Dynamic changes of found in inflammatory zone 1 protein and mrna expression in the lung with experimental pulmonary fibrosis of the rat
|
|
- Rosalind French
- 5 years ago
- Views:
Transcription
1 Acta Physiologica Sinica, August 25, 2005, 57 (4): FIZZ1 mrna 1 2, * FIZZ1 (found in inflammatory zone 1) (5 mg/kg ) HE Masson FIZZ1 mrna (1) (7 d) (14~21 d)(28 d)(2) FIZZ1 7 d 14 d 7 d d (3) FIZZ1 mrna 7 d 14 d d FIZZ1 mrna FIZZ1 mrna Q593; R362; R563.1 Dynamic changes of found in inflammatory zone 1 protein and mrna expression in the lung with experimental pulmonary fibrosis of the rat MA Wan-Li 1, YE Hong 2,*, TAO Xiao-Nan 1, XIN Jian-Bao 1 1 Pulmonary Laboratory of Ministry of Health of China, Department of Respiratory Medicine, Union Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan , China; 2 Department of Pathophysiology, Tongji Medical College, Huazhong University of Science and Technology, Wuhan , China Abstract To investigate the role of found in inflammatory zone 1 (FIZZ1) protein in the pathogenesis of experimental pulmonary fibrosis, 48 male Sprague-Dawley rats were randomly divided into two groups, the pulmonary fibrosis group and the control group. Rat pulmonary fibrosis was reproduced by an intratracheal injection of bleomycin (5 mg/kg body weight). Normal saline (1 ml/kg body weight) was given intratracheally injection in the control group. There were 24 rats in each group, and 6 animals were separately killed on the 7 th, 14 th, 21 th and 28 th day after treated with bleomycin or normal saline. Then the following tests were undertaken: (1) HE and Masson staining of lung section; (2) Determination of lung tissue hydroxyproline (HYP); (3) Immunohistochemical staining of protein of FIZZ1 in the lung; (4) In situ hybridization of FIZZ1 mrna in the lung. The results showed: (1) There were full of inflammatory cells in the lung, the interval of alveoli enlarged and many alveolar spaces disappeared on the 7 th day after treated with bleomycin in the fibrosis group. Collagen began to proliferate after 14 d. The pulmonary fibrosis was stably established on the 28 th day, full of green fibers in the Masson staining of lung section. (2) The expression of FIZZ1 protein in the lung increased after 7 d in bleomycin-treated animals (3.013±0.326 vs 0.473±0.056, P<0.01 vs control), but was slightly decreased on the 14 th day (2.124±0.197) and expensively decreased on the 21 st day (1.760±0.105) and the 28 th day (0.691±0.081). (3) The expression of FIZZ1 mrna in the lung also increased after 7 d by treated with bleomycin (3.795±0.338 vs 0.678±0.087, P<0.01 vs control), but decreased on the 14 th day (1.276±0.104) and further Received Accepted * Corresponding author. Tel: ; yehongmwl@hotmail. com.
2 494 Acta Physiologica Sinica, August 25, 2005, 57(4): decreased on the 28 th day (0.896±0.084). The expression of FIZZ1 protein and mrna in fibrosis group was higher than that in the control group (P<0.05 or P<0.01). The results suggest that FIZZ1 protein and FIZZ1 mrna are dynamically changed in the lung with experimental pulmonary fibrosis, which may contribute to the pathogenesis of pulmonary fibrosis. Key words: pulmonary; fibrosis; found in inflammatory zone 1 FIZZ (found in inflammatory zone) 2000 [1] FIZZ1 FIZZ [2-5] FIZZ (serious acute respiratory syndrome, SARS) 28 FIZZ1 mrna FIZZ Sprague-Dawley ~230 g A5 FIZZ1 Santa Cruz (USA) FIZZ1 ( ) % 3 ml/kg 5 mg/kg A5 (1 ml/kg ) % HE Masson HE Masson 60 2 h HE Masson mol/l HCl h; 6 mol/l NaOH HCl; 1 mol/l NaOH 1 mol/l HCl ph r/min 10 min 1 ml 0.5 ml 0.05 mol/l T 1ml 20 min 3.15 mol/l ml 5 min 10% 1 ml min 560 nm (SABC ) FIZZ h PBS 3 min 3 0.3% Triton X min 3% H 2 O 2 15 min 10% 30 min 1:100 FIZZ1 37 1~2 h mol/l PBS 5 min 3 IgG min 0.01 mol/l PBS 5 min 3 SAB min 0.01 mol/l PBS 5 min 4 DAB FIZZ1 mrna FIZZ1 [6] FIZZ1 FIZZ1 mrna : 5'-GAAGT CCAGA ATGAA AATAT TTGCA ACTGC CTGTG C-3' 0.5% H 2 O 2 / h 20 µl
