Post-translational Modifications to Human Bile Acid CoA:Amino Acid N- acyltransferase

Size: px
Start display at page:

Download "Post-translational Modifications to Human Bile Acid CoA:Amino Acid N- acyltransferase"

Transcription

1 Post-translational Modifications to uman Bile Acid oa:amino Acid - acyltransferase Erin Shonsey UAB Graduate Student September 12, 2006

2 onjugation of Bile Acids SoA S 3 - hbat oa-s 2 2 S - 3 (Amidate, -holyltaurine) (A)

3 atalytic Triad of BAT Various mutation and other studies performed previously led to the hypothesis that BAT works through a catalytic triad The members of this catalytic triad are believed to be ys235, is362, and Asp328

4 harge Relay Mechanism shared by hbat, thioesterases, and a large group of hydrolases ys 235 is 362 ys 235 is 362 Bile acid S S ---- oa. ucleophilic attack Michaelis complex Asp S Bile acid S oa - Tetrahedral intermediate Asp 328 ys 235 (Ser235) 2 is 362 R 2 S 4 Gly or Tau ( 2 ) Gly or Tau 3 oa ys S R S Acyl-enzyme intermediate oa Asp 328 ys 235 ys 235 is 362 R - 2 S 5 Gly or Tau Gly or Tau Bile acid Bile acid conjugate + S Active enzyme - Asp 328

5 MALDI-TF MS Analysis of hbat-avi/cholic acid intermediate Mass (m/z)

6 Deconvoluted Q-TF MS Analysis of hbat- Avi/cholic acid intermediate Da mass

7 Amino Acids Modified by 4E 4E-Modified Lysine Michael Addition 4E-Modified ysteine S Michael Addition Adduct Michael Schiff base Pentylpyrrole 4E-Modified Lysine Schiff Base Adduct Mol wt J Am Soc Mass Spectrom Aug;15(8): E-Modified Lysine 2-Pentylpyrrole Adduct 4E-Modified istidine Michael Addition

8 Potential 4E targets in hbat MIQLTATPVSALVDEPVIRATGLIPFQMVSFQASLEDEGDMF YSQAYRAEFGEVDLASSLGGDYMGVPMGLFWSLKPEKLL TRLLKRDVMRPFQVQVKLYDLELIVKVASAPKASLTLERWY VAPGVTRIKVREGRLRGALFLPPGEGLFPGVIDLFGGLGGLLEF RASLLASRGFASLALAYYEDLPRKPEVTDLEYFEEAAFLLR PKVFGSGVGVVSVQGVQIGLSMAIYLKQVTATVLIGTFPF GIPQVYGQIQPLPSAQLISTALGLLELYRTFETTQVGASQ YLFPIEEAQGQFLFIVGEGDKTISKAAEQAIGQLKRGKW TLLSYPGAGLIEPPYSPLASTTDLRLWGGEVIPAAAQE AWKEIQRFLRKLIPDVTSQL 17 is 16 Lys 19 Arg 3 ys

9 In vitro Modification of hbat with E hbat + E Incubate at 4 for 1 hour E treated hbat + E treated hbat E modified hbat Incubate at 37 overnight Mix with matrix and spot on MALDI plate 100 % Intensity Mass (m/z)

10 Inactivation of hbat by E 120 % Residual Activity control E oncentration (µm) 1.6µM hbat

11 MALDI-TF MS of hymotrypsin Digest of E modified hbat ative hbat Modified hbat Mass (m/z)

12 istidine Residues Modified by 1 mm E Found by QTF Residue umbers Sequence Unmodified Mass Modified Mass Mass Shift GFASLALAYYEDLPR GQIQPLPSAQ GQIQPLPSAQ AAEQAIGQLK LWGGEVIPAAAQEAWK

13 MS/MS Spectra Using ID of [M] M I Q L T A T P V S A L V D E P V I R [M+2] 2+ - E Michael adduct y 8 y 10 b 13 b 9 b y7 5 b 3 b y 5 7 y 6 b 6 y 9 b 12 b 14 y 11 b 15 y 13 y 12 y 14 y 15 b 17 y m/z

14 Electron apture Dissociation urr pin Biotechnol Feb;15(1):12-6.

15 ED Fragmentation y 3 z 3 z 2 z 1 R1 R2 R3 R4 + b 1 c 1 c 2 c 3

16 MS/MS Spectra Using ED of [M] A A E Q A I G Q L K R [M+3] 3+ [M+2] 2+ ~ x 5 c 5 z 8 c 3 c 4 c z 7 c z 2 8 c 11 1 z 3 z 4 c 6 z c c 7 9 c m/z

