Glycosidic bond cleavage

Size: px
Start display at page:

Download "Glycosidic bond cleavage"

Transcription

1 Glycosidases and Glycosyltransferases Introduction to Inverting/Retaining Mechanisms Inhibitor design Chemical Reaction Proposed catalytic mechanisms Multiple slides courtesy of Harry Gilbert with Wells modifications Glycosidic bond cleavage Glycone Aglycone H 2 O Classic example is lysozyme: cleaves N-acetlymuramic acid-β-4-glcnac Discovered by Alexander Fleming in 1920s Sneezed onto his bacterial agar plate Bacteria found to be lysed next day Potential antimicrobial enzyme He discovered a better antimicrobial agent later; what is it? 1

2 Glycosidic bond cleavage in free solution Glycone Aglycone H 2 O Transition state oxocarbenium ion attacked by hydroxyl ion Rate of glycosidic bond cleavage The transition state (positively charged oxocarbenium ion) is a very high energy molecule Geometry changes from chair to half-chair Why? So C1 and ring oxygen are in same plane So positive charge is not just at C1 but shared between C1 and ring oxygen This stabilises positive charge. Need lots of energy to cause change in geometry of sugar O5 C1 2

3 Two different mechanisms of acid-base assisted catalysis Single displacement mechanism Inversion of the anomeric configuration of glycone sugar β-glycosidic bond Bond is equatorial sugar OH is axial Two different mechanisms of acid-base assisted catalysis Double displacement mechanism Retention of the anomeric configuration of glycone sugar β-glycosidic bond Bond is equatorial OH remains equatorial 3

4 Two different mechanisms of acid-base assisted catalysis How does an enzyme generate protons and hydroxyl ions? Two amino acids with carboxylic acid side-chains Glutamate or aspartate Two mechanisms are as follows: Acid-base assisted single displacement mechanism Catalytic acid Catalytic base The acid catalyst Uncharged Hydrogen in the perfect position to be donated to the glycosidic oxygen. The catalytic base Extracts a proton from water Hydroxyl ion in the perfect position to attack C1 of the transition state 4

5 Acid-base assisted double displacement mechanism Catalytic acid-base Catalytic nucleophile Two distinct reactions Glycosylation Formation of a covalent glycosyl-enzyme intermediate (ester bond) The aglycone sugar released from active site Deglycosylation The ester bond between the glycone sugar and the enzyme is hydrolysed and the glycone sugar is released from the active site The first enzyme structure solved The textbook example of enzyme catalyzed glycoside hydrolysis Hydrolyses the glycosidic bond via a retaining mechanism 5

6 And the lysozyme mechanism is revisited: Covalent enzyme intermediate for hen egg white lysozyme Lysozyme (E35Q) Asp52 Vocadlo et al. Nature 412, How can we identify the catalytic amino acids Glycoside hydrolases are grouped in enzyme families based on sequence similarity (i.e. evolved from a common ancestor. Currently 100+ families All members of same family have Evolved from the same progenitor sequence Conserved mechanism Same fold Conserved catalytic apparatus 6

7 CAZY Several families have ancient ancestral relationship Same fold, mechanism and catalytic residues How does CAZY help us? Tells us what the catalytic residues are Tells us the mechanism Tells us the likely substrate specificity Catalytic acid Sequence 1:73 QNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSAN 1 UNIPROT:XYNA_PSEFL 1:73 335:407 QNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSAN 2 UNIPROT:Q9AJR9 1:68 111:178 RHNQQVRGHNLCWHE--ELPTwaSEVngNAKEILIQHIQTVAGRYAGRIQSWDVVNEAILPKDGRPDG UNIPROT:GUX_CELFI 3:66 115:176 --GKELYGHTLVWHS--QLPDWAKNLNGsfESAMVNHVTKVADHFEGKVASWDVVNEAFADG-DGP UNIPROT:Q :61 116:173 --GKELYGHTLVWHS--QLPDWAKNLNGsfESAMVNHVTKVADHFEGKVASWDVVNEAFAD UNIPROT:Q :63 324:391 ENNMTVHGHALVWHSDYQVPnwAGSAE-DFLAALDTHITTIVDHYegNLVSWDVVNEAIDDNS UNIPROT:Q :63 343:409 -NNINVHGHALVWHSDYQVPNFmsGSAADFIAEVEDHVTQVVTHFkgNVVSWDVVNEAINDGS UNIPROT:Q :73 111:180 QNGKQVRGHTLAWHS--QQPGWMQssGSSLRQAMIDHINGVMAHYKGKIVQWDVVNEAFADG--NSGGRRDSN 8 UNIPROT:Q7SI98 1:73 73:142 QNGKQVRGHTLAWHS--QQPGWMQssGSTLRQAMIDHINGVMGHYKGKIAQWDVVNEAFSD--DGSGGRRDSN 9 UNIPROT:XYNB_THENE 1:62 96:158 KNDMIVHGHTLVWHN--QLPGWLTgsKEELLNILEDHVKTVVSHFRGRVKIWDVVNEAVSDS UNIPROT:Q :62 96:158 KNDMIVHGHTLVWHN--QLPGWLTgsKEELLNILEDHVKTVVSHFRGRVKIWDVVNEAVSDS UNIPROT:AAN :62 96:158 KNDMIVHGHTLVWHN--QLPGWLTgsKEELLNILEDHVKTVVSHFRGRVKIWDVVNEAVSDS UNIPROT:Q7TM36 8:68 2: GHTVVWHGA--VPTWLNasTDDFRAAFENHIRTVADHFRGKVLAWDVVNEAV---ADDGSG UNIPROT:Q7WVV0 1:62 96:158 ENDMIVHGHTLVWHN--QLPGWITgtKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDS UNIPROT:Q7WUM6 1:62 96:158 ENDMIVHGHTLVWHN--QLPGWITgtKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDS UNIPROT:Q9WXS5 1:62 96:158 ENDMIVHGHTLVWHN--QLPGWITgtKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDS UNIPROT:Q9P973 1:57 120:176 QNGKSIRGHTLIWHS--QLPAWVNnnNAdlRQVIRTHVSTVVGRYKGKIRAWDVVNE UNIPROT:Q9X584 1:63 115:176 QNGKQVRGHTLAWHS--QQPGWMQssGSALRQAMIDHINGVMAHYKGKIAQWDVVNEAFADGS UNIPROT:XYNA_STRLI 1:63 114:175 QNGKQVRGHTLAWHS--QQPGWMQssGSALRQAMIDHINGVMAHYKGKIVQWDVVNEAFADGS UNIPROT:Q8CJQ1 1:63 114:175 QNGKQVRGHTLAWHS--QQPGWMQssGSALRQAMIDHINGVMAHYKGKIVQWDVVNEAFADGS UNIPROT:P :62 93:155 QNGQGLRCHTLIWYS--QLPGWVSSGNWN-RQTLEahIDNVMGHYKGQCYAWDVVNEAVDDN UNIPROT:Q9XDV5 3:71 427:505 --GMKVHGHTLVWHQ--QTPAWMndSGGNirEemRNHIRTVIEHFGDKVISWDVVNEAMSDNPSNpdWRGS-- 22 UNIPROT:Q8GJ37 3:71 427:505 --GMKVHGHTLVWHQ--QTPAWMndSGGNirEemRNHIRTVIEHFGDKVISWDVVNEAMSDNPSNpdWRGS-- 23 UNIPROT:Q7X2C9 1:63 27:88 QNGKQVRGHTLAWHS--QQPGWMQssGSSLRQAMIDHINGVMNHSKGKIAQWDVVNEAFADGS UNIPROT:Q9RJ91 3:61 105:162 --GMDVRGHTLVWHS--QLPSWVSPLGadLRTAMNAHINGLMGHYKGEIHSWDVVNEAFQD UNIPROT:Q :61 119:176 --GMKVRGHTLVWHS--QLPGWVSPLAadLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQD UNIPROT:Q9RMM5 1:61 113:172 QNGKEVRGHTLAWHS--QQPYWMQssGSDLRQAMIDHINGVMNHYKGKIAQWDVVNEAFED UNIPROT:BAD :61 113:172 QNGKEVRGHTLAWHS--QQPYWMQssGSDLRQAMIDHINGVMNHYKGKIAQWDVVNEAFED