3 : FIZZ1 mrna SSC 0.2 SSC min 0.5 mol/l PBS 3 IgG min 0.5 mol/l PBS 3 BronchioliBC min 0.5 mol/l PBS 4 DAB Image Pro-Plus (A ) mean ± SD t HE Masson 7 d 14 d 7 d 21 d 28 d Masson HE Masson ( 1 1) 1. Table 1. Content of hydroxyproline (HYP) in the lung tissue (mean ± SD, n=24) (mg/g) Hydroxyproline (mg/g lung tissue) 7 d 14 d 21 d 28 d Control 2.31± ± ± ±0.04 Fibrosis 2.29± ±0.05 * 3.11±0.05 ** 3.85±0.05 ** 2.2 FIZZ1 FIZZ1 7 d 14 d 7 d 21 d 28 d FIZZ1 mrna FIZZ1 FIZZ1 mrna 7 d 14 d 21 d 28 d ( 3 2) 2. FIZZ1 Table 2. Results of immunohistochemical staining of FIZZ1 protein in the lung (A value, mean ± SD, n=24) FIZZ1 protein (A) 7 d 14 d 21 d 28 d Control 0.473± ± ± ±0.32 Fibrosis 3.013±0.326 ** ± ** 1.760±0.105 ** 0.691±0.081 * 3. FIZZ1 mrna Table 3. Results of in situ hybridization of FIZZ1 mrna in the lung (A value, mean ± SD, n=24) FIZZ1 mrna (A) 7 d 14 d 21 d 28 d Control 0.678± ± ± ±0.091 Fibrosis 3.795±0.338 ** 1.276±0.104 ** 1.003±0.110 * 0.896±0.084 *
4 496 Acta Physiologica Sinica, August 25, 2005, 57(4): HE Masson Fig. 1. HE and Masson staining in the lung of rat from different phases with experimental pulmonary fibrosis. A: HE, control. B: HE, d 7, alveolitis phase. C: Masson, d14, fibers proliferating phase, the green staining is fiber. D: Masson, d 28, pulmonary fibrosis, full of green staining fibers. Scale bar, 25 µm. 2. FIZZ1 mrna Fig. 2. In situ hybridization of FIZZ1 mrna in the lung of rat from different phases with experimental pulmonary fibrosis. A: Control, the brown staining is the positive of FIZZ1 mrna. B: d 7, alveolitis phase, expressions of FIZZ1 mrna obviously enhanced. C: d 14, fibers proliferating phase. D: d 28, pulmonary fibrosis. Scale bar, 25 µm.
5 : FIZZ1 mrna FIZZ 2000 N- ( 1-23) C- FIZZ1 found in inflammatory zone 1, FIZZ1 ( ) [1, 7] [2-5] FIZZ1 [1] ; FIZZ1 FIZZ1 [8] [9,10] 2004 FIZZ1 Liu FIZZ1 [4] FIZZ1 FIZZ1 α-actin I TGF-β FIZZ1 α-actin I FIZZ1 [4] HE Masson (7 d ) (14~21 d) (28 d) FIZZ1 mrna FIZZ1 mrna FIZZ1 FIZZ1 [4] FIZZ1 FIZZ1 Liu IL-4/IL-13 STAT- 6 FIZZ1 [5] FIZZ1 1 Holcomb IN, Kabakoff RC, Chan B, Baker TW, Gurney A, Henzel W, Nelson C, Lowman HB, Wright BD, Skelton NJ, Frantz GD, Tumas DB, Peale FV Jr, Shelton DL, Hebert CC. FIZZ1, a novel cysteine-rich secreted protein associated with pulmonary inflammation, defines a new gene family. EMBO J 2000; 19(15): Rajala MW, Lin Y, Ranalletta M, Yang XM, Qian H, Gingerich R, Barzilai N, Scherer PE. Cell type-specific expression and coregulation of murine resistin and resistin-like molecule-alpha in adipose tissue. Mol Endocrinol 2002; 16(8): Gerstmayer B, Kusters D, Gebel S, Muller T, Van Miert E, Hofmann K, Bosio A. Identification of RELMgamma, a novel resistin-like molecule with a distinct expression pattern. Genomics 2003; 81(6): Liu T, Dhanasekaran SM, Jin H, Hu B, Tomlins SA, Chinnaiyan AM, Phan SH. FIZZ1 stimulation of myofibroblast differentiation. Am J Pathol 2004; 164(4): Liu T, Jin H, Ullenbruch M, Hu B, Hashimoto N, Moore B, Mckenzie A, Lukacs NW, Phan SH. Regulation of found in inflammatory zone 1 expression in bleomycin-induced lung fibrosis: role of IL-4/IL-13 and mediation via STAT-6. J Immunol 2004; 173(5): Ye H, Ma WL, Yang ML, Liu SY, Wang DX. Effect of chronic cigarette smoking on large-conductance calcium-activated potassium channel and K v 1.5 expression in bronchial smooth muscle cells of rats. Acta Physiol Sin () 2004; 56 (5): Raes G, Baetselier PD, Noel W, Beschin A, Brombacher F, Hassanzadeh Gh G. Differential expression of FIZZ1 and Ym1 in alternatively versus classically activated macrophages. J Leukoc Biol 2002; 71(4): Teng X, Li D, Champion HC, Johns RA. FIZZ1/RELM/ RELMa, a novel hypoxia-induced mitogenic factor in lung with vasoconstrictive and angiogenic properties. Circ Res 2003; 92(10): Streiter RM. Inflammatory mechanisms are not a minor component of the pathogenesis of idiopathic pulmonary fibrosis. Am J Respir Crit Care Med 2002; 165(9): Xu Y, Hua J, Mui A, O Connor R, Grotendorst G, Khalil N. Release of biologically active TGF-beta1 by alveolar epithelial cells results in pulmonary fibrosis. Am J Physiol Lung Cell Mol Physiol 2003; 285(3): L527-L539.