17 Sequence overage Using FT-IR/MS MIQLTATPVSALVDEPVIRATGLIPFQMVSFQASL EDEGDMFYSQAYRAEFGEVDLASSLGGDYMG VPMGLFWSLKPEKLLTRLLKRDVMRPFQVQVKLY DLELIVKVASAPKASLTLERWYVAPGVTRIKVRE GRLRGALFLPPGEGLFPGVIDLFGGLGGLLEFRASL LASRGFASLALAYYEDLPRKPEVTDLEYFEEAA FLLRPKVFGSGVGVVSVQGVQIGLSMAIYLKQVT ATVLIGTFPFGIPQVYGQIQPLPSAQLIST ALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIV GEGDKTISKAAEQAIGQLKRGKWTLLSYPGA GLIEPPYSPLASTTDLRLWGGEVIPAAAQE AWKEIQRFLRKLIPDVTSQL 70.1% Sequence overage

18 Amino Acids Modified by E Using FT-IR/MS Peptide 128 µm E Modified Amino Acid 64 µm E 32 µm E 16 µm E 8 µm E AAEQAIGQLKR RLWGGEVIPAAAQEAWK AQGQFLFIVGEGDKTISK 397 K329, K K329, K K329, K K329, K334 K329, K334 MIQLTATPVSALVDEPVIR RAEFGEVDLASSLGGDYMGVPMGLFWSLKPEK 1*156 WTLLSYPGAGLIEPPYSPLASTTDLR 362, 372, 373, 378

19 Summary A covalent enzyme intermediate was identified between hbat and cholic acid L-ESI-MS/MS on the Q-tof identified 6 modifications at 1 mm E L-ESI-FT-IR/MS identified up to 10 modifications at 128 µm, down to 3 modifications at 8 µm 4E may first alter sites in the region of the catalytic triad

20 Acknowledgements Barnes Lab: Stephen Barnes Tracy D Alessandro Kim Lab: elen Kim Shannon Eliuk FT-IR/MS Lab for Biomedical Research: Matthew Renfrow Monica Stinnett Mass Spec Shared Facility: Marion Kirk Landon Wilson

Comparison of mass spectrometers performances

Comparison of mass spectrometers performances Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion

More information

Bio 100 Serine Proteases 9/26/11

Bio 100 Serine Proteases 9/26/11 Assigned Reading: 4th ed. 6.4.1 The Chymotrypsin Mechanism Involves Acylation And Deacylation Of A Ser Residue p. 213 BOX 20-1 Penicillin and β-lactamase p. 779 6.5.7 Some Enzymes Are Regulated By Proteolytic

More information

MCB 102 Discussion, Spring 2012

MCB 102 Discussion, Spring 2012 MB Discussion, Spring 2012 Practice Problems 1. Effect of enzymes on reactions Which of the listed effects would be brought about by any enzyme catalyzing the following simple reaction? k 1 S P where K

More information

Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD

Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD 4-7117 sbarnes@uab.edu Overview A mass spectrum Electrospray MS Analysis of intact proteins Molecular weight calculations

More information

Chemical Mechanism of Enzymes

Chemical Mechanism of Enzymes Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.

More information

Previous Class. Today. Term test I discussions. Detection of enzymatic intermediates: chymotrypsin mechanism

Previous Class. Today. Term test I discussions. Detection of enzymatic intermediates: chymotrypsin mechanism Term test I discussions Previous Class Today Detection of enzymatic intermediates: chymotrypsin mechanism Mechanistic Understanding of Enzymemediated Reactions Ultimate goals: Identification of the intermediates,

More information

Nature Methods: doi: /nmeth Supplementary Figure 1

Nature Methods: doi: /nmeth Supplementary Figure 1 Supplementary Figure 1 Subtiligase-catalyzed ligations with ubiquitin thioesters and 10-mer biotinylated peptides. (a) General scheme for ligations between ubiquitin thioesters and 10-mer, biotinylated

More information

Helen Kim, Ph.D. and John Cutts. Dept of Pharmacology & Toxicology University of Alabama at Birmingham

Helen Kim, Ph.D. and John Cutts. Dept of Pharmacology & Toxicology University of Alabama at Birmingham Understanding the actions of a dietary anti-oxidant at the protein and small molecule level using top-down proteomics, enzyme assays and mass spectrometry elen Kim, Ph.D. and John Cutts Mar 9, 2012 UAB

More information

PAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin

PAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin Subject Paper No and Title 16 Bio-organic and Biophysical Module No and Title 22 Mechanism of Enzyme Catalyzed reactions I Module Tag CHE_P16_M22 Chymotrypsin TABLE OF CONTENTS 1. Learning outcomes 2.

More information

Amino Acids. Amino Acids. Fundamentals. While their name implies that amino acids are compounds that contain an NH. 3 and CO NH 3

Amino Acids. Amino Acids. Fundamentals. While their name implies that amino acids are compounds that contain an NH. 3 and CO NH 3 Fundamentals While their name implies that amino acids are compounds that contain an 2 group and a 2 group, these groups are actually present as 3 and 2 respectively. They are classified as α, β, γ, etc..

