Département Hospitalo-Universitaire AUToimmune and HORmonal diseases

Size: px
Start display at page:

Download "Département Hospitalo-Universitaire AUToimmune and HORmonal diseases"

Transcription

1 Uth DHU Département Hospitalo-Universitaire AUToimmune and HORmonal diseases rs DIABETES ADRENAL DISEASES VASCULITIDES L immunomodulation du diabète. Quelles applications? quel avenir?

2 incidence [105/year] insulitis TYPE 1 DIABETES MELLITUS an autoimmune disease islet cell autoantibodies b cell selectivity anti-gad anti-ia2 anti-insulin anti-znt8 increasing incidence ( 3-4%/year) & geographical incidence variation (> 65/10 5 /year in Finland) Gianani R 2010, Diabetologia genes numerous numerous s Bottazzo & Doniach 1974, Lancet environment Gepts W 1965, Diabetes absence of a unique environmental factor

3 age Controls mortality rate /10 3 person-yr standardized mortality rate Skrivarhaug et al. Diabetologia 2006 [Norway] T1D MORTALITY Allegheny County childhood-onset (< 18) T1D registry diagnosed increased mortality compared to the general population n = 1075 acute renal cardio vascular Intermediate disease compared to high risk autoimmune diseases infections cancer Secrest et al. Diabetes 2010

4 ß cell mass TYPE 1 DIABETES: A CHRONIC DISEASE patient duration of diabetes heterogeneity diabetes recurrence Insulitis 1 22 years 60 days CD8+ T cells years 44 days CD8+ T cells years 92 days CD8+ T cells + ICA Bingley et al. Diabetologia 2006 diabetes hyperglycemia

5 TYPE I DIABETES NKT IL-4, IFN-g NK IFN-g autoantibodies CD1d APC NKG2D/MIC Cl II T CD4 TNF-a, IFN-g Cl II Cl I T reg b cell IL-10, TGF-b GRZ/perforin Pancreatic islet

6 TYPE I DIABETES immunosuppression APC Cl II insulin replacement therapy T CD4 b cell mass restoration graft regeneration TNF-a, IFN-g Cl II Cl I b cell tolerance induction GRZ/perforin Pancreatic islet

7 TYPE I DIABETES anti-tnfa [Etanercept] IL1 antagonists [Anakinra] autoantibodies anti-cd20 [Rituximab] APC Cl II T CD4 TNF-a, IFN-g Cl II Cl I cyclosporin A azathioprine + corticoids anti-thymoglobulin ± corticoids anti-cd3 GRZ/perforin intensive Insulin therapy b cell nicotinamide Pancreatic islet

8 TREATMENT OF DIABETES WITH ANTI-CD ± 1.86 nmol/l per month ± 1.30 nmol/l per month Herold KC et al. 2002, N Engl J Med

9 TREATMENT OF DIABETES WITH ANTI-CD3 months months months n = 40 (placebo) n = 40 (anti-cd3) Keymeulen B et al. 2005, N Engl J Med

10 TREATMENT OF DIABETES WITH ANTI-CD3 Keymeulen B et al. N Engl J Med 200

11 TYPE I DIABETES intrinsic T cell tolerance anergy changes in gene expression profiles peptides APC Cl II T CD4 TNF-a, IFN-g Cl II low-dose IL-2 Rapamycin/IL-2 T reg Cl I insulin IL-10, TGF-b extrinsic T cell tolerance GRZ/perforin GAD IA2,ZnT8 b cell DiaPep277 Pancreatic islet

12 TREATMENT OF PREDIABETES WITH INSULIN first and second degree relatives 3152 autoantibody positive 5 year risk > 50% in 372/2103 randomization to observation (n = 70) versus s.c. insulin twice daily 0.25 units/kg (n = 69) mean follow up 3.7 years s.c./i.v. & oral insulin (DPT1, 2002, N Engl J Med) Nasal insulin (Näntö-Salonen, 2008, Lancet)

13 TREATMENT OF PREDIABETES WITH ORAL INSULIN Diabetes Prevention Trial-Type first and second degree relatives 3483 autoantibody positive 5 year risk 26-50% in 388/2103 randomization to IAA 80 nu/ml 6.2%/year 10.4%/year 8.2%/year 6.4%/year oral insulin 7.7 mg/24h (n = 186, mean IAA 382 ± 555 nu/ml) versus placebo (n = 186, mean IAA 346 ± 336 nu/ml) Skyler J et al Diabetes Care 2005