8 Inhibitors of glycoside hydrolases Glycoside hydrolase activities contribute to significant diseases Flu Type II diabetes Possibly Cancer and Aids To combat diseases need to develop inhibitors Designing glycoside hydrolase inhibitors What comprises a good inhibitor? Mechanistic covalent inhibitors not used Very high affinity non-covalent competitive inhibitors Transition state inhibitors 8

9 glycosylation Transition state has a positive charged nature as leaving group departure precedes nucleophile attack deglycosylation TS-based inhibitors that mimic charge distribution deoxynojirimycin Glucosidase Inhibitors isofagamine Both have nm K i values. Affinities are about one million times higher than substrate Why are they transition state mimics? Contains a positive charge 9

10 Mimicking the half-chair Insert a double-bond to enforce planarity Drugs that mainly mimic the half chair All picomolar affinities fold tighter binders than substrates HIV drug: prevents glycosylation in mammalian cells AIDs virus surface proteins are not glycosylated and thus can t evade the immune system Type II diabetes (inhibits human Amylase) Anti-flu drugs 10

11 Annual Reviews Two folds Both have two Rossman domains GTA strongly linked may look like a single β- sheet GT-B has two separate domains Requirement of nucleotide binding limits number of folds greatly 11

12 Inverting GT Retaining GT Inverting GT Retaining GT 12

13 Take Home Points CAZY Inverting/Retaining Mechanisms Mechanistic Based Inhibitors 13

14 References Cantarel et al (2008) Nucleic Acid Res 37:D233-8 (CAZY) Vocadlo at al. (2001) Nature 412: (Mechanistic inhibitors of glycoside hydrolases) Lairson et al. (2008) Ann. Rev. Biochem. 77: (glycosyltransferases) Rye and Withers (2000) Curr. Opin. Chem. Biol. 4: (glycoside hydrolases) Tailford (2008) Nature Chem. Biol. Nat. 4: (Transition state geometry) 14

15 A. B. C. D. E. F. α3 α3 β4 β3 Ser/Thr β4 β3 Asn Asn Ser/Thr Asn α3 β4 β3 β6 Ser/Thr G. H. I. J. K. β3 Ser/Thr Ser/Thr Asn Asn Asn 15

A. B. C. D. E. F. G. H. I. J. K. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Asn. Asn. Asn. Asn. Asn. Asn

A. B. C. D. E. F. G. H. I. J. K. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Ser/Thr. Asn. Asn. Asn. Asn. Asn. Asn A. B. C. D. E. F. "3 "3!4!3 Ser/Thr "3!4!3!4 Asn Asn Ser/Thr Asn!3!6 Ser/Thr G. H. I. J. K.!3 Ser/Thr Ser/Thr 4 4 2 2 6 3 6 Asn Asn Asn Glycosidases and Glycosyltransferases Introduction to Inverting/Retaining

More information

Finding the Sweet Spot- Mechanism Guided Design of Glycosidase Inhibitors. Jahnabi Roy CHEM 575 Seminar 11/01/12

Finding the Sweet Spot- Mechanism Guided Design of Glycosidase Inhibitors. Jahnabi Roy CHEM 575 Seminar 11/01/12 Finding the Sweet Spot- Mechanism Guided Design of Glycosidase Inhibitors Jahnabi Roy CHEM 575 Seminar 11/01/12 Glycans and Glycosyl Hydrolases http://cellbiology.med.unsw.edu.au/units/science/lecture0803.htm