Kun Jiang 1, He-Bin Chen 1, Ying Wang 1, Jia-Hui Lin 2, Yan Hu 1, Yu-Rong Fang 1
Original Article Changes in interleukin-17 and transforming growth factor beta 1 levels in serum and bronchoalveolar lavage fluid and their clinical significance among children with asthma Kun Jiang 1,
More informationPregnanolone effects on the blood pressure of stress-induced hypertension in rats
Acta Physiologica Sinica August June 25 25 2004 2004 56 56 (3) (4) 269-274 471-475 http//www.actaps.com.cn 471 * 130021 (pregnanolone ) (stress-induced hypertension SIH) (0.24 mg/kg) (angiotensin Ang )
More informationEXPERIMENTAL AND THERAPEUTIC MEDICINE 7: , 2014
EXPERIMENTAL AND THERAPEUTIC MEDICINE 7: 669-674, 2014 Function of the transforming growth factor β1/c Jun N terminal kinase signaling pathway in the action of thalidomide on a rat model of pulmonary fibrosis
More informationEuropean Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1
PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:
More informationMarkers of macrophage differentiation in experimental silicosis
Markers of macrophage differentiation in experimental silicosis Pierre Misson, 1 Sybille van den Brûle, Virginie Barbarin, Dominique Lison, and François Huaux Unit of Industrial Toxicology and Occupational
More informationSupplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function
Supplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function Guoying Yu 1*, Argyris Tzouvelekis 1,2*, Rong Wang 1,3, Jose D. Herazo-Maya
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationC5b - 9 NO TNF 3. ( anti - thymocyte serum nephritis, ATSN) ( mesangial proliferative glomerulonephritis, MPGN)
54 Chinese Journal of Pathophysiology 2004,20 (1) :54-59 [ ] 1000-4718 (2004) 01-0054 - 06 C5b - 9 NO TNF 3 1, 1, 2, 2 ( 1, 210029 ; 2, 221002) [ ] : (ATSN) C5b - 9 : (NO) ( TNF ) : (ATS) ATSN,ATSN C5b
More informationRole of Inflammation in Pulmonary Hypertension
Role of Inflammation in Pulmonary Hypertension K. R. Stenmark University of Colorado Denver, USA Prominent Fibroproliferative Changes are Observed in the Lung Vasculature of Infants With Pulmonary Arterial
More information(A) [DOI] /j.issn
Med J Chin PLA, Vol. 41, No. 3, March 1, 2016 175 [ ] 30 SD 5 (A) (B) (C) (D) (E) 0.206 0.514 1.028mg/(kg d) ELISA HE Masson (TGF- ) 9(MMP-9) C D E A B (P
More informationKD025 in IPF: Topline Results
KD025 in IPF: Topline Results Webcast Presentation February 13, 2018 Kadmon Holdings, Inc. 1 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs
More informationAn essential role for CCAAT/enhancer binding protein β in bleomycin-induced pulmonary fibrosis
Journal of Pathology J Pathol 2007; 211: 455 462 Published online 18 December 2006 in Wiley InterScience (www.interscience.wiley.com) DOI: 10.1002/path.2119 Original Paper An essential role for CCAAT/enhancer
More informationRole of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress
3/1/212 Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies K.R. Stenmark University of Colorado Denver, CO 845 Prominent Fibroproliferative
More informationCYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt
Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,
More informationEffect of compound Maqin decoction on TGF-β1/Smad proteins and IL-10 and IL-17 content in lung tissue of asthmatic rats
Effect of compound Maqin decoction on TGF-β1/Smad proteins and IL-10 and IL-17 content in lung tissue of asthmatic rats Y.H. Xie, X.P. Li, Z.X. Xu, P. Qian, X.L. Li and Y.Q. Wang Staff Room of Diagnosis,
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationOriginal Article Dexamethasone attenuates bleomycin-induced lung fibrosis in mice through TGF-β, Smad3 and JAK-STAT pathway
Int J Clin Exp Med 2014;7(9):2645-2650 www.ijcem.com /ISSN:1940-5901/IJCEM0001498 Original Article Dexamethasone attenuates bleomycin-induced lung fibrosis in mice through TGF-β, Smad3 and JAK-STAT pathway
More informationThe Infcuence of Yiqi Huoxue Jiedu Formula on Early Adventitial Inflammation and Vascular Remodeling after Vascular Injury
/ 7d HE 1 MCP 1 CD68 P 0.01 P 0.05 CD68 P 0.05 P 0.05 CD68 P 0.01P 0.05 The Infcuence of Yiqi Huoxue Jiedu Formula on Early Adventitial Inflammation and Vascular Remodeling after Vascular Injury Yang Ruixue
More informationLung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy
7th to 10th Nov. 2016 Minatec-Grenoble, France. Lung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy Balasubramanayam Annangi bala.annangi@inserm.fr 10 th
More informationRestrictive lung diseases
Restrictive lung diseases Restrictive lung diseases are diseases that affect the interstitium of the lung. Interstitium of the lung is the very thin walls surrounding the alveoli, it s formed of epithelium
More informationEffect of High-fat or High-glucose Diet on Obesity and Visceral Adipose Tissue in Mice
ACTA ACADEMIAE MEDICINAE SINICAE 410011 0731-85295846 lixia2014@vip. 163. com 4 C57BL /6 20-1 mrna 20 P < 0. 05 O 20 P > 0. 05 M2 P < 0. 05-1 mrna P < 0. 05 P > 0. 05 R589. 2 DOI 10. 3881 /j. issn. 1000-503X.