14 GAD VACCINATION IN RECENT-ONSET T1D [Intention to treat analysis] n = 35 n = 34 sponse to GAD up to 15 months IL-5/-10/-13/-17/IFNg/TNFa IL-6/ mg GAD-alum days 1 & 30 within 6 months following onset GAD-induced expression of oxp3 & TNFa Ludvigsson et al, N Engl J Med, 2008

15 TrialNet intervention studies: within 100 days from diagnosis Anti-IL1β [Canakinumab] CTLA-4 Ig [Abatacept] in Recent Onset Diabetes Glutamic acid decarboxylase (GAD) in New Onset T1DM Metabolic Control in New Onset Diabetes Rituximab Study (Anti-CD20) Mycophenolate mofitil / dacliumab (MMF/DZB) study TrialNet prevention studies Oral insulin for prevention of Type 1 diabetes Study Anti-CD3 [Teplizumab] for prevention in relatives CTLA4-Ig [Abatacept] for prevention in relatives The Nutritional Intervention to Prevent Type 1 diabetes Study accessed 1st March, 2014.

16 TYPE 1 DIABETES T CELLS TO DIABETES PREVENTION APC T CD4 TNF-a, IFN-g b cell T CD8

17 HUMAN INSULIN 1 MALWMRLLPL 11 LALLALWGPD 21 PAAA FVNQHL 31 CGSHLVEALY 41 LVCGERGFFY 51 TPK PEPTIDE SIGNAL CHAINE B TRREAED 61 LQVGQVELGG 71 GPGAGSLQPL 81 ALEGSLQKRG 91 IVEQCCTSIC 101 SLYQLENYCN PEPTIDE C CHAINE A MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPK SRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN B9-23 MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLCGERGFFYTPM SRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN

18 CLASS I ALLELE-SPECIFIC PEPTIDES peptide sequence HLA class I HLVEALYLV A ALYLVCGER A3 A LYLVCGERGF A24 LVCGERGFFY A LVCGERGFFY A3 A11 VCGERGFFYT A1 VCGERGFFYT A2 VCGERGFFYT B8 VCGERGFFYT B18 GERGFFYT A1 GERGFFYT B ERGFFYTPK A FYTPKTRRE B TPKTRREAEDL B8 peptide sequence class I allele 2-11 A2 ALWMRLLPLL A24 ALWMRLLPLL B RLLPLLALL A2 RLLPLLALL A RLLPLLALLAL A LALWGPDPAA A2 LALWGPDPAA A ALWGPDPAAA A2 ALWGPDPAAA A26 Toma et al, PNAS 2005; Diabetes 2009

19 CD8+ T CELL RESPONSE TO A2-RESTRICTED PREPROINSULIN PEPTIDES [ELISPOTassay] peptide binding % CD8+ IFN response 10-4 M 10-6 M long standing recent onset total 34-42* 58% 37% 2/4 4/10 6/ * 36% 65% 7/13 1/4 8/ * 96% 71% 5/15 2/4 7/ * 44% 36% 7/13 0/4 44% 7/ * 96% 94% 7/13 1/4 8/17 * Val 42, L 14, L 16, A 23 & A 24 were identified as C-terminal residues generated by proteasome digestion in vitro. ** 6-14 or 6-16 immunization anti-6-14 or cross-reactives responses anti-6-16 to 6-14 and 6-16 T cell clones Toma et al, PNAS2005; Toma et al. Diabetes 2009

20 PE-A: TTM PE-A PE-A: TTM PE-A PE-A: TTM PE-A TETRAMER RECOGNITION OF BLOOD CD8 + T CELLS TCD8 + b cells class I peptide streptavidin biotin A2.1-restricted peptides class I preproinsulin peptide A A A A A A A A controls 10 4 PDHase MATA Nef Dt1A5 TTM A2 PPIh_Dt1A5 TTM A fcsÉCD3+ CD8+ Dt1A5 TTM A2 PPIh_Dt1A5 TTM A fcsÉCD3+ CD _D124D 6-14.fcsÉCD3+ CD TCD PerCP-A: CD8 PerCP-A PerCP-A: CD8 PerCP-A PerCP-A: CD8 PerCP-A Luce et al. Diabetes 2011 Sandrine Luce

