO 311C Spring Lecture 15 Friday 26 Feb. 1
BIO 311C Spring 2010 Lecture 15 Friday 26 Feb. 1 Illustration of a Polypeptide amino acids peptide bonds Review Polypeptide (chain) See textbook, Fig 5.21, p. 82 for a more clear illustration Folding and
More informationProteins. Amino acids, structure and function. The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka
Proteins Amino acids, structure and function The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka O O HO N N HN OH Ser65-Tyr66-Gly67 The Nobel prize in chemistry 2008 Osamu Shimomura,
More informationBiological Sciences 4087 Exam I 9/20/11
Name: Biological Sciences 4087 Exam I 9/20/11 Total: 100 points Be sure to include units where appropriate. Show all calculations. There are 5 pages and 11 questions. 1.(20pts)A. If ph = 4.6, [H + ] =
More informationName. The following exam contains 44 questions, valued at 2.6 points/question. 2. Which of the following is not a principal use of proteins?
Chemistry 131 Exam 3 Practice Proteins, Enzymes, and Carbohydrates Spring 2018 Name The following exam contains 44 questions, valued at 2.6 points/question 1. Which of the following is a protein? a. Amylase
More informationCarboxylic Acid Derivatives Reading Study Problems Key Concepts and Skills Lecture Topics: Structures and reactivity of carboxylic acid derivatives
Carboxylic Acid Derivatives Reading: Wade chapter 21, sections 21-1- 21-16 Study Problems: 21-45, 21-46, 21-48, 21-49, 21-50, 21-53, 21-56, 21-58, 21-63 Key Concepts and Skills: Interpret the spectra of
More information2 3 Carbon Compounds. Proteins. Proteins
2 3 Carbon Compounds Proteins Proteins Proteins are macromolecules that contain nitrogen, carbon, hydrogen, and oxygen. Proteins are polymers of molecules called amino acids. There are 20 amino acids,
More informationSignal Transduction Cascades
Signal Transduction Cascades Contents of this page: Kinases & phosphatases Protein Kinase A (camp-dependent protein kinase) G-protein signal cascade Structure of G-proteins Small GTP-binding proteins,
More informationChapter 3. Table of Contents. Section 1 Carbon Compounds. Section 2 Molecules of Life. Biochemistry
Biochemistry Table of Contents Section 1 Carbon Compounds Section 2 Molecules of Life Section 1 Carbon Compounds Objectives Distinguish between organic and inorganic compounds. Explain the importance of
More information