More informationKD : A Phase 2 Trial of KD025 to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF)
-207: A Phase 2 Trial of to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF) K. F. Gibson 1, F. Averill 2, T.E. Albertson 3, D. M. Baratz 4, S. Chaudhary 5,
More informationOriginal Article Dexamethasone suppresses bleomycin-induced pulmonary fibrosis via down-regulation of jagged1/notch1 signaling pathway
Int J Clin Exp Med 2016;9(2):2897-2904 www.ijcem.com /ISSN:1940-5901/IJCEM0015039 Original Article Dexamethasone suppresses bleomycin-induced pulmonary fibrosis via down-regulation of jagged1/notch1 signaling
More informationRole of cyclooxygenase-2 in H5N1 viral pathogenesis and the potential use of its inhibitors
Title Role of cyclooxygenase-2 in HN viral pathogenesis and the potential use of its inhibitors Author(s) Lee, MY; Cheung, CY; Peiris, JSM Citation Hong Kong Medical Journal, 2, v. 9 n. Suppl. 4, p. 29-
More informationOriginal Article TLR4 contributes to mechanical ventilation induced lung injury in the rabbits
Int J Clin Exp Pathol 2017;10(4):4700-4704 www.ijcep.com /ISSN:1936-2625/IJCEP0040416 Original Article TLR4 contributes to mechanical ventilation induced lung injury in the rabbits Hongmei Zhang 1, Pei
More informationLi et al. Journal of Experimental & Clinical Cancer Research (2018) 37:108
Li et al. Journal of Experimental & Clinical Cancer Research (2018) 37:108 https://doi.org/10.1186/s13046-018-0774-7 CORRECTION Correction to: Novel smac mimetic APG- 1387 elicits ovarian cancer cell killing
More informationAirway Inflammation in Asthma Chih-Yung Chiu 1,2, Kin-Sun Wong 2 1 Department of Pediatrics, Chang Gung Memorial Hospital, Keelung, Taiwan.
REVIEW ARTICLE Chih-Yung Chiu 1,2, Kin-Sun Wong 2 1 Department of Pediatrics, Chang Gung Memorial Hospital, Keelung, Taiwan. 2 Division of Pediatric Pulmonology, Department of Pediatrics, Chang Gung Memorial
More informationIKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung
IKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung Se-Ran Yang, Samantha Valvo, Hongwei Yao, Aruna Kode, Saravanan Rajendrasozhan, Indika Edirisinghe, Samuel
More informationAnalysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients
Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients S. Yang, B. Chen, J. Shi, F. Chen, J. Zhang and Z. Sun Department of Nephrology, Huaihe Hospital
More informationSupporting Information
Supporting Information Rock et al. 10.1073/pnas.1117988108 Fig. S1. Heterogeneity of stromal cells in normal and fibrotic mouse lungs. Sections of normal mouse lungs (A and D) and fibrotic lungs collected
More informationSupplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al
Supplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al Suppl. Fig. 1 Tissue DN C Proteins kd TSC1-17 TSC 1 loxp bp -48-285 ctin PEMs Neutrophils
More informationDioscin Exerts Protective Effects Against Crystalline Silica-induced Pulmonary Fibrosis in Mice
Ivyspring International Publisher 4255 Theranostics Research Paper 2017; 7(17): 4255-4275. doi: 10.7150/thno.20270 Dioscin Exerts Protective Effects Against Crystalline Silica-induced Pulmonary Fibrosis
More informationAstragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced
Astragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced colitis implicating regulation of energy metabolism Xu-Guang Jiang 1,2,, Kai Sun 1,3,4,5,, Yu-Ying Liu 1,4,5, Li Yan 1,4,5,
More informationOriginal article: DEXMEDETOMIDINE INHIBITS INFLAMMATION IN MICROGLIA CELLS UNDER STIMULATION OF LPS AND ATP BY C-FOS/NLRP3/CASPASE-1 CASCADES
Supplementary material to Original article: DEXMEDETOMIDINE INHIBITS INFLAMMATION IN MICROGLIA CELLS UNDER STIMULATION OF LPS AND ATP BY C-FOS/NLRP3/CASPASE-1 CASCADES Hu Li 1, Xueping Zhang 2, Mingfu
More informationImmunological Lung Diseases
Emphysema and Fibrosis Universitätsklinik für Pneumologie Prof. Thomas Geiser Head Div. of Pulmonary Medicine and Laboratory of Lung Research, MU50 thomas.geiser@insel.ch The healthy lung: The pathway
More informationToll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice
Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice X.X. Li 1,2, D.Y. Jiang 1, X.X. Huang 1, S.L. Guo 1, W. Yuan 1 and H.P. Dai 1 1 Beijing Key Laboratory of Respiratory and
More informationIn Vivo Models and Cell Delivery for Lung Indications NO DISCLOSURES
In Vivo Models and Cell Delivery for Lung Indications Marlowe Eldridge MD Department of Pediatrics and Biomedical Engineering University of Wisconsin School of Medicine and Public Health NO DISCLOSURES
More informationConnective Tissue Response in IBD
Connective Tissue Response in IBD Dr I C Lawrance MB BS, PhD FRACP School of Medicine and Pharmacology, University of Western Australia, Fremantle Hospital Intestinal response to Chronic Inflammation Control