More information

Lecture 3. Tandem MS & Protein Sequencing

Lecture 3. Tandem MS & Protein Sequencing Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:

More information

Charges on amino acids and proteins. ph 1. ph 7. Acidic side chains: glutamate and aspartate

Charges on amino acids and proteins. ph 1. ph 7. Acidic side chains: glutamate and aspartate harges on amino acids and proteins Acidic side chains: glutamate and aspartate A A- + + + - + Basic side chains: arginine, lysine & histidine Glycine @ p 1 B+ B + + + The amino group, pka 9.6 3 N+ The

More information

Classification of amino acids: -

Classification of amino acids: - Page 1 of 8 P roteinogenic amino acids, also known as standard, normal or primary amino acids are 20 amino acids that are incorporated in proteins and that are coded in the standard genetic code (subunit

More information

Protein Identification and Phosphorylation Site Determination by de novo sequencing using PepFrag TM MALDI-Sequencing kit

Protein Identification and Phosphorylation Site Determination by de novo sequencing using PepFrag TM MALDI-Sequencing kit Application Note Tel: +82-54-223-2463 Fax : +82-54-223-2460 http://www.genomine.com venture ldg 306 Pohang techno park Pohang, kyungbuk, Korea(ROK) Protein Identification and Phosphorylation Site Determination

More information

Mass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector

Mass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector Mass Spectrometry MALDI-TOF ESI/MS/MS Mass spectrometer Basic components Ionization source Mass analyzer Detector 1 Principles of Mass Spectrometry Proteins are separated by mass to charge ratio (limit

More information

2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry

2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique

More information

Mass Spectrometry a Multi-purpose Tool in Cancer Research

Mass Spectrometry a Multi-purpose Tool in Cancer Research Mass Spectrometry a Multi-purpose Tool in Cancer Research Stephen Barnes,PhD Director, Center for Nutrient-Gene Interaction in Cancer Prevention Director, Mass Spectrometry Shared Facility Cancer Research

More information

Enzyme Catalysis-Serine Proteases

Enzyme Catalysis-Serine Proteases Enzyme Catalysis-Serine Proteases Concepts to be learned Activation Energy Transition State Example: Proteases Requirements for proteolysis Families of proteases Protein Folds used by proteases for catalysis

More information

Chymotrypsin Lecture. Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin

Chymotrypsin Lecture. Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin Chymotrypsin Lecture Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin What s so great about enzymes? They accomplish large rate accelerations (10 10-10

More information

Practice Problems 3. a. What is the name of the bond formed between two amino acids? Are these bonds free to rotate?

Practice Problems 3. a. What is the name of the bond formed between two amino acids? Are these bonds free to rotate? Life Sciences 1a Practice Problems 3 1. Draw the oligopeptide for Ala-Phe-Gly-Thr-Asp. You do not need to indicate the stereochemistry of the sidechains. Denote with arrows the bonds formed between the

More information

REDOX PROTEOMICS. Roman Zubarev.

REDOX PROTEOMICS. Roman Zubarev. REDOX PROTEOMICS Roman Zubarev Roman.Zubarev@ki.se Physiological Chemistry I, Department for Medical Biochemistry & Biophysics, Karolinska Institutet, Stockholm What is (RedOx) Proteomics? Proteomics -

More information

Biotransformation-induced toxicity. Challenges in drug design M. Matilde Marques

Biotransformation-induced toxicity. Challenges in drug design M. Matilde Marques Biotransformation-induced toxicity. Challenges in drug design M. Matilde Marques Drug Discovery Session July 4, 2016 Drug Discovery Toxicology The Road to Safe Drugs Attrition in drug development remains

More information

Quantitative LC-MS/MS Analysis of Glucagon. Veniamin Lapko, Ph.D June 21, 2011

Quantitative LC-MS/MS Analysis of Glucagon. Veniamin Lapko, Ph.D June 21, 2011 Quantitative LC-MS/MS Analysis of Glucagon Veniamin Lapko, Ph.D June 21, 2011 Contents Comparison with small molecule LC-MS/MS LC-MS/MS sensitivity of peptides detection Stability: neat vs. matrix solutions

More information

Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g.

Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g. Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g., casein more interestingly, in most other cases, it is a transient

More information

Enzyme Catalytic Mechanisms. Dr. Kevin Ahern

Enzyme Catalytic Mechanisms. Dr. Kevin Ahern Enzyme Catalytic Mechanisms Dr. Kevin Ahern Cleave Peptide Bonds Specificity of Cutting Common Active Site Composition/Structure Mechanistically Well Studied Chymotrypsin Chymotrypsin Catalysis H2O Chymotrypsin

More information

The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold

The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold Anthony C.G. Dossang * 1, Precious G. Motshwene * 1, Yang Yang* 1, Martyn F. Symmons*, Clare E.