21 TETRAMER RECOGNITION OF BLOOD CD8 + T CELLS A2.1-restricted peptides single cell PCR central memory T cells effector memory T cells Luce et al. Diabetes 2011

22 AUC mg.h/dl mg NEW PRECLINICAL T1D MODELS beta cell mass x A2/DQ8 Tg Human insulin OUF YES Insulin A2.1 DQ8 genes insulin/a2.1/dq8 mice Luce et al. unpublished Intraperitoneal glucose tolerance test s.c./i.v. & oral insulin (DPT1, 2002, N Engl J Med) Nasal insulin (Näntö-Salonen, 2008, Lancet) YES C ol YES C ol

23 DIABETES IN RIP-B7 TRANSGENIC YES MICE % total islets diabetes (%) TCR CD11c CD8 CD28 TCR T cell CD19 CD4 D4 MHC B7.2 dapi non anti-glucagon diabetic anti-cd3 diabetic CD11b RIP-B7 YES Age (weeks) Luce et al. unpublished

24 DIABETES IN RIP-B7 TRANSGENIC YES MICE rdu proliferation assay CD8 + IFNγ Elispot assay CD8 + TMr + expansion assay Luce et al. unpublished

25 FROM RESEARCH TO CLINIC Uth DHU rs FROM PALLIATIVE TREATMENT TO PREVENTION OF TYPE 1 DIABETES diagnosis immunotherapy prediabetes damaged islet of Langerhans diabetes diagnostics T NKT T reg APC NK T CD8 B T CD4 Class II-restricted epitopes modified by inclusion of a thiol-disulfide oxidoreductase motif within flanking residues peptide autoantigen HLA Immunotherapy EU FP7 project Carlier et al. PloSOne 2012 YES mice Luce S et al. Diabetes 2011

26 Uth DHU Département Hospitalo-Universitaire AUToimmune and HORmonal diseases rs DIABETES ADRENAL DISEASES VASCULITIDES Andrea Toma Sandrine Luce Etienne Larger Roberto Mallone François Lemonnier Agnès Lehuen Sylvianne Muller, Jean Paul Briand (CNRS, Strasbourg) Decio Eizirik (Brussels) Charbel Masaad (Paris) Laurent Drouot, Olivier Boyer (Rouen)

Immune Modulation of Type1 Diabetes

Immune Modulation of Type1 Diabetes Immune Modulation of Type1 Diabetes Jay S. Skyler, MD, MACP Division of Endocrinology, Diabetes, and Metabolism and Diabetes Research Institute University of Miami Miller School of Medicine Ideal Therapeutic

More information

Prediction and Prevention of Type 1 Diabetes. How far to go?

Prediction and Prevention of Type 1 Diabetes. How far to go? Prediction and Prevention of Type 1 Diabetes. How far to go? Peter Colman Diabetes and Endocrinology Royal Melbourne Hospital Royal Melbourne Hospital Lancet, Saturday 30 th November 1974; p. 1279-1282

More information

Designing An)gen- specific Immunotherapy for Treatment of Type 1 Diabetes.

Designing An)gen- specific Immunotherapy for Treatment of Type 1 Diabetes. Designing An)gen- specific Immunotherapy for Treatment of Type 1 Diabetes. Kristin V. Tarbell Immune Tolerance Unit, Diabetes Endocrinology and Obesity Branch, NIDDK Outline Background on type 1 diabetes

More information

New targets for prevention of type 1 diabetes George S. Eisenbarth Barbara Davis Center Unversity Colorado

New targets for prevention of type 1 diabetes George S. Eisenbarth Barbara Davis Center Unversity Colorado New targets for prevention of type 1 diabetes George S. Eisenbarth Barbara Davis Center Unversity Colorado WEB BOOK: Immunology of Type 1 Diabetes HTTP://WWW.BARBARADAVISCENTER.ORG Board Member/Advisory

More information

Immune therapy in type 1 diabetes mellitus.