More information

Mechanisms of Enzymes

Mechanisms of Enzymes Mechanisms of Enzymes Presented by Dr. Mohammad Saadeh The requirements for the Pharmaceutical Biochemistry I Philadelphia University Faculty of pharmacy How enzymes work * Chemical reactions have an energy

More information

Bio 100 Serine Proteases 9/26/11

Bio 100 Serine Proteases 9/26/11 Assigned Reading: 4th ed. 6.4.1 The Chymotrypsin Mechanism Involves Acylation And Deacylation Of A Ser Residue p. 213 BOX 20-1 Penicillin and β-lactamase p. 779 6.5.7 Some Enzymes Are Regulated By Proteolytic

More information

Chymotrypsin Lecture. Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin

Chymotrypsin Lecture. Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin Chymotrypsin Lecture Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin What s so great about enzymes? They accomplish large rate accelerations (10 10-10

More information

PAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin

PAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin Subject Paper No and Title 16 Bio-organic and Biophysical Module No and Title 22 Mechanism of Enzyme Catalyzed reactions I Module Tag CHE_P16_M22 Chymotrypsin TABLE OF CONTENTS 1. Learning outcomes 2.

More information

Previous Class. Today. Term test I discussions. Detection of enzymatic intermediates: chymotrypsin mechanism

Previous Class. Today. Term test I discussions. Detection of enzymatic intermediates: chymotrypsin mechanism Term test I discussions Previous Class Today Detection of enzymatic intermediates: chymotrypsin mechanism Mechanistic Understanding of Enzymemediated Reactions Ultimate goals: Identification of the intermediates,

More information

Previous Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties

Previous Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties Previous Class Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism Today Protein Kinase Catalytic Properties Protein Phosphorylation Phosphorylation: key protein modification

More information

Enzyme Catalysis-Serine Proteases

Enzyme Catalysis-Serine Proteases Enzyme Catalysis-Serine Proteases Concepts to be learned Activation Energy Transition State Example: Proteases Requirements for proteolysis Families of proteases Protein Folds used by proteases for catalysis

More information

CHM 341 C: Biochemistry I. Test 2: October 24, 2014

CHM 341 C: Biochemistry I. Test 2: October 24, 2014 CHM 341 C: Biochemistry I Test 2: ctober 24, 2014 This test consists of 14 questions worth points. Make sure that you read the entire question and answer each question clearly and completely. To receive

More information

Protein Modification Overview DEFINITION The modification of selected residues in a protein and not as a component of synthesis

Protein Modification Overview DEFINITION The modification of selected residues in a protein and not as a component of synthesis Lecture Four: Protein Modification & Cleavage [Based on Chapters 2, 9, 10 & 11 Berg, Tymoczko & Stryer] (Figures in red are for the 7th Edition) (Figures in Blue are for the 8th Edition) Protein Modification

More information

CHAPTER 9: CATALYTIC STRATEGIES. Chess vs Enzymes King vs Substrate

CHAPTER 9: CATALYTIC STRATEGIES. Chess vs Enzymes King vs Substrate CHAPTER 9: CATALYTIC STRATEGIES Chess vs Enzymes King vs Substrate INTRODUCTION CHAPTER 9 What are the sources of the catalytic power and specificity of enzymes? Problems in reactions in cells Neutral

More information

MITOCW watch?v=922oig1hwg8

MITOCW watch?v=922oig1hwg8 MITOCW watch?v=922oig1hwg8 The following content is provided under a Creative Commons license. Your support will help MIT OpenCourseWare continue to offer high quality educational resources for free. To

More information

PART IV THE CATALYTIC FUNCTION

PART IV THE CATALYTIC FUNCTION PAT IV TE ATALYTI FUNTIN INTDUTIN The life of a cell, of an organism, depends on the multiplicity of the diverse chemical reactions which constitute metabolism. These reactions are carried out with appreciable

More information

Chemical Mechanism of Enzymes

Chemical Mechanism of Enzymes Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.

More information

Notes 11/2. Heather Graehl

Notes 11/2. Heather Graehl Lecture Page 1 Notes 11/2 Friday, November 02, 2007 9:56 AM Heather Graehl Notes 1112 Audio recording started: 10:02 AM Friday, November 02, 2007 Slide 1: Enzymes: Serine Proteases (Nov 7th Midterm will

More information

Enzyme Catalytic Mechanisms. Dr. Kevin Ahern

Enzyme Catalytic Mechanisms. Dr. Kevin Ahern Enzyme Catalytic Mechanisms Dr. Kevin Ahern Cleave Peptide Bonds Specificity of Cutting Common Active Site Composition/Structure Mechanistically Well Studied Chymotrypsin Chymotrypsin Catalysis H2O Chymotrypsin

More information

6. The catalytic mechanism of arylsulfatase A and its theoretical investigation

6. The catalytic mechanism of arylsulfatase A and its theoretical investigation 6. The catalytic mechanism of arylsulfatase A and its theoretical investigation When the crystal structure of arylsulfatase A was solved, a remarkable structural analogy to another hydrolytic enzyme, the

More information

From Structure to Function (II): Enzyme Structure & Catalysis

From Structure to Function (II): Enzyme Structure & Catalysis BCHS 6229 Protein Structure and Function Lecture 5 (Oct 25, 2011) From Structure to Function (II): Enzyme Structure & Catalysis 1 Outline Catalysis: Overview Active site geometry Proximity and ground-state

More information

UNIVERSITY OF GUELPH CHEM 4540 ENZYMOLOGY Winter 2005 Quiz #2: March 24, 2005, 11:30 12:50 Instructor: Prof R. Merrill ANSWERS

