Post-translational Modifications to Human Bile Acid CoA:Amino Acid N- acyltransferase
|
|
- Conrad King
- 5 years ago
- Views:
Transcription
1 Post-translational Modifications to uman Bile Acid oa:amino Acid - acyltransferase Erin Shonsey UAB Graduate Student September 12, 2006
2 onjugation of Bile Acids SoA S 3 - hbat oa-s 2 2 S - 3 (Amidate, -holyltaurine) (A)
3 atalytic Triad of BAT Various mutation and other studies performed previously led to the hypothesis that BAT works through a catalytic triad The members of this catalytic triad are believed to be ys235, is362, and Asp328
4 harge Relay Mechanism shared by hbat, thioesterases, and a large group of hydrolases ys 235 is 362 ys 235 is 362 Bile acid S S ---- oa. ucleophilic attack Michaelis complex Asp S Bile acid S oa - Tetrahedral intermediate Asp 328 ys 235 (Ser235) 2 is 362 R 2 S 4 Gly or Tau ( 2 ) Gly or Tau 3 oa ys S R S Acyl-enzyme intermediate oa Asp 328 ys 235 ys 235 is 362 R - 2 S 5 Gly or Tau Gly or Tau Bile acid Bile acid conjugate + S Active enzyme - Asp 328
5 MALDI-TF MS Analysis of hbat-avi/cholic acid intermediate Mass (m/z)
6 Deconvoluted Q-TF MS Analysis of hbat- Avi/cholic acid intermediate Da mass
7 Amino Acids Modified by 4E 4E-Modified Lysine Michael Addition 4E-Modified ysteine S Michael Addition Adduct Michael Schiff base Pentylpyrrole 4E-Modified Lysine Schiff Base Adduct Mol wt J Am Soc Mass Spectrom Aug;15(8): E-Modified Lysine 2-Pentylpyrrole Adduct 4E-Modified istidine Michael Addition
8 Potential 4E targets in hbat MIQLTATPVSALVDEPVIRATGLIPFQMVSFQASLEDEGDMF YSQAYRAEFGEVDLASSLGGDYMGVPMGLFWSLKPEKLL TRLLKRDVMRPFQVQVKLYDLELIVKVASAPKASLTLERWY VAPGVTRIKVREGRLRGALFLPPGEGLFPGVIDLFGGLGGLLEF RASLLASRGFASLALAYYEDLPRKPEVTDLEYFEEAAFLLR PKVFGSGVGVVSVQGVQIGLSMAIYLKQVTATVLIGTFPF GIPQVYGQIQPLPSAQLISTALGLLELYRTFETTQVGASQ YLFPIEEAQGQFLFIVGEGDKTISKAAEQAIGQLKRGKW TLLSYPGAGLIEPPYSPLASTTDLRLWGGEVIPAAAQE AWKEIQRFLRKLIPDVTSQL 17 is 16 Lys 19 Arg 3 ys
9 In vitro Modification of hbat with E hbat + E Incubate at 4 for 1 hour E treated hbat + E treated hbat E modified hbat Incubate at 37 overnight Mix with matrix and spot on MALDI plate 100 % Intensity Mass (m/z)
10 Inactivation of hbat by E 120 % Residual Activity control E oncentration (µm) 1.6µM hbat
11 MALDI-TF MS of hymotrypsin Digest of E modified hbat ative hbat Modified hbat Mass (m/z)
12 istidine Residues Modified by 1 mm E Found by QTF Residue umbers Sequence Unmodified Mass Modified Mass Mass Shift GFASLALAYYEDLPR GQIQPLPSAQ GQIQPLPSAQ AAEQAIGQLK LWGGEVIPAAAQEAWK
13 MS/MS Spectra Using ID of [M] M I Q L T A T P V S A L V D E P V I R [M+2] 2+ - E Michael adduct y 8 y 10 b 13 b 9 b y7 5 b 3 b y 5 7 y 6 b 6 y 9 b 12 b 14 y 11 b 15 y 13 y 12 y 14 y 15 b 17 y m/z