More informationPreparation of Liposome Containing Bacteriorhodopsin with Natural. Preferred Orientation of Its Transient Photoresponse
ISSN 0582-9879 ACTA BIOCHIMICA et BIOPHYSICA SINICA 2003, 35(4): 391-395 CN 31-1300/Q Preparation of Liposome Containing Bacteriorhodopsin with Natural Preferred Orientation of Its Transient Photoresponse
More informationAbhd2 regulates alveolar type Ⅱ apoptosis and airway smooth muscle remodeling: a key target of COPD research
Abhd2 regulates alveolar type Ⅱ apoptosis and airway smooth muscle remodeling: a key target of COPD research Shoude Jin Harbin Medical University, China Background COPD ------ a silent killer Insidious,
More informationMEK/ERK INHIBITORS: A PROOF-OF-CONCEPT STUDY IN LUNG FIBROSIS
MEK/ERK INHIBITORS: A PROOF-OF-CONCEPT STUDY IN LUNG FIBROSIS Andrew Leask Departments of Dentistry and Physiology and Pharmacology University of Western Ontario Dental Sciences Building London ON Canada
More informationMOLECULAR MEDICINE REPORTS 10: 39-44, 2014
MOLECULAR MEDICINE REPORTS 10: 39-44, 2014 Epithelial mesenchymal transition and apoptosis of renal tubular epithelial cells are associated with disease progression in patients with IgA nephropathy JUNXIA
More informationSupplemental Table 1: Demographics and characteristics of study participants. Male, n (%) 3 (20%) 6 (50%) Age, years [mean ± SD] 33.3 ± ± 9.
SUPPLEMENTAL DATA Supplemental Table 1: Demographics and characteristics of study participants Lean (n=15) Obese (n=12) Male, n (%) 3 (20%) 6 (50%) Age, years [mean ± SD] 33.3 ± 9.5 44.8 ± 9.1 White, n
More informationThis article is protected by copyright. All rights reserved.
Coates edited INVITED COMMENTARY Fibroblast Growth Factors and Pulmonary Fibrosis: It s more complex than it sounds Running Title: Pleiotropic actions of FGFs in lung fibrosis Authors: Kevin K. Kim*, Thomas
More informationBIOMEDICAL SCIENCES GRADUATE PROGRAM SUMMER 2014
THE OHIO STATE UNIVERSITY BIOMEDICAL SCIENCES GRADUATE PROGRAM SUMMER 2014 Jessica Rose Napolitano PhD Candidate Examination of the role of ZIP8 and cadmium in the development of Chronic Obstructive Pulmonary
More informationGreen tea extract Its potential protective effect on bleomycin induced lung injuries in rats
Green tea extract Its potential protective effect on bleomycin induced lung injuries in rats Azza H. EL-Medany, Jamila EL-Medany The interest in the use of plant extracts in the treatment of several diseases
More informationRapid Detection of Milk Protein based on Proteolysis Catalyzed by Trypsinase
Rapid Detection of Milk Protein based on Proteolysis Catalyzed by Trypsinase Yafeng Chen Institute of Food Quality and Safety, University of Shanghai for Science and Technology Shanghai 93, China Email:cyfxy498@6.com
More informationCaffeine Modulates Hyperoxia - Induced Angiogenesis in Newborn Mice
Caffeine Modulates Hyperoxia - Induced Angiogenesis in Newborn Mice Vikramaditya Dumpa, MD Lori C Nielsen, MS Huamei Wang, MD Vasanth HS Kumar, MD Supported by AAP Marshall Klaus Perinatal Research Grant
More informationUncovering the mechanisms of wound healing and fibrosis
Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:
More informationSeasonal and geographical dispersal regularity of airborne pollens in China LI Quan-sheng, JIANG Sheng-xue, LI Xin-ze, ZHU Xiao-ming, WEI Qing-yu *
Med J Chin PLA, Vol. 42, No. 11, November 1, 2017 951 [] [ ] [ ] R562.25[ ] A[] 0177-7402(2017)11-0951-05 [DOI] 10.11855/j.issn.0577-7402.2017.11.03 Seasonal and geographical dispersal regularity of airborne
More informationRole of Tyk-2 in Th9 and Th17 cells in allergic asthma
Supplementary File Role of Tyk-2 in Th9 and Th17 cells in allergic asthma Caroline Übel 1*, Anna Graser 1*, Sonja Koch 1, Ralf J. Rieker 2, Hans A. Lehr 3, Mathias Müller 4 and Susetta Finotto 1** 1 Laboratory
More informationRespiratory Toxicology
Respiratory Toxicology Loch-Caruso ENVIRON 310 2017 1 Breathing Oxygen Carbon Dioxide http://www.webmd.com/lung/picture-of-the-lungs Loch-Caruso ENVIRON 310 2017 2 Breathing Enlarged view of the airways,
More informationDietary α-linolenic acid-rich flaxseed oil prevents against alcoholic hepatic steatosis
Dietary α-linolenic acid-rich flaxseed oil prevents against alcoholic hepatic steatosis via ameliorating lipid homeostasis at adipose tissue-liver axis in mice Meng Wang a, Xiao-Jing Zhang a, Kun Feng
More informationSmall Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment
Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure:
More informationSupporting Information
Supporting Information M1 macrophage-derived nanovesicles potentiate the anticancer efficacy of immune checkpoint inhibitors Yeon Woong Choo, 1, Mikyung Kang, 2, Han Young Kim, 1 Jin Han, 1 Seokyung Kang,