UNIVERSITY OF GUELPH CHEM 4540 ENZYMOLOGY Winter 2005 Quiz #2: March 24, 2005, 11:30 12:50 Instructor: Prof R. Merrill ANSWERS UNIVERSITY F GUELPH CHEM 4540 ENZYMLGY Winter 2005 Quiz #2: March 24, 2005, 11:30 12:50 Instructor: Prof R. Merrill ANSWERS Instructions: Time allowed = 80 minutes. Total marks = 30. This quiz represents

More information

MahaAbuAjamieh. BahaaNajjar. MamoonAhram

MahaAbuAjamieh. BahaaNajjar. MamoonAhram 7 MahaAbuAjamieh BahaaNajjar MamoonAhram Carbohydrates (saccharides) can be classified into these main categories: 1. Monosaccharides, they are simplesugars (the simplest units), such as glucose, galactose

More information

Catalysis & specificity: Proteins at work

Catalysis & specificity: Proteins at work Catalysis & specificity: Proteins at work Introduction Having spent some time looking at the elements of structure of proteins and DNA, as well as their ability to form intermolecular interactions, it

More information

For questions 1-4, match the carbohydrate with its size/functional group name:

For questions 1-4, match the carbohydrate with its size/functional group name: Chemistry 11 Fall 2013 Examination #5 PRACTICE 1 ANSWERS For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the

More information

1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: =3x10-5 = 30μM

1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: =3x10-5 = 30μM 1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: k 1 = 2 x 10 8 M -1 s -1, k 2 = 1 x 10 3 s -1, k 3 = 5 x 10 3 s -1 a) What

More information

Chapter 23 Enzymes 1

Chapter 23 Enzymes 1 Chapter 23 Enzymes 1 Enzymes Ribbon diagram of cytochrome c oxidase, the enzyme that directly uses oxygen during respiration. 2 Enzyme Catalysis Enzyme: A biological catalyst. With the exception of some

More information

189,311, , ,561, ,639, ,679, Ch13; , Carbohydrates

189,311, , ,561, ,639, ,679, Ch13; , Carbohydrates Lecture 31 (12/8/17) Reading: Ch7; 258-267 Ch10; 371-373 Problems: Ch7 (text); 26,27,28 Ch7 (study-guide: applying); 2,5 Ch7 (study-guide: facts); 6 NEXT (LAST!) Reading: Chs4,6,8,10,14,16,17,18; 128-129,

More information

MITOCW watch?v=xms9dyhqhi0

MITOCW watch?v=xms9dyhqhi0 MITOCW watch?v=xms9dyhqhi0 The following content is provided under a Creative Commons license. Your support will help MIT OpenCourseWare continue to offer high-quality, educational resources for free.

More information

2. Which of the following is NOT true about carbohydrates

2. Which of the following is NOT true about carbohydrates Chemistry 11 Fall 2011 Examination #5 For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the free response questions

More information

2. Which of the following amino acids is most likely to be found on the outer surface of a properly folded protein?

2. Which of the following amino acids is most likely to be found on the outer surface of a properly folded protein? Name: WHITE Student Number: Answer the following questions on the computer scoring sheet. 1 mark each 1. Which of the following amino acids would have the highest relative mobility R f in normal thin layer

More information

Enzymes. Enzyme. Aim: understanding the basic concepts of enzyme catalysis and enzyme kinetics

Enzymes. Enzyme. Aim: understanding the basic concepts of enzyme catalysis and enzyme kinetics Enzymes Substrate Enzyme Product Aim: understanding the basic concepts of enzyme catalysis and enzyme kinetics Enzymes are efficient Enzyme Reaction Uncatalysed (k uncat s -1 ) Catalysed (k cat s -1 )

More information

For questions 1-4, match the carbohydrate with its size/functional group name:

For questions 1-4, match the carbohydrate with its size/functional group name: Chemistry 11 Fall 2009 Examination #5 ANSWER KEY For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the free response

More information

Biochemistry: A Short Course

Biochemistry: A Short Course Tymoczko Berg Stryer Biochemistry: A Short Course Second Edition CHAPTER 10 Carbohydrates 2013 W. H. Freeman and Company Chapter 10 Outline Monosaccharides are aldehydes or ketones that contain two or

More information

Short polymer. Dehydration removes a water molecule, forming a new bond. Longer polymer (a) Dehydration reaction in the synthesis of a polymer

Short polymer. Dehydration removes a water molecule, forming a new bond. Longer polymer (a) Dehydration reaction in the synthesis of a polymer HO 1 2 3 H HO H Short polymer Dehydration removes a water molecule, forming a new bond Unlinked monomer H 2 O HO 1 2 3 4 H Longer polymer (a) Dehydration reaction in the synthesis of a polymer HO 1 2 3

More information

Lecture 18 (10/27/17) Lecture 18 (10/27/17)

Lecture 18 (10/27/17) Lecture 18 (10/27/17) Reading: Ch6; 225-232 Lecture 18 (10/27/17) Problems: Ch5 (text); 2 Ch6 (study guide-facts); 5, 6, 7, 14 NEXT Reading: Ch5; 164, 166-169 Problems: none Remember Monday at 6:30 in PHO-206 is the first MB

More information

Lecture 34. Carbohydrate Metabolism 2. Glycogen. Key Concepts. Biochemistry and regulation of glycogen degradation

Lecture 34. Carbohydrate Metabolism 2. Glycogen. Key Concepts. Biochemistry and regulation of glycogen degradation Lecture 34 Carbohydrate Metabolism 2 Glycogen Key Concepts Overview of Glycogen Metabolism Biochemistry and regulation of glycogen degradation Biochemistry and regulation of glycogen synthesis What mechanisms