14 Electron apture Dissociation urr pin Biotechnol Feb;15(1):12-6.
15 ED Fragmentation y 3 z 3 z 2 z 1 R1 R2 R3 R4 + b 1 c 1 c 2 c 3
16 MS/MS Spectra Using ED of [M] A A E Q A I G Q L K R [M+3] 3+ [M+2] 2+ ~ x 5 c 5 z 8 c 3 c 4 c z 7 c z 2 8 c 11 1 z 3 z 4 c 6 z c c 7 9 c m/z
17 Sequence overage Using FT-IR/MS MIQLTATPVSALVDEPVIRATGLIPFQMVSFQASL EDEGDMFYSQAYRAEFGEVDLASSLGGDYMG VPMGLFWSLKPEKLLTRLLKRDVMRPFQVQVKLY DLELIVKVASAPKASLTLERWYVAPGVTRIKVRE GRLRGALFLPPGEGLFPGVIDLFGGLGGLLEFRASL LASRGFASLALAYYEDLPRKPEVTDLEYFEEAA FLLRPKVFGSGVGVVSVQGVQIGLSMAIYLKQVT ATVLIGTFPFGIPQVYGQIQPLPSAQLIST ALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIV GEGDKTISKAAEQAIGQLKRGKWTLLSYPGA GLIEPPYSPLASTTDLRLWGGEVIPAAAQE AWKEIQRFLRKLIPDVTSQL 70.1% Sequence overage
18 Amino Acids Modified by E Using FT-IR/MS Peptide 128 µm E Modified Amino Acid 64 µm E 32 µm E 16 µm E 8 µm E AAEQAIGQLKR RLWGGEVIPAAAQEAWK AQGQFLFIVGEGDKTISK 397 K329, K K329, K K329, K K329, K334 K329, K334 MIQLTATPVSALVDEPVIR RAEFGEVDLASSLGGDYMGVPMGLFWSLKPEK 1*156 WTLLSYPGAGLIEPPYSPLASTTDLR 362, 372, 373, 378
19 Summary A covalent enzyme intermediate was identified between hbat and cholic acid L-ESI-MS/MS on the Q-tof identified 6 modifications at 1 mm E L-ESI-FT-IR/MS identified up to 10 modifications at 128 µm, down to 3 modifications at 8 µm 4E may first alter sites in the region of the catalytic triad
20 Acknowledgements Barnes Lab: Stephen Barnes Tracy D Alessandro Kim Lab: elen Kim Shannon Eliuk FT-IR/MS Lab for Biomedical Research: Matthew Renfrow Monica Stinnett Mass Spec Shared Facility: Marion Kirk Landon Wilson
Comparison of mass spectrometers performances
Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion
More informationBio 100 Serine Proteases 9/26/11
Assigned Reading: 4th ed. 6.4.1 The Chymotrypsin Mechanism Involves Acylation And Deacylation Of A Ser Residue p. 213 BOX 20-1 Penicillin and β-lactamase p. 779 6.5.7 Some Enzymes Are Regulated By Proteolytic
More informationMCB 102 Discussion, Spring 2012
MB Discussion, Spring 2012 Practice Problems 1. Effect of enzymes on reactions Which of the listed effects would be brought about by any enzyme catalyzing the following simple reaction? k 1 S P where K
More informationMass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD
Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD 4-7117 sbarnes@uab.edu Overview A mass spectrum Electrospray MS Analysis of intact proteins Molecular weight calculations
More informationChemical Mechanism of Enzymes
Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.
More informationPrevious Class. Today. Term test I discussions. Detection of enzymatic intermediates: chymotrypsin mechanism
Term test I discussions Previous Class Today Detection of enzymatic intermediates: chymotrypsin mechanism Mechanistic Understanding of Enzymemediated Reactions Ultimate goals: Identification of the intermediates,
More informationNature Methods: doi: /nmeth Supplementary Figure 1
Supplementary Figure 1 Subtiligase-catalyzed ligations with ubiquitin thioesters and 10-mer biotinylated peptides. (a) General scheme for ligations between ubiquitin thioesters and 10-mer, biotinylated
More informationHelen Kim, Ph.D. and John Cutts. Dept of Pharmacology & Toxicology University of Alabama at Birmingham
Understanding the actions of a dietary anti-oxidant at the protein and small molecule level using top-down proteomics, enzyme assays and mass spectrometry elen Kim, Ph.D. and John Cutts Mar 9, 2012 UAB
More informationPAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin
Subject Paper No and Title 16 Bio-organic and Biophysical Module No and Title 22 Mechanism of Enzyme Catalyzed reactions I Module Tag CHE_P16_M22 Chymotrypsin TABLE OF CONTENTS 1. Learning outcomes 2.