More informationDiagnosis and Management of Fungal Allergy Monday, 9-139
Diagnosis and Management of Fungal Allergy Monday, 9-139 13-2010 Alan P. Knutsen,, MD Director, Pediatric Allergy & Immunology Director, Jeffrey Modell Diagnostic Center for Primary Immunodeficiencies
More informationSupplementary Information
Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1
More informationN Khalil, T V Parekh, R O Connor, N Antman, W Kepron, T Yehaulaeshet, Y D Xu, L I Gold
Thorax 2001;56:907 915 907 Regulation of the evects of TGF-β1 by activation of latent TGF-β1 and diverential expression of TGF-β receptors (TβR-I and TβR-II) in idiopathic pulmonary fibrosis N Khalil,
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationVenous thrombo-embolism in people with idiopathic pulmonary fibrosis: a population based study
Venous thrombo-embolism in people with idiopathic pulmonary fibrosis: a population based study Authors: William Dalleywater 1, Helen A Powell 1,,2, Andrew W Fogarty 1, Richard B Hubbard 1, Vidya Navaratnam
More informationhttp / / cjbmb. bjmu. edu. cn Chinese Journal of Biochemistry and Molecular Biology COX-2 NTera-2 NTera-2 RT-PCR FasL caspase-8 caspase-3 PARP.
ISSN 1007-7626 CN 11-3870 / Q http / / cjbmb bjmu edu cn Chinese Journal of Biochemistry and Molecular Biology 2012 7 28 7 630 ~ 636 NTera-2 ** ** * 410081 COX-2 NTera-2 MTT NTera-2 NTera-2 Hoechest 33258
More information( 2smooth muscle actin, 2SM actin)
UV2C 234, 1999 4, 51 (2), 234 239 Acta Physiologica Sinica 3 (, 510315) (220 W, 220 V, 50 Hz) UV2C (254 nm), 10 cm (smooth muscle cells, SM2 Cs),, ; / ; DNA UV2C SMCs SMCs : ; ; ; : Q2233 (smooth muscle
More informationUnderstanding the mechanisms of asbestos related diseases
University of Hawai i Cancer Center Understanding the mechanisms of asbestos related diseases Haining Yang, PhD Professor University of Hawai i Cancer Center Marker of exposure: Bilateral pleural plaques
More informationChanges in circadian sleep-wake and rest-activity rhythms during different phases of menstrual cycle
Acta Physiologica Sinica, June 25, 2005, 57 (3): 389-394 http://www.actaps.com.cn 389 - - 1 2 2 1,* 1 230022; 2 230027 - - - - - (actigraphy) 12 - - - (24.01±0.29) h ( interdaily stability, IS) (P
More informationBile Acids and Liver Fibrosis Causative Agent and Therapeutic Tool
Bile Acids and Liver Fibrosis Causative Agent and Therapeutic Tool Peter Fickert, Andrea Fuchsbichler, Tarek Moustafa, Gernot Zollner, Emina Halilbasic, Ulrike Stöger, Cord Langner, Helmut Denk, and Michael
More informationFamilial PAH. Genetics and pulmonary arterial hypertension. PAH and mutations in the bone morphogenetic protein type II receptor (BMPR-II)
athology of vascular lesions in idiopathic pulmonary arterial hypertension Genetics and pulmonary arterial hypertension Concentric intimal lesion Nick Morrell British Heart Foundation rofessor of Cardiopulmonary
More informationRegulatory B cells in autoimmunity. Liwei Lu University of Hong Kong, China
Regulatory B cells in autoimmunity Liwei Lu University of Hong Kong, China Multiple functions of B cells in immunity LeBien and Tedder, Blood (2008) B cell functions in autoimmune pathogenesis The Immunopathogensis
More informationSupplementary Figures
Inhibition of Pulmonary Anti Bacterial Defense by IFN γ During Recovery from Influenza Infection By Keer Sun and Dennis W. Metzger Supplementary Figures d a Ly6G Percentage survival f 1 75 5 1 25 1 5 1
More informationLung Diseases of the Newborn
Lung Diseases of the Newborn PD Dr. med. Anne Hilgendorff Comprehensive Pneumology Center Perinatal Center LMU ispz Hauner Ludwig-Maximilians University und Helmholtz Zentrum München Prematurity 1 % of
More informationBin Liu, Lei Yang, Binfang Huang, Mei Cheng, Hui Wang, Yinyan Li, Dongsheng Huang, Jian Zheng,
The American Journal of Human Genetics, Volume 91 Supplemental Data A Functional Copy-Number Variation in MAPKAPK2 Predicts Risk and Survival of Lung Cancer Bin Liu, Lei Yang, Binfang Huang, Mei Cheng,
More informationClinical trial of brain-protective effect of nalmefene hydrochloride in patients with acute traumatic
DOI:10.16636/j.cnki.jinn.2014.02.006 Journal of International Neurology and Neurosurgery 1 2 2 1. 410004 2. 410008 β- β-ep DynA1-13 NSE 40 20 1 2 3 5 7 10 β-ep DynA1-13 NSE 3 GOS β-ep DynA1-13 NSE β-ep
More informationMitosis. Single Nano Micro Milli Macro. Primary. PCNA expression
a b c DAPI YFP CC3 DAPI YFP PCNA DAPI YFP ph3 DAPI YFP KI67 e 6 Mitosis f 1 PCNA expression %ph3 + /YFP + n= 63 87 61 3 13 8 n= 15 3 9 1 5 %PCNA+/YFP+ 8 6 Supplementary Figure 1. Proliferation/apoptosis
More informationEffect of qidan granule and tetrandrine on the information transmission channel of TGF-β1-smads for silicosis fibrosis.