More information

Six Types of Enzyme Catalysts

Six Types of Enzyme Catalysts Six Types of Enzyme Catalysts Although a huge number of reactions occur in living systems, these reactions fall into only half a dozen types. The reactions are: 1. Oxidation and reduction. Enzymes that

More information

Peptide hydrolysis uncatalyzed half-life = ~450 years HIV protease-catalyzed half-life = ~3 seconds

Peptide hydrolysis uncatalyzed half-life = ~450 years HIV protease-catalyzed half-life = ~3 seconds Uncatalyzed half-life Peptide hydrolysis uncatalyzed half-life = ~450 years IV protease-catalyzed half-life = ~3 seconds Life Sciences 1a Lecture Slides Set 9 Fall 2006-2007 Prof. David R. Liu In the absence

More information

Chapter 11: Enzyme Catalysis

Chapter 11: Enzyme Catalysis Chapter 11: Enzyme Catalysis Matching A) high B) deprotonated C) protonated D) least resistance E) motion F) rate-determining G) leaving group H) short peptides I) amino acid J) low K) coenzymes L) concerted

More information

For questions 1-4, match the carbohydrate with its size/functional group name:

For questions 1-4, match the carbohydrate with its size/functional group name: Chemistry 11 Fall 2013 Examination #5 PRACTICE 1 For the first portion of this exam, select the best answer choice for the questions below and mark the answers on your scantron. Then answer the free response

More information

Introduction to Enzymology

Introduction to Enzymology Introduction to Enzymology Functional Properties Nomenclature Enzyme specificity Enzyme regulation Introduction to Enzymology Enzymes - Biological catalysts By definition a Catalyst : - Accelerates the

More information

CHEM121. Unit 6: Enzymes. Lecture 10. At the end of the lecture, students should be able to:

CHEM121. Unit 6: Enzymes. Lecture 10. At the end of the lecture, students should be able to: CHEM121 Unit 6: Enzymes Lecture 10 At the end of the lecture, students should be able to: Define the term enzyme Name and classify enzymes according to the: type of reaction catalyzed type of specificity

More information

An aldose contains an aldehyde functionality A ketose contains a ketone functionality

An aldose contains an aldehyde functionality A ketose contains a ketone functionality RCT Chapter 7 Aldoses and Ketoses; Representative monosaccharides. (a)two trioses, an aldose and a ketose. The carbonyl group in each is shaded. An aldose contains an aldehyde functionality A ketose contains

More information

Amino acids. (Foundation Block) Dr. Essa Sabi

Amino acids. (Foundation Block) Dr. Essa Sabi Amino acids (Foundation Block) Dr. Essa Sabi Learning outcomes What are the amino acids? General structure. Classification of amino acids. Optical properties. Amino acid configuration. Non-standard amino

More information

Lab 5: Proteins and the small molecules that love them (AKA Computer Modeling with PyMol #2)

Lab 5: Proteins and the small molecules that love them (AKA Computer Modeling with PyMol #2) Lab 5: Proteins and the small molecules that love them (AKA Computer Modeling with PyMol #2) Goals: The objective of this lab is to provide you with an understanding of: 1. Catalysis 2. Small molecule

More information

Farah Al-Khaled. Razi Kittaneh. Mohammad Omari

Farah Al-Khaled. Razi Kittaneh. Mohammad Omari 7 Farah Al-Khaled Razi Kittaneh Mohammad Omari Dr. Mamoun Ahram In this lecture we are going to talk about modified sugars. Remember: The Fischer projection can be turned into a ring structure (which is

More information

Chapter 20 Carbohydrates Chapter 20

Chapter 20 Carbohydrates Chapter 20 Chapter 20 Carbohydrates Chapter 20 1 Carbohydrates Carbohydrate: A polyhydroxyaldehyde or polyhydroxyketone, or a substance that gives these compounds on hydrolysis. Monosaccharide: A carbohydrate that

More information

Enzymes. Enzyme Structure. How do enzymes work?

Enzymes. Enzyme Structure. How do enzymes work? Page 1 of 6 Enzymes Enzymes are biological catalysts. There are about 40,000 different enzymes in human cells, each controlling a different chemical reaction. They increase the rate of reactions by a factor

More information

The MOLECULES of LIFE

The MOLECULES of LIFE The MOLECULES of LIFE Physical and Chemical Principles Solutions Manual Prepared by James Fraser and Samuel Leachman Chapter 16 Principles of Enzyme Catalysis Problems True/False and Multiple Choice 1.

More information

Chemistry 135, First Exam. September 23, Chem 135, Exam 1 SID:

Chemistry 135, First Exam. September 23, Chem 135, Exam 1 SID: Chemistry 135, First Exam September 23, 2015 This exam will be worth 15% of your overall grade. Please read all instructions/questions carefully and provide answers in the space provided. There should

More information

P450 CYCLE. All P450s follow the same catalytic cycle of;

P450 CYCLE. All P450s follow the same catalytic cycle of; P450 CYCLE All P450s follow the same catalytic cycle of; 1. Initial substrate binding 2. First electron reduction 3. Oxygen binding 4. Second electron transfer 5 and 6. Proton transfer/dioxygen cleavage

More information

Figure 1. A ribbon diagram of the aldolase (A) and a close up of the active site (B) including the bound substrate.