More informationAmino Acids. Amino Acids. Fundamentals. While their name implies that amino acids are compounds that contain an NH. 3 and CO NH 3
Fundamentals While their name implies that amino acids are compounds that contain an 2 group and a 2 group, these groups are actually present as 3 and 2 respectively. They are classified as α, β, γ, etc..
More informationLecture 3. Tandem MS & Protein Sequencing
Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:
More informationCharges on amino acids and proteins. ph 1. ph 7. Acidic side chains: glutamate and aspartate
harges on amino acids and proteins Acidic side chains: glutamate and aspartate A A- + + + - + Basic side chains: arginine, lysine & histidine Glycine @ p 1 B+ B + + + The amino group, pka 9.6 3 N+ The
More informationClassification of amino acids: -
Page 1 of 8 P roteinogenic amino acids, also known as standard, normal or primary amino acids are 20 amino acids that are incorporated in proteins and that are coded in the standard genetic code (subunit
More informationProtein Identification and Phosphorylation Site Determination by de novo sequencing using PepFrag TM MALDI-Sequencing kit
Application Note Tel: +82-54-223-2463 Fax : +82-54-223-2460 http://www.genomine.com venture ldg 306 Pohang techno park Pohang, kyungbuk, Korea(ROK) Protein Identification and Phosphorylation Site Determination
More informationMass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector
Mass Spectrometry MALDI-TOF ESI/MS/MS Mass spectrometer Basic components Ionization source Mass analyzer Detector 1 Principles of Mass Spectrometry Proteins are separated by mass to charge ratio (limit
More information2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry
Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique
More informationMass Spectrometry a Multi-purpose Tool in Cancer Research
Mass Spectrometry a Multi-purpose Tool in Cancer Research Stephen Barnes,PhD Director, Center for Nutrient-Gene Interaction in Cancer Prevention Director, Mass Spectrometry Shared Facility Cancer Research
More informationEnzyme Catalysis-Serine Proteases
Enzyme Catalysis-Serine Proteases Concepts to be learned Activation Energy Transition State Example: Proteases Requirements for proteolysis Families of proteases Protein Folds used by proteases for catalysis
More informationChymotrypsin Lecture. Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin
Chymotrypsin Lecture Aims: to understand (1) the catalytic strategies used by enzymes and (2) the mechanism of chymotrypsin What s so great about enzymes? They accomplish large rate accelerations (10 10-10
More informationPractice Problems 3. a. What is the name of the bond formed between two amino acids? Are these bonds free to rotate?
Life Sciences 1a Practice Problems 3 1. Draw the oligopeptide for Ala-Phe-Gly-Thr-Asp. You do not need to indicate the stereochemistry of the sidechains. Denote with arrows the bonds formed between the
More informationREDOX PROTEOMICS. Roman Zubarev.
REDOX PROTEOMICS Roman Zubarev Roman.Zubarev@ki.se Physiological Chemistry I, Department for Medical Biochemistry & Biophysics, Karolinska Institutet, Stockholm What is (RedOx) Proteomics? Proteomics -
More informationBiotransformation-induced toxicity. Challenges in drug design M. Matilde Marques
Biotransformation-induced toxicity. Challenges in drug design M. Matilde Marques Drug Discovery Session July 4, 2016 Drug Discovery Toxicology The Road to Safe Drugs Attrition in drug development remains
More informationQuantitative LC-MS/MS Analysis of Glucagon. Veniamin Lapko, Ph.D June 21, 2011
Quantitative LC-MS/MS Analysis of Glucagon Veniamin Lapko, Ph.D June 21, 2011 Contents Comparison with small molecule LC-MS/MS LC-MS/MS sensitivity of peptides detection Stability: neat vs. matrix solutions
More informationPhosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g.
Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g., casein more interestingly, in most other cases, it is a transient
More informationEnzyme Catalytic Mechanisms. Dr. Kevin Ahern
Enzyme Catalytic Mechanisms Dr. Kevin Ahern Cleave Peptide Bonds Specificity of Cutting Common Active Site Composition/Structure Mechanistically Well Studied Chymotrypsin Chymotrypsin Catalysis H2O Chymotrypsin
More informationThe N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold
The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold Anthony C.G. Dossang * 1, Precious G. Motshwene * 1, Yang Yang* 1, Martyn F. Symmons*, Clare E.
More informationProtein Interactions by Infrared Multiphoton Dissociation-MS. Crosslinker for Identification of. Photoactive Chemical
Photoactive Chemical Crosslinker for Identification of Protein Interactions by Infrared Multiphoton Dissociation-MS Myles W. Gardner, Jennifer S. Brodbelt Chemical Crosslinking of Proteins Protein structural
More informationIntroduction to Peptide Sequencing
Introduction to Peptide equencing Quadrupole Ion Traps tructural Biophysics Course December 3, 2014 12/8/14 Introduction to Peptide equencing - athan Yates 1 Why are ion traps used to sequence peptides?
More informationSupporting Information. Development of N, S-doped carbon dots as a novel matrix for the. analysis of small molecules by negative ion MALDI-TOF MS
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 16 Supporting Information Development of N, S-doped carbon dots as a novel matrix for the analysis
More informationBiological Mass Spectrometry. April 30, 2014
Biological Mass Spectrometry April 30, 2014 Mass Spectrometry Has become the method of choice for precise protein and nucleic acid mass determination in a very wide mass range peptide and nucleotide sequencing
More information7.05 Spring 2004 March 12, Recitation #4
7.05 Spring 2004 March 12, 2004 Recitation #4 ontact Information TA: Victor Sai Recitation: Friday, 34pm, 2132 Email: sai@mit.edu ffice ours: Friday, 45pm, 2132 Unit 2 Schedule Recitation/Exam Date Lectures
More informationChapter 10. Regulatory Strategy
Chapter 10 Regulatory Strategy Regulation of enzymatic activity: 1. Allosteric Control. Allosteric proteins have a regulatory site(s) and multiple functional sites Activity of proteins is regulated by
More informationSUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2019 SUPPORTING INFORMATION Lysine Carbonylation is a Previously Unrecognized Contributor to
More informationPeptide hydrolysis uncatalyzed half-life = ~450 years HIV protease-catalyzed half-life = ~3 seconds
Uncatalyzed half-life Peptide hydrolysis uncatalyzed half-life = ~450 years IV protease-catalyzed half-life = ~3 seconds Life Sciences 1a Lecture Slides Set 9 Fall 2006-2007 Prof. David R. Liu In the absence
More informationCHM 341 C: Biochemistry I. Test 2: October 24, 2014
CHM 341 C: Biochemistry I Test 2: ctober 24, 2014 This test consists of 14 questions worth points. Make sure that you read the entire question and answer each question clearly and completely. To receive
More informationPrevious Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties
Previous Class Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism Today Protein Kinase Catalytic Properties Protein Phosphorylation Phosphorylation: key protein modification
More informationBiomolecular Mass Spectrometry
Lipids ot different than other organic small molecules Carbohydrates Polymers of monosaccharides linked via glycosidic bonds (acetals/ ketals) many different combinationsvery interesting no time ucleic
More informationEnzymes are highly specific
Manickam ugumaran Department of Biology University of Massachusetts Boston, MA 015 Enzymes are highly specific Enzymes distinguish between homologues (succinate and malonate). Enzymes acting on D-amino
More informationLC-MS Analysis of Botanicals