Immune therapy in type 1 diabetes mellitus. Immune therapy in type 1 diabetes mellitus. Lernmark, Åke; Elding Larsson, Helena Published in: Nature Reviews Endocrinology DOI: 10.1038/nrendo.2012.237 2013 Link to publication Citation for published

More information

Targeting the Trimolecular Complex for Immune Intervention. Aaron Michels MD

Targeting the Trimolecular Complex for Immune Intervention. Aaron Michels MD Targeting the Trimolecular Complex for Immune Intervention Aaron Michels MD Disclosures Research Grant from Novartis. Research Grant from NovoNordisk. Take Home Points Type 1 diabetes is an immunologic

More information

Dr Dario Tuccinardi University Campus Bio-Medico of Rome

Dr Dario Tuccinardi University Campus Bio-Medico of Rome Dr Dario Tuccinardi University Campus Bio-Medico of Rome d.tuccinardi@unicampus.it Topics to be discussed Epidemiology (increase in incidence) Genetics (more cases with moderate HLA risk alleles) Pathogenesis

More information

Chapter 10. Humoral Autoimmunity 6/20/2012

Chapter 10. Humoral Autoimmunity 6/20/2012 Chapter 10 Humoral Autoimmunity 6/20/2012 DIPP Populations Study: Quartile Levels Insulin Autoantibodies (6 month post first IAA) and progression to Diabetes Parrika et al Diabetologia 2012 MSD ELECTROCHEMILUMINESCENT

More information

Depleting T cells in newly diagnosed autoimmune (type 1) diabetes--are we getting anywhere?

Depleting T cells in newly diagnosed autoimmune (type 1) diabetes--are we getting anywhere? Depleting T cells in newly diagnosed autoimmune (type 1) diabetes--are we getting anywhere? Lernmark, Åke Published in: Diabetes DOI: 10.2337/db13-1207 Published: 2013-01-01 Link to publication Citation

More information

IMMUNOTHERAPIE DU DIABETE AUTO-IMMUN

IMMUNOTHERAPIE DU DIABETE AUTO-IMMUN IMMUNOTHERAPIE DU DIABETE AUTO-IMMUN INSERM U1013 INSTITUT UNIVERSITAIRE DE FRANCE Natural history of type 1 diabetes b cell function (%) Time AN ALARMING EPIDEMIOLOGICAL TREND EURODIAB registered 29 311

More information

Diabetes mellitus is a complex of syndromes characterized metabolically by hyperglycemia and altered glucose metabolism, and associated

Diabetes mellitus is a complex of syndromes characterized metabolically by hyperglycemia and altered glucose metabolism, and associated Diabetes mellitus is a complex of syndromes characterized metabolically by hyperglycemia and altered glucose metabolism, and associated pathologically with specific microvascular and macrovascular complications.

More information

Evgenija Homšak,M.Ph., M.Sc., EuSpLM. Department for laboratory diagnostics University Clinical Centre Maribor Slovenia

Evgenija Homšak,M.Ph., M.Sc., EuSpLM. Department for laboratory diagnostics University Clinical Centre Maribor Slovenia Evgenija Homšak,M.Ph., M.Sc., EuSpLM. Department for laboratory diagnostics University Clinical Centre Maribor Slovenia 14th EFLM Continuing Postgraduate Course in Clinical Chemistry and Laboratory Medicine

More information

Staging of Type 1 Diabetes: Clinical Implications. April Deborah Hefty, MN, RN, CDE.

Staging of Type 1 Diabetes: Clinical Implications. April Deborah Hefty, MN, RN, CDE. Staging of Type 1 Diabetes: TT Clinical Implications April 2016 Deborah Hefty, MN, RN, CDE dhefty@benaroyaresearch.org BRI s major contributions to type 1 diabetes research Identified type 1 diabetes susceptibility

More information

T Cell Activation, Costimulation and Regulation

T Cell Activation, Costimulation and Regulation 1 T Cell Activation, Costimulation and Regulation Abul K. Abbas, MD University of California San Francisco 2 Lecture outline T cell antigen recognition and activation Costimulation, the B7:CD28 family

More information

Disclosures. Sanofi Advisory Board DSMB for Novo Nordisk Consultant for NeoStem. Altering The Course Of Type 1 Diabetes. UCSF Diabetes Update 4.29.