More information

Protein Interactions by Infrared Multiphoton Dissociation-MS. Crosslinker for Identification of. Photoactive Chemical

Protein Interactions by Infrared Multiphoton Dissociation-MS. Crosslinker for Identification of. Photoactive Chemical Photoactive Chemical Crosslinker for Identification of Protein Interactions by Infrared Multiphoton Dissociation-MS Myles W. Gardner, Jennifer S. Brodbelt Chemical Crosslinking of Proteins Protein structural

More information

Introduction to Peptide Sequencing

Introduction to Peptide Sequencing Introduction to Peptide equencing Quadrupole Ion Traps tructural Biophysics Course December 3, 2014 12/8/14 Introduction to Peptide equencing - athan Yates 1 Why are ion traps used to sequence peptides?

More information

Supporting Information. Development of N, S-doped carbon dots as a novel matrix for the. analysis of small molecules by negative ion MALDI-TOF MS

Supporting Information. Development of N, S-doped carbon dots as a novel matrix for the. analysis of small molecules by negative ion MALDI-TOF MS Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 16 Supporting Information Development of N, S-doped carbon dots as a novel matrix for the analysis

More information

Biological Mass Spectrometry. April 30, 2014

Biological Mass Spectrometry. April 30, 2014 Biological Mass Spectrometry April 30, 2014 Mass Spectrometry Has become the method of choice for precise protein and nucleic acid mass determination in a very wide mass range peptide and nucleotide sequencing

More information

7.05 Spring 2004 March 12, Recitation #4

7.05 Spring 2004 March 12, Recitation #4 7.05 Spring 2004 March 12, 2004 Recitation #4 ontact Information TA: Victor Sai Recitation: Friday, 34pm, 2132 Email: sai@mit.edu ffice ours: Friday, 45pm, 2132 Unit 2 Schedule Recitation/Exam Date Lectures

More information

Chapter 10. Regulatory Strategy

Chapter 10. Regulatory Strategy Chapter 10 Regulatory Strategy Regulation of enzymatic activity: 1. Allosteric Control. Allosteric proteins have a regulatory site(s) and multiple functional sites Activity of proteins is regulated by

More information

SUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T

SUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2019 SUPPORTING INFORMATION Lysine Carbonylation is a Previously Unrecognized Contributor to

More information

Peptide hydrolysis uncatalyzed half-life = ~450 years HIV protease-catalyzed half-life = ~3 seconds

Peptide hydrolysis uncatalyzed half-life = ~450 years HIV protease-catalyzed half-life = ~3 seconds Uncatalyzed half-life Peptide hydrolysis uncatalyzed half-life = ~450 years IV protease-catalyzed half-life = ~3 seconds Life Sciences 1a Lecture Slides Set 9 Fall 2006-2007 Prof. David R. Liu In the absence

More information

CHM 341 C: Biochemistry I. Test 2: October 24, 2014

CHM 341 C: Biochemistry I. Test 2: October 24, 2014 CHM 341 C: Biochemistry I Test 2: ctober 24, 2014 This test consists of 14 questions worth points. Make sure that you read the entire question and answer each question clearly and completely. To receive

More information

Previous Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties

Previous Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties Previous Class Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism Today Protein Kinase Catalytic Properties Protein Phosphorylation Phosphorylation: key protein modification

More information

Biomolecular Mass Spectrometry

Biomolecular Mass Spectrometry Lipids ot different than other organic small molecules Carbohydrates Polymers of monosaccharides linked via glycosidic bonds (acetals/ ketals) many different combinationsvery interesting no time ucleic

More information

Enzymes are highly specific

Enzymes are highly specific Manickam ugumaran Department of Biology University of Massachusetts Boston, MA 015 Enzymes are highly specific Enzymes distinguish between homologues (succinate and malonate). Enzymes acting on D-amino

More information

LC-MS Analysis of Botanicals

LC-MS Analysis of Botanicals Botanical workshop UAB, Sept 11, 26 LC-MS Analysis of Botanicals Jeevan K. Prasain, Ph.D. Department of Pharmacology & Toxicology, UAB Purdue-UAB Botanicals Center for Age-related Disease Applications

More information

A Chemical Look at Proteins: Workhorses of the Cell

A Chemical Look at Proteins: Workhorses of the Cell A Chemical Look at Proteins: Workhorses of the Cell A A Life ciences 1a Lecture otes et 4 pring 2006 Prof. Daniel Kahne Life requires chemistry 2 amino acid monomer and it is proteins that make the chemistry

More information

Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University

Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk previously Peptide fragmentation Hybrid instruments 117 The Building Blocks of Life DNA RNA Proteins

More information

Chapter 23 Enzymes 1

Chapter 23 Enzymes 1 Chapter 23 Enzymes 1 Enzymes Ribbon diagram of cytochrome c oxidase, the enzyme that directly uses oxygen during respiration. 2 Enzyme Catalysis Enzyme: A biological catalyst. With the exception of some