Botanical workshop UAB, Sept 11, 26 LC-MS Analysis of Botanicals Jeevan K. Prasain, Ph.D. Department of Pharmacology & Toxicology, UAB Purdue-UAB Botanicals Center for Age-related Disease Applications
More informationA Chemical Look at Proteins: Workhorses of the Cell
A Chemical Look at Proteins: Workhorses of the Cell A A Life ciences 1a Lecture otes et 4 pring 2006 Prof. Daniel Kahne Life requires chemistry 2 amino acid monomer and it is proteins that make the chemistry
More informationMass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University
Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk previously Peptide fragmentation Hybrid instruments 117 The Building Blocks of Life DNA RNA Proteins
More informationChapter 23 Enzymes 1
Chapter 23 Enzymes 1 Enzymes Ribbon diagram of cytochrome c oxidase, the enzyme that directly uses oxygen during respiration. 2 Enzyme Catalysis Enzyme: A biological catalyst. With the exception of some
More information1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: =3x10-5 = 30μM
1. Measurement of the rate constants for simple enzymatic reaction obeying Michaelis- Menten kinetics gave the following results: k 1 = 2 x 10 8 M -1 s -1, k 2 = 1 x 10 3 s -1, k 3 = 5 x 10 3 s -1 a) What
More informationOperating Instructions
Sequazyme C-Peptide Sequencing Kit Operating Instructions 1 Product Description The Sequazyme C-Peptide Sequencing Kit enables peptide digestion and the analysis of sequentially truncated peptides using
More informationMass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications
- Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications Adapted from Mass Spectrometry in Biotechnology Gary Siuzdak,, Academic Press 1996 1 Introduction
More informationTargeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS. Kayleigh Arthur
Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS Kayleigh Arthur K.Arthur@lboro.ac.uk Introduction LC-MS is a highly used technique for untargeted profiling analyses
More informationIon Source. Mass Analyzer. Detector. intensity. mass/charge
Proteomics Informatics Overview of spectrometry (Week 2) Ion Source Analyzer Detector Peptide Fragmentation Ion Source Analyzer 1 Fragmentation Analyzer 2 Detector b y Liquid Chromatography (LC)-MS/MS
More informationChapter 3. Structure of Enzymes. Enzyme Engineering
Chapter 3. Structure of Enzymes Enzyme Engineering 3.1 Introduction With purified protein, Determining M r of the protein Determining composition of amino acids and the primary structure Determining the
More informationCatalysis & specificity: Proteins at work
Catalysis & specificity: Proteins at work Introduction Having spent some time looking at the elements of structure of proteins and DNA, as well as their ability to form intermolecular interactions, it
More informationChemistry 135, First Exam. September 23, Chem 135, Exam 1 SID:
Chemistry 135, First Exam September 23, 2015 This exam will be worth 15% of your overall grade. Please read all instructions/questions carefully and provide answers in the space provided. There should
More informationChapter 11: Enzyme Catalysis
Chapter 11: Enzyme Catalysis Matching A) high B) deprotonated C) protonated D) least resistance E) motion F) rate-determining G) leaving group H) short peptides I) amino acid J) low K) coenzymes L) concerted
More informationPeptide and Protein Analysis Primary (1 ) structure of a peptide or protein is the amino acid sequence
n-suppport cyclization 2 3 3 FM R n 1) Pd(0), Et 3 i 2) piperidine R 2 2 3 3 2 R n PyBP R 2 2 3 R n F 3 2, 3, F,! anisole anisole! R n 3 R 2 R 2 49 Peptide and Protein Analysis Primary (1 ) structure of
More informationMass Spectrometry Infrastructure
Mass Spectrometry Infrastructure Todd Williams, Ph.D. Director KU Mass Spectrometry and Analytical Proteomics Laboratory Mass Spectrometry Lab B025 Malott Hall Mission The Mass Spectrometry and analytical
More informationMALDI Imaging Mass Spectrometry