Biomedical Research 2017; 28 (4): 1693-1700 ISSN 0970-938X www.biomedres.info Effect of qidan granule and tetrandrine on the information transmission channel of TGF-β1-smads for silicosis fibrosis. Zhang
More informationSearching for Targets to Control Asthma
Searching for Targets to Control Asthma Timothy Craig Distinguished Educator Professor Medicine and Pediatrics Penn State University Hershey, PA, USA Inflammation and Remodeling in Asthma The most important
More informationRespiratory Physiology
Respiratory Physiology Dr. Aida Korish Associate Prof. Physiology KSU The main goal of respiration is to 1-Provide oxygen to tissues 2- Remove CO2 from the body. Respiratory system consists of: Passages
More informationJournal of ChineseMedicinalMaterials H 2 O 2. Effects of EGb 761 on the Cell Apoptosis Induced by H 2 O 2 in R IN 2m Beta Cells
424 H 2 O 2 R IN2m,,, (, 510632) : ( Ginkgo biloba extract, EGb761) (Hydrogen peroxide, H 2 O 2 ) RIN2m : 500 mol/l H 2 O 2 RIN2m 6h ; (Control) (H 2 O 2 ) ( Que 100 mol/l) EGb 761 ( EGb 761 100 mol/l),
More informationStructural and Functional Analysis of Mouse Hypoxia2induced Mitogenic Factor Promoter
ISSN 100727626 CN 1123870ΠQ Chinese Journal of Biochemistry and Molecular Biology 2008 8 24 (8) :735 741 1), 2) 3, 2), 2), 2), 2), 3) ( 1), 2), 3), 430022) (hypoxia2induced mitogenic factor, HIMF),, HIMF.
More informationP ulmonary fibrosis is the end stage of a heterogeneous
765 INTERSTITIAL LUNG DISEASE Short course dexamethasone treatment following injury inhibits bleomycin induced fibrosis in rats W A Dik, R J McAnulty, M A Versnel, BAENaber, LJIZimmermann, G J Laurent,
More informationSuberoylanilide hydroxamic acid attenuates paraquat-induced pulmonary fibrosis by preventing Smad7 from deacetylation in rats
Original Article Suberoylanilide hydroxamic acid attenuates paraquat-induced pulmonary fibrosis by preventing Smad7 from deacetylation in rats Shan-Shan Rao 1, Xiang-Yan Zhang 2,3, Ming-Jun Shi 1, Ying
More informationSupporting Information
Supporting Information Idoyaga et al. 10.1073/pnas.0812247106 SSC a) Single cell suspension 99 Aqua b) Live cells 96 -W c) Singlets 92 -A CD19+ER119 d) CD19 ER119 cells 97 CD3 e) CD3 cells 27 f) DX5 cells
More information15-lipoxygenases and their metabolites as biomarkers for the early detection of smoking-induced non-small cell lung cancer
15-lipoxygenases and their metabolites as biomarkers for the early detection of smoking-induced non-small cell lung cancer George G Chen Department of Surgery, Cancer Centre, Faculty of Medicine, The Chinese
More informationRespiratory System. Organization of the Respiratory System
Respiratory System In addition to the provision of oxygen and elimination of carbon dioxide, the respiratory system serves other functions, as listed in (Table 15 1). Respiration has two quite different
More informationSupplementary Information:
Supplementary Information: Follicular regulatory T cells with Bcl6 expression suppress germinal center reactions by Yeonseok Chung, Shinya Tanaka, Fuliang Chu, Roza Nurieva, Gustavo J. Martinez, Seema
More informationElectronic Supplementary Information (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2012
Electronic Supplementary Information (ESI) for Lab on a Chip Electronic Supplementary Information Construction of oxygen and chemical concentration gradients in a single microfluidic device for studying
More informationMing Zeng 1, Bin Liao 2, Chen Zhu 1, Wenjun Wang 1, Xiaoqin Zhan 1 and Xianming Fan 1, 3
Cellular & Molecular Immunology 219 Article Aerosolized STAT1 Antisense Oligodeoxynucleotides Decrease the Concentrations of Inflammatory Mediators in Bronchoalveolar Lavage Fluid in Bleomycin-Induced
More informationLymphoid System: cells of the immune system. Answer Sheet
Lymphoid System: cells of the immune system Answer Sheet Q1 Which areas of the lymph node have most CD3 staining? A1 Most CD3 staining is present in the paracortex (T cell areas). This is towards the outside