More information

1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: =3x10-5 = 30μM

1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: =3x10-5 = 30μM 1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: k 1 = 2 x 10 8 M -1 s -1, k 2 = 1 x 10 3 s -1, k 3 = 5 x 10 3 s -1 a) What

More information

Operating Instructions

Operating Instructions Sequazyme C-Peptide Sequencing Kit Operating Instructions 1 Product Description The Sequazyme C-Peptide Sequencing Kit enables peptide digestion and the analysis of sequentially truncated peptides using

More information

Mass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications

Mass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications Adapted from Mass Spectrometry in Biotechnology Gary Siuzdak,, Academic Press 1996 1 Introduction

More information

Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS. Kayleigh Arthur

Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS. Kayleigh Arthur Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS Kayleigh Arthur K.Arthur@lboro.ac.uk Introduction LC-MS is a highly used technique for untargeted profiling analyses

More information

Ion Source. Mass Analyzer. Detector. intensity. mass/charge

Ion Source. Mass Analyzer. Detector. intensity. mass/charge Proteomics Informatics Overview of spectrometry (Week 2) Ion Source Analyzer Detector Peptide Fragmentation Ion Source Analyzer 1 Fragmentation Analyzer 2 Detector b y Liquid Chromatography (LC)-MS/MS

More information

Chapter 3. Structure of Enzymes. Enzyme Engineering

Chapter 3. Structure of Enzymes. Enzyme Engineering Chapter 3. Structure of Enzymes Enzyme Engineering 3.1 Introduction With purified protein, Determining M r of the protein Determining composition of amino acids and the primary structure Determining the

More information

Catalysis & specificity: Proteins at work

Catalysis & specificity: Proteins at work Catalysis & specificity: Proteins at work Introduction Having spent some time looking at the elements of structure of proteins and DNA, as well as their ability to form intermolecular interactions, it

More information

Chemistry 135, First Exam. September 23, Chem 135, Exam 1 SID:

Chemistry 135, First Exam. September 23, Chem 135, Exam 1 SID: Chemistry 135, First Exam September 23, 2015 This exam will be worth 15% of your overall grade. Please read all instructions/questions carefully and provide answers in the space provided. There should

More information

Chapter 11: Enzyme Catalysis

Chapter 11: Enzyme Catalysis Chapter 11: Enzyme Catalysis Matching A) high B) deprotonated C) protonated D) least resistance E) motion F) rate-determining G) leaving group H) short peptides I) amino acid J) low K) coenzymes L) concerted

More information

Peptide and Protein Analysis Primary (1 ) structure of a peptide or protein is the amino acid sequence

Peptide and Protein Analysis Primary (1 ) structure of a peptide or protein is the amino acid sequence n-suppport cyclization 2 3 3 FM R n 1) Pd(0), Et 3 i 2) piperidine R 2 2 3 3 2 R n PyBP R 2 2 3 R n F 3 2, 3, F,! anisole anisole! R n 3 R 2 R 2 49 Peptide and Protein Analysis Primary (1 ) structure of

More information

Mass Spectrometry Infrastructure

Mass Spectrometry Infrastructure Mass Spectrometry Infrastructure Todd Williams, Ph.D. Director KU Mass Spectrometry and Analytical Proteomics Laboratory Mass Spectrometry Lab B025 Malott Hall Mission The Mass Spectrometry and analytical

More information

MALDI Imaging Mass Spectrometry

MALDI Imaging Mass Spectrometry MALDI Imaging Mass Spectrometry Nan Kleinholz Mass Spectrometry and Proteomics Facility The Ohio State University Mass Spectrometry and Proteomics Workshop What is MALDI Imaging? MALDI: Matrix Assisted

More information

1. Sample Introduction to MS Systems:

1. Sample Introduction to MS Systems: MS Overview: 9.10.08 1. Sample Introduction to MS Systems:...2 1.1. Chromatography Interfaces:...3 1.2. Electron impact: Used mainly in Protein MS hard ionization source...4 1.3. Electrospray Ioniztion:

More information

Protein sequence mapping is commonly used to

Protein sequence mapping is commonly used to Reproducible Microwave-Assisted Acid Hydrolysis of Proteins Using a Household Microwave Oven and Its Combination with LC-ESI MS/MS for Mapping Protein Sequences and Modifications Nan Wang and Liang Li

More information

A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization

A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization Amina S. Woods and Marilyn A. Huestis Chemistry and Drug Metabolism, NIDA Intramural Research Program, NIDA, NIH, Baltimore,

More information

Minjia Tan, Ph.D Shanghai Institute of Materia Medica, Chinese Academy of Sciences

Minjia Tan, Ph.D Shanghai Institute of Materia Medica, Chinese Academy of Sciences Lysine Glutarylation Is a Protein Posttranslational Modification Regulated by SIRT5 Minjia Tan, Ph.D Shanghai Institute of Materia Medica, Chinese Academy of Sciences Lysine: the most frequently modified