MALDI Imaging Mass Spectrometry Nan Kleinholz Mass Spectrometry and Proteomics Facility The Ohio State University Mass Spectrometry and Proteomics Workshop What is MALDI Imaging? MALDI: Matrix Assisted
More information1. Sample Introduction to MS Systems:
MS Overview: 9.10.08 1. Sample Introduction to MS Systems:...2 1.1. Chromatography Interfaces:...3 1.2. Electron impact: Used mainly in Protein MS hard ionization source...4 1.3. Electrospray Ioniztion:
More informationProtein sequence mapping is commonly used to
Reproducible Microwave-Assisted Acid Hydrolysis of Proteins Using a Household Microwave Oven and Its Combination with LC-ESI MS/MS for Mapping Protein Sequences and Modifications Nan Wang and Liang Li
More informationA Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization
A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization Amina S. Woods and Marilyn A. Huestis Chemistry and Drug Metabolism, NIDA Intramural Research Program, NIDA, NIH, Baltimore,
More informationMinjia Tan, Ph.D Shanghai Institute of Materia Medica, Chinese Academy of Sciences
Lysine Glutarylation Is a Protein Posttranslational Modification Regulated by SIRT5 Minjia Tan, Ph.D Shanghai Institute of Materia Medica, Chinese Academy of Sciences Lysine: the most frequently modified
More informationPTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System
Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow
More informationH 2 C NH 3 CH 2 CHCOO
Make sure You have FIVE Different 110 April 29, 2009 Pages Including this over Page. over Page You may pick up your graded exam after 120 minutes Final Exam 5/4/09 until 12/01/09 DETA TIS SEET AND USE
More informationDouglas S. Masterson* Department of Chemistry and Biochemistry, The University of Southern Mississippi, Hattiesburg, MS 39406, USA
ARTICLES Free Radical Induced Site-Specific Peptide Cleavage in the Gas Phase: Low-Energy Collision-Induced Dissociation in ESI- and MALDI Mass Spectrometry Huiyong Yin, Almary Chacon, and Ned A. Porter
More informationThe 1997 ABRF Mass Spectrometry Committee Collaborative Study: Identification of Phosphopeptides in a Tryptic Digest of Apomyoglobin
The 1997 ABRF Mass Spectrometry Committee Collaborative Study: Identification of Phosphopeptides in a Tryptic Digest of Apomyoglobin Kristine Swiderek, Farzin Gharahdaghi, Lowell Ericsson, Murray Hackett,
More informationBeta Amyloid Peptides
Beta Amyloid Peptides The Most Comprehensive Collection for Alzheimer s Disease Academic Services Pharmaceutical Services Beta Amyloid Peptides The Most Comprehensive Collection for Alzheimer s Disease
More informationThe MOLECULES of LIFE
The MOLECULES of LIFE Physical and Chemical Principles Solutions Manual Prepared by James Fraser and Samuel Leachman Chapter 16 Principles of Enzyme Catalysis Problems True/False and Multiple Choice 1.
More informationDouble charge of 33kD peak A1 A2 B1 B2 M2+ M/z. ABRF Proteomics Research Group - Qualitative Proteomics Study Identifier Number 14146
Abstract The 2008 ABRF Proteomics Research Group Study offers participants the chance to participate in an anonymous study to identify qualitative differences between two protein preparations. We used
More informationO H 2 N. α H. Chapter 4 - Amino Acids
hapter 4 - Amino Acids Introduction Several amino acids were produced in the electrical discharge in the reducing, primordial atmosphere that gave rise to the first biomolecules (see chapter 1). The importance
More informationLibrary identifications for Lemnaceae
Library identifications for Lemnaceae NP-001984 ESI+ NP-001984 present in, enriched in (15.47min) NP-001984 -MS^E CH 3 Moupinamide H NH NP-005512 + NP-016675 ESI- s NP-005512 NP-016675 NP-005512 present
More informationSupporting Information 3,4-Dihydroxyphenylalanine Peptides as. Nonperturbative Quantum Dot Sensors of
Supporting Information 3,4-Dihydroxyphenylalanine Peptides as Nonperturbative Quantum Dot Sensors of Aminopeptidase Valle Palomo 1, Sebastián A. Díaz 2, Michael H. Stewart 3, Kimihiro Susumu 3, Igor L.