Figure 1. A ribbon diagram of the aldolase (A) and a close up of the active site (B) including the bound substrate. Problem Set 4 (C-C bond formation, phosphoryl transfer reactions and the role of ATP) 1. Chemists can use the same strategies as nature to make new carbon-carbon bonds stereospecifically using enzymes

More information

Hydrolysis From Wikipedia, the free encyclopedia

Hydrolysis From Wikipedia, the free encyclopedia Page 1 of 7 Hydrolysis From Wikipedia, the free encyclopedia Hydrolysis (/haɪˈdrɒlᵻsɪs/; from Greek hydro-, meaning "water", and lysis, meaning "to unbind") usually means the cleavage of chemical bonds

More information

Topic 4 - #2 Carbohydrates Topic 2

Topic 4 - #2 Carbohydrates Topic 2 Topic 4 - #2 Carbohydrates Topic 2 Biologically Important Monosaccharide Derivatives There are a large number of monosaccharide derivatives. A variety of chemical and enzymatic reactions produce these

More information

Enzymes: The Catalysts of Life

Enzymes: The Catalysts of Life Chapter 6 Enzymes: The Catalysts of Life Lectures by Kathleen Fitzpatrick Simon Fraser University Activation Energy and the Metastable State Many thermodynamically feasible reactions in a cell that could

More information

Lesson 5 Proteins Levels of Protein Structure

Lesson 5 Proteins Levels of Protein Structure Lesson 5 Proteins Levels of Protein Structure Primary 1º Structure The primary structure is simply the sequence of amino acids in a protein. Chains of amino acids are written from the amino terminus (N-terminus)

More information

MCB 102 Discussion, Spring 2012

MCB 102 Discussion, Spring 2012 MB Discussion, Spring 2012 Practice Problems 1. Effect of enzymes on reactions Which of the listed effects would be brought about by any enzyme catalyzing the following simple reaction? k 1 S P where K

More information

The Structure and Function of Macromolecules

The Structure and Function of Macromolecules The Structure and Function of Macromolecules Macromolecules are polymers Polymer long molecule consisting of many similar building blocks. Monomer the small building block molecules. Carbohydrates, proteins

More information

CHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith

CHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, & Enzymes General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, Enzymes Learning Objectives: q The 20 common, naturally occurring

More information

Enzymes Topic 3.6 & 7.6 SPEED UP CHEMICAL REACTIONS!!!!!!!

Enzymes Topic 3.6 & 7.6 SPEED UP CHEMICAL REACTIONS!!!!!!! Enzymes Topic 3.6 & 7.6 SPEED UP CHEMICAL REACTIONS!!!!!!! Key Words Enzyme Substrate Product Active Site Catalyst Activation Energy Denature Enzyme-Substrate Complex Lock & Key model Induced fit model

More information

Moorpark College Chemistry 11 Fall Instructor: Professor Gopal. Examination #5: Section Five December 7, Name: (print) Section:

Moorpark College Chemistry 11 Fall Instructor: Professor Gopal. Examination #5: Section Five December 7, Name: (print) Section: Moorpark College Chemistry 11 Fall 2011 Instructor: Professor Gopal Examination #5: Section Five December 7, 2011 Name: (print) Section: alkene < alkyne < amine < alcohol < ketone < aldehyde < amide

More information

Details of Organic Chem! Date. Carbon & The Molecular Diversity of Life & The Structure & Function of Macromolecules

Details of Organic Chem! Date. Carbon & The Molecular Diversity of Life & The Structure & Function of Macromolecules Details of Organic Chem! Date Carbon & The Molecular Diversity of Life & The Structure & Function of Macromolecules Functional Groups, I Attachments that replace one or more of the hydrogens bonded to

More information

BIO 311C Spring Lecture 15 Friday 26 Feb. 1

BIO 311C Spring Lecture 15 Friday 26 Feb. 1 BIO 311C Spring 2010 Lecture 15 Friday 26 Feb. 1 Illustration of a Polypeptide amino acids peptide bonds Review Polypeptide (chain) See textbook, Fig 5.21, p. 82 for a more clear illustration Folding and

More information

Questions- Carbohydrates. A. The following structure is D-sorbose. (Questions 1 7) CH 2 OH C = O H C OH HO C H H C OH

Questions- Carbohydrates. A. The following structure is D-sorbose. (Questions 1 7) CH 2 OH C = O H C OH HO C H H C OH Questions- Carbohydrates A. The following structure is D-sorbose. (Questions 1 7) CH 2 C = O H C HO C H H C CH 2 1. 2. 3. 4. 5. Which characteristic is different when comparing the open-chain forms of

More information

Exams written in pencil or erasable ink will not be re-graded under any circumstances.

Exams written in pencil or erasable ink will not be re-graded under any circumstances. Biochemistry 461, Section I May 21, 1998 Final Exam Prof. Jason D. Kahn Your Printed ame: Your SS#: Your Signature: You have 120 minutes for this exam. The exam has 7 questions, worth 200 points. Do all

More information

Human Biochemistry Option B

Human Biochemistry Option B Human Biochemistry Option B A look ahead... Your body has many functions to perform every day: Structural support, genetic information, communication, energy supply, metabolism Right now, thousands of

More information

BIOCHEMISTRY 460 FIRST HOUR EXAMINATION FORM A (yellow) ANSWER KEY February 11, 2008

BIOCHEMISTRY 460 FIRST HOUR EXAMINATION FORM A (yellow) ANSWER KEY February 11, 2008 WRITE YOUR AND I.D. NUMBER LEGIBLY ON EVERY PAGE PAGES WILL BE SEPARATED FOR GRADING! CHECK TO BE SURE YOU HAVE 6 PAGES, (print): ANSWERS INCLUDING COVER PAGE. I swear/affirm that I have neither given

More information

Biological Sciences 4087 Exam I 9/20/11

Biological Sciences 4087 Exam I 9/20/11 Name: Biological Sciences 4087 Exam I 9/20/11 Total: 100 points Be sure to include units where appropriate. Show all calculations. There are 5 pages and 11 questions. 1.(20pts)A. If ph = 4.6, [H + ] =

More information

Macromolecules of Life -3 Amino Acids & Proteins

Macromolecules of Life -3 Amino Acids & Proteins Macromolecules of Life -3 Amino Acids & Proteins Shu-Ping Lin, Ph.D. Institute of Biomedical Engineering E-mail: splin@dragon.nchu.edu.tw Website: http://web.nchu.edu.tw/pweb/users/splin/ Amino Acids Proteins

More information

Essential Biology 3.2 Carbohydrates, Lipids, Proteins. 1. Define organic molecule.