More information

PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System

PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow

More information

H 2 C NH 3 CH 2 CHCOO

H 2 C NH 3 CH 2 CHCOO Make sure You have FIVE Different 110 April 29, 2009 Pages Including this over Page. over Page You may pick up your graded exam after 120 minutes Final Exam 5/4/09 until 12/01/09 DETA TIS SEET AND USE

More information

Douglas S. Masterson* Department of Chemistry and Biochemistry, The University of Southern Mississippi, Hattiesburg, MS 39406, USA

Douglas S. Masterson* Department of Chemistry and Biochemistry, The University of Southern Mississippi, Hattiesburg, MS 39406, USA ARTICLES Free Radical Induced Site-Specific Peptide Cleavage in the Gas Phase: Low-Energy Collision-Induced Dissociation in ESI- and MALDI Mass Spectrometry Huiyong Yin, Almary Chacon, and Ned A. Porter

More information

The 1997 ABRF Mass Spectrometry Committee Collaborative Study: Identification of Phosphopeptides in a Tryptic Digest of Apomyoglobin

The 1997 ABRF Mass Spectrometry Committee Collaborative Study: Identification of Phosphopeptides in a Tryptic Digest of Apomyoglobin The 1997 ABRF Mass Spectrometry Committee Collaborative Study: Identification of Phosphopeptides in a Tryptic Digest of Apomyoglobin Kristine Swiderek, Farzin Gharahdaghi, Lowell Ericsson, Murray Hackett,

More information

Beta Amyloid Peptides

Beta Amyloid Peptides Beta Amyloid Peptides The Most Comprehensive Collection for Alzheimer s Disease Academic Services Pharmaceutical Services Beta Amyloid Peptides The Most Comprehensive Collection for Alzheimer s Disease

More information

The MOLECULES of LIFE

The MOLECULES of LIFE The MOLECULES of LIFE Physical and Chemical Principles Solutions Manual Prepared by James Fraser and Samuel Leachman Chapter 16 Principles of Enzyme Catalysis Problems True/False and Multiple Choice 1.

More information

Double charge of 33kD peak A1 A2 B1 B2 M2+ M/z. ABRF Proteomics Research Group - Qualitative Proteomics Study Identifier Number 14146

Double charge of 33kD peak A1 A2 B1 B2 M2+ M/z. ABRF Proteomics Research Group - Qualitative Proteomics Study Identifier Number 14146 Abstract The 2008 ABRF Proteomics Research Group Study offers participants the chance to participate in an anonymous study to identify qualitative differences between two protein preparations. We used

More information

O H 2 N. α H. Chapter 4 - Amino Acids

O H 2 N. α H. Chapter 4 - Amino Acids hapter 4 - Amino Acids Introduction Several amino acids were produced in the electrical discharge in the reducing, primordial atmosphere that gave rise to the first biomolecules (see chapter 1). The importance

More information

Library identifications for Lemnaceae

Library identifications for Lemnaceae Library identifications for Lemnaceae NP-001984 ESI+ NP-001984 present in, enriched in (15.47min) NP-001984 -MS^E CH 3 Moupinamide H NH NP-005512 + NP-016675 ESI- s NP-005512 NP-016675 NP-005512 present

More information

Supporting Information 3,4-Dihydroxyphenylalanine Peptides as. Nonperturbative Quantum Dot Sensors of

Supporting Information 3,4-Dihydroxyphenylalanine Peptides as. Nonperturbative Quantum Dot Sensors of Supporting Information 3,4-Dihydroxyphenylalanine Peptides as Nonperturbative Quantum Dot Sensors of Aminopeptidase Valle Palomo 1, Sebastián A. Díaz 2, Michael H. Stewart 3, Kimihiro Susumu 3, Igor L.

More information

Fundamentals of Soft Ionization and MS Instrumentation

Fundamentals of Soft Ionization and MS Instrumentation Fundamentals of Soft Ionization and MS Instrumentation Ana Varela Coelho varela@itqb.unl.pt Mass Spectrometry Lab Analytical Services Unit Index Mass spectrometers and its components Ionization methods:

More information

LABORATÓRIUMI GYAKORLAT SILLABUSZ SYLLABUS OF A PRACTICAL DEMONSTRATION. financed by the program

LABORATÓRIUMI GYAKORLAT SILLABUSZ SYLLABUS OF A PRACTICAL DEMONSTRATION. financed by the program TÁMOP-4.1.1.C-13/1/KONV-2014-0001 projekt Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére program

More information

Primary Structure Analysis. Automated Evaluation. LC-MS Data Sets

Primary Structure Analysis. Automated Evaluation. LC-MS Data Sets Primary Structure Analysis by Automated Evaluation of LC-MS Data Sets Mass Spec 29 Dr. Wozny, MassMap GmbH & Co. KG 1 LC-MS Peptide Mapping Origin of Signals Peptides with and without post-translational

More information

Supporting information

Supporting information Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2014 Supporting information Glycan Reductive Isotope-coded Amino Acid Labeling (GRIAL) for Mass Spectrometry-based

More information

Introduction to Proteomics 1.0

Introduction to Proteomics 1.0 Introduction to Proteomics 1.0 CMSP Workshop Pratik Jagtap Managing Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s necessary for success using

More information

Lipid Imaging Mass Spectrometry.