More informationAn excessive increase in glutamate contributes to glucose-toxicity in. β-cells via activation of pancreatic NMDA receptors in rodent diabetes
An excessive increase in glutamate contributes to glucose-toxicity in β-cells via activation of pancreatic NMDA receptors in rodent diabetes Xiao-Ting Huang 1, Chen Li 1,3, Xiang-Ping Peng 1, Jia Guo 1,5,
More informationH1N1 H7N9. Clinical analysis of severe avian influenza H7N9 and severe influenza A H1N1
DOI 10.16047/j.cnki.cn14-1300/r.2018.04.004 2018-05-08 11:56:58 http://kns.cnki.net/kcms/detail/14.1300.r.20180508.1156.008.html 254 Proceeding of Clinical Medicine Apr. 2018 Vol 27 No. 4 J. 2012 13 2
More informationPostnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter
Postnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter Comparative Biosciences, Inc 786 Lucerne Drive Sunnyvale,
More informationThe FDA Critical Path Initiative
The FDA Critical Path Initiative Clinical Considerations for Demonstration of Dose-response for Inhaled Corticosteroids - Exhaled Nitric Oxide Model Badrul A. Chowdhury, MD, PhD Director Division of Pulmonary
More informationInduced sputum to assess airway inflammation: a study of reproducibility
Clinical and Experimental Allergy. 1997. Volume 27. pages 1138-1144 Induced sputum to assess airway inflammation: a study of reproducibility A. SPANEVELLO, G. B. MIGLIORI. A. SHARARA*, L. BALLARDlNIt,
More informationACR Meeting November, 2012
ACR Meeting November, 212 Arhalofenate is a Novel Dual-Acting Agent with Uricosuric and Anti-Inflammatory Properties Yun-Jung Choi, Vanina Larroca, Annette Lucman, Vic Vicena, Noe Abarca, Tim Rantz, Brian
More informationInterleukin-20 is associated with delayed healing in diabetic wounds
Interleukin-20 is associated with delayed healing in diabetic wounds Phillip Finley, PhD Integrated and Applied Sciences Program Biology and Statistics/Research Methodology Normal Healing Body s natural
More informationBasic mechanisms disturbing lung function and gas exchange
Basic mechanisms disturbing lung function and gas exchange Blagoi Marinov, MD, PhD Pathophysiology Department, Medical University of Plovdiv Respiratory system 1 Control of breathing Structure of the lungs
More informationTissue and Fluid Proteomics Chao-Cheng (Sam) Wang
Tissue and Fluid Proteomics Chao-Cheng (Sam) Wang UAB-03/09/2004 What is proteomics? A snap shot of the protein pattern!! What can proteomics do? To provide information on functional networks and/or involvement
More informationRelationship between renal injury and the antagonistic roles of angiotensin-converting enzyme (ACE) and ACE2
Relationship between renal injury and the antagonistic roles of angiotensin-converting enzyme (ACE) and ACE2 C. Ma, H. Xin, X.-Y. Jiang, Y.-X. Wang and Y.-S. Zhang Key Laboratory of Animal Physiology and
More informationGrowth Factor Circuitry in Vascular Morphogenesis. Lung Development
Growth Factor Circuitry in Vascular Morphogenesis Margaret Schwarz, MD Associate Professor Lung Development PECAM-1 Vascular Mediators VEGF ECM Adhesion molecules Anti-angiogenic Factors Fate Specification
More informationAbstract. IgE. IgE Th2. x x IL-4 IL-5 IgE CD4 +
D. o ƒf 6,''!" # + % %$ '& ' '' & " k n k x k k k k k x k IgE k x IgE Ò1Ó k Ò2Ó v k x IgE Th2 x } x x IL-4 IL-5 IgE IgE j IFN-γ IgG j j CD4 + { k d «d j B7 w k k x IgE k 1 k Abstract Parental immunization
More informationEngineering of Ministry of Education, Institute of Molecular Science, Shanxi University, Taiyuan , China.
Indicator approach to develop a chemosensor for the colorimetric sensing of thiol-containing in water and its application for the thiol detection in plasma Fang-Jun Huo, a Yu-Tao Yang, b Jing Su, b Yuan-Qiang
More informationDetection of Inflammation and Parenchymal Damage Using Precision-cut Lung Slices
Detection of Inflammation and Parenchymal Damage Using Precision-cut Lung Slices Holger P. Behrsing, Ph.D. Principal Scientist Inhalation Toxicology Program 1 Presentation Outline Disclaimer History and
More information