Essential Biology 3.2 Carbohydrates, Lipids, Proteins. 1. Define organic molecule. 1. Define organic molecule. An organic molecule is a molecule that contains carbon and is found in living things. There are many organic molecules in living things. The same (or very similar) molecules

More information

Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A

Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A Homework Watch the Bozeman video called, Biological Molecules Objective:

More information

An Introduction to Enzyme and Coenzyme Chemistry, 2nd Ed. T. D. H. Bugg, Blackwell Science, Oxford, 2004

An Introduction to Enzyme and Coenzyme Chemistry, 2nd Ed. T. D. H. Bugg, Blackwell Science, Oxford, 2004 Combinatorial synthesis of linchpin β-turn mimic 1 2 DCC, BT 1 2 n -tbu 1 n -tbu 1) 2 FMC DCC, BT 2) piperidine 1 2 2 n -tbu 3 DCC, BT 1 2 n -tbu 3 1) Ph 3 P 2) cyclization 3) CF 3 C 2 2 1 n 3 2 Evaluated

More information

Chem Lecture 5 Catalytic Strategies Part 3

Chem Lecture 5 Catalytic Strategies Part 3 Chem 52 - Lecture 5 Catalytic Strategies Part 3 Question of the Day: Transition states in enzyme catalyzed reactions are usually very unstable and therefore hard to observe. What was the trick used by

More information

1. For the following reaction, at equilibrium [S] = 5 mm, [P] = 0.5 mm, and k f = 10 s -1. k f

1. For the following reaction, at equilibrium [S] = 5 mm, [P] = 0.5 mm, and k f = 10 s -1. k f 1. For the following reaction, at equilibrium [S] = 5 mm, [P] = 0.5 mm, and k f = 10 s -1. S k f k r P a) Calculate K eq (the equilibrium constant) and k r. b) A catalyst increases k f by a factor of 10

More information

Sheet #10 Dr. Mamoun Ahram Sec 1,2,3 15/07/2014. Carbohydrates 2

Sheet #10 Dr. Mamoun Ahram Sec 1,2,3 15/07/2014. Carbohydrates 2 Carbohydrates 2 A study Guide: Kindly,refer to the slide number,look at the structures and read the sheet notes well,most of the slides content besides all what the doctor said are mentioned here,good

More information

Competitive Inhibitor

Competitive Inhibitor is a substance that reduces the activity of an enzyme by entering the active site in place of the substrate whose structure it mimics. Competitive Inhibitor Identify the following molecule: Polysaccharide

More information

Adenosine triphosphate (ATP)

Adenosine triphosphate (ATP) Adenosine triphosphate (ATP) 1 High energy bonds ATP adenosine triphosphate N NH 2 N -O O P O O P O- O- O O P O- O CH 2 H O H N N adenine phosphoanhydride bonds (~) H OH ribose H OH Phosphoanhydride bonds

More information

Section 2.1: Enzymes and Digestion

Section 2.1: Enzymes and Digestion Section 2.1: Enzymes and Digestion Glands produce enzymes that are used to break down large molecules into smaller ones that are ready for abortion. The digestive system provides an interface between the

More information

Chapter 11. Learning objectives: Structure and function of monosaccharides, polysaccharide, glycoproteins lectins.

Chapter 11. Learning objectives: Structure and function of monosaccharides, polysaccharide, glycoproteins lectins. Chapter 11 Learning objectives: Structure and function of monosaccharides, polysaccharide, glycoproteins lectins. Carbohydrates Fuels Structural components Coating of cells Part of extracellular matrix

More information

Hind Abu Tawileh. Moh Tarek & Razi Kittaneh. Ma moun

Hind Abu Tawileh. Moh Tarek & Razi Kittaneh. Ma moun 26 Hind Abu Tawileh Moh Tarek & Razi Kittaneh... Ma moun Cofactors are non-protein compounds, they are divided into 3 types: Protein-based. Metals: if they are bounded tightly (covalently) to the enzyme

More information

Objective: You will be able to explain how the subcomponents of

Objective: You will be able to explain how the subcomponents of Objective: You will be able to explain how the subcomponents of nucleic acids determine the properties of that polymer. Do Now: Read the first two paragraphs from enduring understanding 4.A Essential knowledge:

More information

Glycolysis. Biochemistry of Metabolism. glucose-6-phosphate. ATP adenosine triphosphate

Glycolysis. Biochemistry of Metabolism. glucose-6-phosphate. ATP adenosine triphosphate Biochemistry of Metabolism opyright 998-007 by Joyce J. Diwan. All rights reserved. Gibbs Free Energy hanges Rxn# Enzyme ΔG '(kj/mol) ΔG(kJ/mol) exokinase -.7 -. Phosphogluco-isomerase +.7 -. Phosphofructokinase

More information

Carbohydrates. Learning Objective

Carbohydrates. Learning Objective , one of the four major classes of biomolecules, are aldehyde or ketone compounds with multiple hydroxyl groups. They function as energy stores, metabolic intermediates and important fuels for the body.

More information

BIOB111 - Tutorial activity for Session 14

BIOB111 - Tutorial activity for Session 14 BIOB111 - Tutorial activity for Session 14 General topics for week 7 Session 14 Amino acids and proteins Students review the concepts learnt and answer the selected questions from the textbook. General

More information

Chemistry and Biochemistry 153A Spring Exam 2

Chemistry and Biochemistry 153A Spring Exam 2 hemistry and Biochemistry 153A Spring 2011 Exam 2 Instructions: You will have 1 hour 45 minutes to complete the exam. You may use a pencil (recommended) or blue or black ink pen to write your answers.