Lipid Imaging Mass Spectrometry. Lipid Imaging Mass Spectrometry. NH 2 P H H H H P H H P H N N Advanced Graduate Course in Metabolomics 3-11-2015 Janusz Kabarowski, Dept. of Microbiology, UAB. Matrix-Assisted Laser Desorption/Ionization

More information

Proteins: Proteomics & Protein-Protein Interactions Part I

Proteins: Proteomics & Protein-Protein Interactions Part I Proteins: Proteomics & Protein-Protein Interactions Part I Jesse Rinehart, PhD Department of Cellular & Molecular Physiology Systems Biology Institute DNA RNA PROTEIN DNA RNA PROTEIN Proteins: Proteomics

More information

MS1 and MS2 crosstalk in label free quantitation of mass spectrometry data independent acquisitions

MS1 and MS2 crosstalk in label free quantitation of mass spectrometry data independent acquisitions MS1 and MS2 crosstalk in label free quantitation of mass spectrometry data independent acquisitions MS1 528.18 +++ m/z 568.98 ++ m/z 678.34 ++ m/z MS2/SWATH June 9th, 2013 Matthew J. Rardin SIRT3 regulated

More information

Learning Objectives. Overview of topics to be discussed 10/25/2013 HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS

Learning Objectives. Overview of topics to be discussed 10/25/2013 HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS A clinical proteomics perspective Michael L. Merchant, PhD School of Medicine, University of Louisville Louisville, KY Learning Objectives

More information

Electronic Supplementary Information. Table of Contents

Electronic Supplementary Information. Table of Contents Electronic Supplementary Information Examination of native chemical ligation using peptidyl prolyl thioester Takahiro Nakamura, Akira Shigenaga, Kohei Sato, Yusuke Tsuda, Ken Sakamoto, and Akira Otaka*

More information

SUPPLEMENTARY INFORMATION. An orthogonal ribosome-trnas pair by the engineering of

SUPPLEMENTARY INFORMATION. An orthogonal ribosome-trnas pair by the engineering of SUPPLEMENTARY INFORMATION An orthogonal ribosome-trnas pair by the engineering of peptidyl transferase center Naohiro Terasaka 1 *, Gosuke Hayashi 1 *, Takayuki Katoh 1, and Hiroaki Suga 1,2 1 Department

More information

MS/MS to Targeted Proteomics (MRM)

MS/MS to Targeted Proteomics (MRM) MS/MS to Targeted Proteomics (MRM) How it worked on the Human Lens Proteome Jayson Falkner PhD jay@singleorganism.com Genes Show Limited Value in Predicting Diseases With only a few exceptions, what the

More information

Unbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM

Unbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM Unbiased in-depth characterization of CEX fractions from a stressed mab by MS Matthias Berg, Novartis Pharma, BTDM Characterization of CEX fractions Biopharmaceuticals like IgGs show a certain degree of

More information

SYNAPT G2-S High Definition MS (HDMS) System

SYNAPT G2-S High Definition MS (HDMS) System SYNAPT G2-S High Definition MS (HDMS) System High performance, versatility, and workflow efficiency of your MS system all play a crucial role in your ability to successfully reach your scientific and business

More information

Cellular functions of protein degradation

Cellular functions of protein degradation Protein Degradation Cellular functions of protein degradation 1. Elimination of misfolded and damaged proteins: Environmental toxins, translation errors and genetic mutations can damage proteins. Misfolded

More information

Lecture 18 (10/27/17) Lecture 18 (10/27/17)

Lecture 18 (10/27/17) Lecture 18 (10/27/17) Reading: Ch6; 225-232 Lecture 18 (10/27/17) Problems: Ch5 (text); 2 Ch6 (study guide-facts); 5, 6, 7, 14 NEXT Reading: Ch5; 164, 166-169 Problems: none Remember Monday at 6:30 in PHO-206 is the first MB

More information

An Introduction to Enzyme and Coenzyme Chemistry, 2nd Ed. T. D. H. Bugg, Blackwell Science, Oxford, 2004

An Introduction to Enzyme and Coenzyme Chemistry, 2nd Ed. T. D. H. Bugg, Blackwell Science, Oxford, 2004 Combinatorial synthesis of linchpin β-turn mimic 1 2 DCC, BT 1 2 n -tbu 1 n -tbu 1) 2 FMC DCC, BT 2) piperidine 1 2 2 n -tbu 3 DCC, BT 1 2 n -tbu 3 1) Ph 3 P 2) cyclization 3) CF 3 C 2 2 1 n 3 2 Evaluated