More informationFundamentals of Soft Ionization and MS Instrumentation
Fundamentals of Soft Ionization and MS Instrumentation Ana Varela Coelho varela@itqb.unl.pt Mass Spectrometry Lab Analytical Services Unit Index Mass spectrometers and its components Ionization methods:
More informationLABORATÓRIUMI GYAKORLAT SILLABUSZ SYLLABUS OF A PRACTICAL DEMONSTRATION. financed by the program
TÁMOP-4.1.1.C-13/1/KONV-2014-0001 projekt Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére program
More informationPrimary Structure Analysis. Automated Evaluation. LC-MS Data Sets
Primary Structure Analysis by Automated Evaluation of LC-MS Data Sets Mass Spec 29 Dr. Wozny, MassMap GmbH & Co. KG 1 LC-MS Peptide Mapping Origin of Signals Peptides with and without post-translational
More informationSupporting information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2014 Supporting information Glycan Reductive Isotope-coded Amino Acid Labeling (GRIAL) for Mass Spectrometry-based
More informationIntroduction to Proteomics 1.0
Introduction to Proteomics 1.0 CMSP Workshop Pratik Jagtap Managing Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s necessary for success using
More informationLipid Imaging Mass Spectrometry.
Lipid Imaging Mass Spectrometry. NH 2 P H H H H P H H P H N N Advanced Graduate Course in Metabolomics 3-11-2015 Janusz Kabarowski, Dept. of Microbiology, UAB. Matrix-Assisted Laser Desorption/Ionization
More informationProteins: Proteomics & Protein-Protein Interactions Part I
Proteins: Proteomics & Protein-Protein Interactions Part I Jesse Rinehart, PhD Department of Cellular & Molecular Physiology Systems Biology Institute DNA RNA PROTEIN DNA RNA PROTEIN Proteins: Proteomics
More informationMS1 and MS2 crosstalk in label free quantitation of mass spectrometry data independent acquisitions
MS1 and MS2 crosstalk in label free quantitation of mass spectrometry data independent acquisitions MS1 528.18 +++ m/z 568.98 ++ m/z 678.34 ++ m/z MS2/SWATH June 9th, 2013 Matthew J. Rardin SIRT3 regulated
More informationLearning Objectives. Overview of topics to be discussed 10/25/2013 HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS
HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS A clinical proteomics perspective Michael L. Merchant, PhD School of Medicine, University of Louisville Louisville, KY Learning Objectives
More informationElectronic Supplementary Information. Table of Contents
Electronic Supplementary Information Examination of native chemical ligation using peptidyl prolyl thioester Takahiro Nakamura, Akira Shigenaga, Kohei Sato, Yusuke Tsuda, Ken Sakamoto, and Akira Otaka*
More informationSUPPLEMENTARY INFORMATION. An orthogonal ribosome-trnas pair by the engineering of
SUPPLEMENTARY INFORMATION An orthogonal ribosome-trnas pair by the engineering of peptidyl transferase center Naohiro Terasaka 1 *, Gosuke Hayashi 1 *, Takayuki Katoh 1, and Hiroaki Suga 1,2 1 Department
More informationMS/MS to Targeted Proteomics (MRM)
MS/MS to Targeted Proteomics (MRM) How it worked on the Human Lens Proteome Jayson Falkner PhD jay@singleorganism.com Genes Show Limited Value in Predicting Diseases With only a few exceptions, what the
More informationUnbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM
Unbiased in-depth characterization of CEX fractions from a stressed mab by MS Matthias Berg, Novartis Pharma, BTDM Characterization of CEX fractions Biopharmaceuticals like IgGs show a certain degree of
More informationSYNAPT G2-S High Definition MS (HDMS) System
SYNAPT G2-S High Definition MS (HDMS) System High performance, versatility, and workflow efficiency of your MS system all play a crucial role in your ability to successfully reach your scientific and business
More informationCellular functions of protein degradation
Protein Degradation Cellular functions of protein degradation 1. Elimination of misfolded and damaged proteins: Environmental toxins, translation errors and genetic mutations can damage proteins. Misfolded
More informationLecture 18 (10/27/17) Lecture 18 (10/27/17)
Reading: Ch6; 225-232 Lecture 18 (10/27/17) Problems: Ch5 (text); 2 Ch6 (study guide-facts); 5, 6, 7, 14 NEXT Reading: Ch5; 164, 166-169 Problems: none Remember Monday at 6:30 in PHO-206 is the first MB
More informationAn Introduction to Enzyme and Coenzyme Chemistry, 2nd Ed. T. D. H. Bugg, Blackwell Science, Oxford, 2004