More information

[2] (b) When the enzyme catalase is added to hydrogen peroxide, the following reaction occurs: 2 H 2

[2] (b) When the enzyme catalase is added to hydrogen peroxide, the following reaction occurs: 2 H 2 1 (a) Enzymes are biological catalysts. Explain the term biological catalyst................ [2] (b) When the enzyme catalase is added to hydrogen peroxide, the following reaction occurs: catalase H 2

More information

Macro molecule = is all the reactions that take place in cells, the sum of all chemical reactions that occur within a living organism Anabolism:

Macro molecule = is all the reactions that take place in cells, the sum of all chemical reactions that occur within a living organism Anabolism: Macromolecule Macro molecule = molecule that is built up from smaller units The smaller single subunits that make up macromolecules are known as Joining two or more single units together form a M is all

More information

Biomolecules. Unit 3

Biomolecules. Unit 3 Biomolecules Unit 3 Atoms Elements Compounds Periodic Table What are biomolecules? Monomers vs Polymers Carbohydrates Lipids Proteins Nucleic Acids Minerals Vitamins Enzymes Triglycerides Chemical Reactions

More information

Slide 1. Slide 2. Slide 3. Chapter 5- Enzymes. State Standard. Enzymes Speed Up Chemical Reactions. Standard 1.b.

Slide 1. Slide 2. Slide 3. Chapter 5- Enzymes. State Standard. Enzymes Speed Up Chemical Reactions. Standard 1.b. Slide 1 Chapter 5- Enzymes Slide 2 State Standard Standard 1.b. Slide 3 Enzymes Speed Up Chemical Reactions Most of the essential chemical reactions in cells must occur quickly and precisely for the cell

More information

Enzymes Part III: regulation II. Dr. Mamoun Ahram Summer, 2017

Enzymes Part III: regulation II. Dr. Mamoun Ahram Summer, 2017 Enzymes Part III: regulation II Dr. Mamoun Ahram Summer, 2017 Advantage This is a major mechanism for rapid and transient regulation of enzyme activity. A most common mechanism is enzyme phosphorylation

More information

Introduction to Biochemistry Midterm exam )ومن أحياها(

Introduction to Biochemistry Midterm exam )ومن أحياها( Introduction to Biochemistry Midterm exam 2016-2017 )ومن أحياها( 1. Which of the following amino (in a peptide chain) would probably be found at a beta bend or turn? a. lysine * b. Gly c. arg d. asn 2.

More information

Chemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins

Chemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins Chemical Nature of the Amino Acids All peptides and polypeptides are polymers of alpha-amino acids. There are 20 a- amino acids that are relevant to the make-up of mammalian proteins (see below). Several

More information

Human Biochemistry. Enzymes

Human Biochemistry. Enzymes Human Biochemistry Enzymes Characteristics of Enzymes Enzymes are proteins which catalyze biological chemical reactions In enzymatic reactions, the molecules at the beginning of the process are called

More information

Section 1 Lecture 1- Origins of Life Life probably started by Hydrothermal Vents.

Section 1 Lecture 1- Origins of Life Life probably started by Hydrothermal Vents. Section 1 Lecture 1- Origins of Life Life probably started by Hydrothermal Vents. Photosynthesis originated around 3GA, as cells figured out how to fix CO2 and release O2. Eukaryotes originates 1.5-2.5

More information

Review of Biochemistry

Review of Biochemistry Review of Biochemistry Chemical bond Functional Groups Amino Acid Protein Structure and Function Proteins are polymers of amino acids. Each amino acids in a protein contains a amino group, - NH 2,

More information

Name. The following exam contains 44 questions, valued at 2.6 points/question. 2. Which of the following is not a principal use of proteins?

Name. The following exam contains 44 questions, valued at 2.6 points/question. 2. Which of the following is not a principal use of proteins? Chemistry 131 Exam 3 Practice Proteins, Enzymes, and Carbohydrates Spring 2018 Name The following exam contains 44 questions, valued at 2.6 points/question 1. Which of the following is a protein? a. Amylase

More information

Find this material useful? You can help our team to keep this site up and bring you even more content consider donating via the link on our site.

Find this material useful? You can help our team to keep this site up and bring you even more content consider donating via the link on our site. Find this material useful? You can help our team to keep this site up and bring you even more content consider donating via the link on our site. Still having trouble understanding the material? Check

More information

Signal Transduction Cascades

Signal Transduction Cascades Signal Transduction Cascades Contents of this page: Kinases & phosphatases Protein Kinase A (camp-dependent protein kinase) G-protein signal cascade Structure of G-proteins Small GTP-binding proteins,

More information

Statement Starch Cellulose Glycogen glycosidic bonds present polymer of α-glucose unbranched chains only only found in plants

Statement Starch Cellulose Glycogen glycosidic bonds present polymer of α-glucose unbranched chains only only found in plants 1 The statements in the table below refer to three polysaccharide molecules. Complete the table. If the statement is correct, place a tick ( ) in the box and if the statement is incorrect place a cross

More information

Proteins. Amino acids, structure and function. The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka

Proteins. Amino acids, structure and function. The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka Proteins Amino acids, structure and function The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka O O HO N N HN OH Ser65-Tyr66-Gly67 The Nobel prize in chemistry 2008 Osamu Shimomura,

More information

Chapter 3. Table of Contents. Section 1 Carbon Compounds. Section 2 Molecules of Life. Biochemistry

Chapter 3. Table of Contents. Section 1 Carbon Compounds. Section 2 Molecules of Life. Biochemistry Biochemistry Table of Contents Section 1 Carbon Compounds Section 2 Molecules of Life Section 1 Carbon Compounds Objectives Distinguish between organic and inorganic compounds. Explain the importance of

More information