More information

Nature Methods: doi: /nmeth.3177

Nature Methods: doi: /nmeth.3177 Supplementary Figure 1 Characterization of LysargiNase, trypsin and LysN missed cleavages. (a) Proportion of peptides identified in LysargiNase and trypsin digests of MDA-MB-231 cell lysates carrying 0,

More information

Proteins? Protein function. Protein folding. Protein folding diseases. Protein interactions. Macromolecular assemblies. The end product of Genes

Proteins? Protein function. Protein folding. Protein folding diseases. Protein interactions. Macromolecular assemblies. The end product of Genes Proteins? Protein function Protein folding Protein folding diseases Protein interactions Macromolecular assemblies The end product of Genes Protein Unfolding DOD Acid Catalysis DOD HDOD + N H N D C N C

More information

Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information

Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt

More information

Proteomics/Peptidomics

Proteomics/Peptidomics Proteomics/Peptidomics System biology tools and preclinical models for translational research in endometriosis, ESHRE Campus workshop, 4-5 September 2009 E. Waelkens Proteomics: What? Proteins Proteomics

More information

Facile Cu(II) mediated conjugation of thioesters and thioacids to peptides and proteins under mild conditions

Facile Cu(II) mediated conjugation of thioesters and thioacids to peptides and proteins under mild conditions Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2018 Facile Cu(II) mediated conjugation of thioesters and thioacids to peptides

More information

7.014 Problem Set 2 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web.

7.014 Problem Set 2 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web. MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Name: Section : 7.014 Problem Set 2 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions

More information

Supplementary Information. Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels

Supplementary Information. Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels Supplementary Information Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels Nobuaki Takemori,,* Ayako Takemori,, Piriya Wongkongkathep, Michael Nshanian, Rachel R. Ogorzalek

More information

N α -Acetylation of yeast ribosomal proteins and its effect on protein synthesis

N α -Acetylation of yeast ribosomal proteins and its effect on protein synthesis JOURNAL OF PROTEOMICS 74 (2011) 431 441 available at www.sciencedirect.com www.elsevier.com/locate/jprot N α -Acetylation of yeast ribosomal proteins and its effect on protein synthesis Masahiro Kamita

More information

Date: EXERCISE 4. Figure 1. Amino acid structure.

Date: EXERCISE 4. Figure 1. Amino acid structure. Student s name: Date: Points: Assistant s signature: Index numer: /6 EXERISE 4 AMIN AIDS AND PRTEINS. Amino acids are structural units (monomers) of proteins. There are 20 different amino acids coded for

More information

Algal Biofuels Research: Using basic science to maximize fuel output. Jacob Dums, PhD candidate, Heike Sederoff Lab March 9, 2015

Algal Biofuels Research: Using basic science to maximize fuel output. Jacob Dums, PhD candidate, Heike Sederoff Lab March 9, 2015 Algal Biofuels Research: Using basic science to maximize fuel output Jacob Dums, PhD candidate, jtdums@ncsu.edu Heike Sederoff Lab March 9, 2015 Outline Research Approach Dunaliella Increase Oil Content

More information

Properties of amino acids in proteins

Properties of amino acids in proteins Properties of amino acids in proteins one of the primary roles of DNA (but far from the only one!!!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids

More information

Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow

Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Purpose Described herein is a workflow that combines the isobaric tagging reagents, itraq Reagents, with the separation power

More information

An Introduction to the Use of itraq Reagents for Amino Acid Analysis

An Introduction to the Use of itraq Reagents for Amino Acid Analysis An Introduction to the Use of itraq Reagents for Amino Acid Analysis Lisa Sapp Clinical Research and Forensic Toxicology Product Manager Mass Spectrometry Systems Amino Acid Analysis Using itraq Reagents

More information

Molecular Cell, Volume 46. Supplemental Information

Molecular Cell, Volume 46. Supplemental Information Molecular Cell, Volume 46 Supplemental Information Mapping N-Glycosylation Sites across Seven Evolutionary Distant Species Reveals a Divergent Substrate Proteome Despite a Common Core Machinery Dorota

More information

MS/MS Scan Modes. Eötvös University, Budapest April 16, MS/MS Scan Modes. Árpád Somogyi. Product Ion Scan Select. Scan. Precursor Ion Scan Scan

MS/MS Scan Modes. Eötvös University, Budapest April 16, MS/MS Scan Modes. Árpád Somogyi. Product Ion Scan Select. Scan. Precursor Ion Scan Scan MS/MS Modes Árpád Somogyi Eötvös University, Budapest April 16, 2012 MS/MS Modes Product Ion Precursor Ion Neutral Loss Δ ed Reaction Monitoring (SRM) 1 modes in a triple quadrupole (QqQ) (one quadrupole

More information