Combinatorial synthesis of linchpin β-turn mimic 1 2 DCC, BT 1 2 n -tbu 1 n -tbu 1) 2 FMC DCC, BT 2) piperidine 1 2 2 n -tbu 3 DCC, BT 1 2 n -tbu 3 1) Ph 3 P 2) cyclization 3) CF 3 C 2 2 1 n 3 2 Evaluated
More informationNature Methods: doi: /nmeth.3177
Supplementary Figure 1 Characterization of LysargiNase, trypsin and LysN missed cleavages. (a) Proportion of peptides identified in LysargiNase and trypsin digests of MDA-MB-231 cell lysates carrying 0,
More informationProteins? Protein function. Protein folding. Protein folding diseases. Protein interactions. Macromolecular assemblies. The end product of Genes
Proteins? Protein function Protein folding Protein folding diseases Protein interactions Macromolecular assemblies The end product of Genes Protein Unfolding DOD Acid Catalysis DOD HDOD + N H N D C N C
More informationCharacterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information
Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt
More informationProteomics/Peptidomics
Proteomics/Peptidomics System biology tools and preclinical models for translational research in endometriosis, ESHRE Campus workshop, 4-5 September 2009 E. Waelkens Proteomics: What? Proteins Proteomics
More informationFacile Cu(II) mediated conjugation of thioesters and thioacids to peptides and proteins under mild conditions
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2018 Facile Cu(II) mediated conjugation of thioesters and thioacids to peptides
More information7.014 Problem Set 2 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web.
MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Name: Section : 7.014 Problem Set 2 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions
More informationSupplementary Information. Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels
Supplementary Information Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels Nobuaki Takemori,,* Ayako Takemori,, Piriya Wongkongkathep, Michael Nshanian, Rachel R. Ogorzalek
More informationN α -Acetylation of yeast ribosomal proteins and its effect on protein synthesis
JOURNAL OF PROTEOMICS 74 (2011) 431 441 available at www.sciencedirect.com www.elsevier.com/locate/jprot N α -Acetylation of yeast ribosomal proteins and its effect on protein synthesis Masahiro Kamita
More informationDate: EXERCISE 4. Figure 1. Amino acid structure.
Student s name: Date: Points: Assistant s signature: Index numer: /6 EXERISE 4 AMIN AIDS AND PRTEINS. Amino acids are structural units (monomers) of proteins. There are 20 different amino acids coded for
More informationAlgal Biofuels Research: Using basic science to maximize fuel output. Jacob Dums, PhD candidate, Heike Sederoff Lab March 9, 2015
Algal Biofuels Research: Using basic science to maximize fuel output Jacob Dums, PhD candidate, jtdums@ncsu.edu Heike Sederoff Lab March 9, 2015 Outline Research Approach Dunaliella Increase Oil Content
More informationProperties of amino acids in proteins
Properties of amino acids in proteins one of the primary roles of DNA (but far from the only one!!!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids
More informationMultiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow
Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Purpose Described herein is a workflow that combines the isobaric tagging reagents, itraq Reagents, with the separation power
More informationAn Introduction to the Use of itraq Reagents for Amino Acid Analysis
An Introduction to the Use of itraq Reagents for Amino Acid Analysis Lisa Sapp Clinical Research and Forensic Toxicology Product Manager Mass Spectrometry Systems Amino Acid Analysis Using itraq Reagents
More informationMolecular Cell, Volume 46. Supplemental Information
Molecular Cell, Volume 46 Supplemental Information Mapping N-Glycosylation Sites across Seven Evolutionary Distant Species Reveals a Divergent Substrate Proteome Despite a Common Core Machinery Dorota
More informationMS/MS Scan Modes. Eötvös University, Budapest April 16, MS/MS Scan Modes. Árpád Somogyi. Product Ion Scan Select. Scan. Precursor Ion Scan Scan
MS/MS Modes Árpád Somogyi Eötvös University, Budapest April 16, 2012 MS/MS Modes Product Ion Precursor Ion Neutral Loss Δ ed Reaction Monitoring (SRM) 1 modes in a triple quadrupole (QqQ) (one quadrupole
More information