Disclosures. Sanofi Advisory Board DSMB for Novo Nordisk Consultant for NeoStem. Altering The Course Of Type 1 Diabetes. UCSF Diabetes Update 4.29. 4/3/15 Altering The Course Of Type 1 Diabetes UCSF Diabetes Update 4.29.15 Stephen E. Gitelman, MD UCSF sgitelma@ucsf.edu Disclosures Sanofi Advisory Board DSMB for Novo Nordisk Consultant for NeoStem 1

More information

Cover Page. The handle holds various files of this Leiden University dissertation

Cover Page. The handle   holds various files of this Leiden University dissertation Cover Page The handle http://hdl.handle.net/1887/39620 holds various files of this Leiden University dissertation Author: Alkemade, Gonnie Title: Destruction, regeneration and replacement of beta-cells

More information

IPS Modern management of childhood diabetes mellitus

IPS Modern management of childhood diabetes mellitus Modern management of childhood diabetes mellitus Professor Philippe LYSY, MD PhD Pediatric endocrinology and diabetology Institut de Recherche Expérimentale et Clinique Université Catholique de Louvain

More information

TYPE 1 DIABETES MELLITUS: AUTOIMMUNE DIABETES

TYPE 1 DIABETES MELLITUS: AUTOIMMUNE DIABETES 27 th Nov. 2015 TYPE 1 DIABETES MELLITUS: AUTOIMMUNE DIABETES Bo Kyung Koo CONTENTS 1. Introduction on Type 1 diabetes (T1DM) 2. Pathogenesis of T1DM 3. Immunologic Markers in T1DM 4. Atypical T1DM 1 Diabetes

More information

Immune system and diabetes. Chairmen: J. Belkhadir (Morocco) N.M. Lalic (Serbia)

Immune system and diabetes. Chairmen: J. Belkhadir (Morocco) N.M. Lalic (Serbia) Immune system and diabetes Chairmen: J. Belkhadir (Morocco) N.M. Lalic (Serbia) Autoimmunity and prevention of type 1 diabetes R. Mallone (France) Autoimmunity and Prevention of Type 1 Diabetes Roberto

More information

Benaroya Research Institute. Update on Type 1 Diabetes Trials. to Save Beta Cells. Carla Greenbaum MD. Seattle, WA

Benaroya Research Institute. Update on Type 1 Diabetes Trials. to Save Beta Cells. Carla Greenbaum MD. Seattle, WA Benaroya Research Institute Update on Type 1 Diabetes Trials Carla Greenbaum MD Seattle, WA to Save Beta Cells 1552 BC earliest written record of DM 1 st Breakthrough in understanding: 1889 The problem

More information

FOCiS. Lecture outline. The immunological equilibrium: balancing lymphocyte activation and control. Immunological tolerance and immune regulation -- 1

FOCiS. Lecture outline. The immunological equilibrium: balancing lymphocyte activation and control. Immunological tolerance and immune regulation -- 1 1 Immunological tolerance and immune regulation -- 1 Abul K. Abbas UCSF FOCiS 2 Lecture outline Principles of immune regulation Self-tolerance; mechanisms of central and peripheral tolerance Inhibitory

More information

Antigen-Based Prediction and Prevention of Type 1 Diabetes

Antigen-Based Prediction and Prevention of Type 1 Diabetes DOCTOR OF MEDICAL SCIENCE Antigen-Based Prediction and Prevention of Type 1 Diabetes Jacob Sten Petersen This review has been accepted as a thesis together with ten previously published papers, by the

More information

Enhancing the Clinical Activity of HER2/neu Specific T Cells. William Gwin, MD Internal Medicine, Resident University of Washington

Enhancing the Clinical Activity of HER2/neu Specific T Cells. William Gwin, MD Internal Medicine, Resident University of Washington Enhancing the Clinical Activity of HER2/neu Specific T Cells William Gwin, MD Internal Medicine, Resident University of Washington Immunotherapy and Cancer Cancer vaccines were originally used in melanoma

More information

Self-tolerance. Lack of immune responsiveness to an individual s own tissue antigens. Central Tolerance. Peripheral tolerance

Self-tolerance. Lack of immune responsiveness to an individual s own tissue antigens. Central Tolerance. Peripheral tolerance Autoimmunity Self-tolerance Lack of immune responsiveness to an individual s own tissue antigens Central Tolerance Peripheral tolerance Factors Regulating Immune Response Antigen availability Properties

More information

Lecture outline. Immunological tolerance and immune regulation. Central and peripheral tolerance. Inhibitory receptors of T cells. Regulatory T cells

Lecture outline. Immunological tolerance and immune regulation. Central and peripheral tolerance. Inhibitory receptors of T cells. Regulatory T cells 1 Immunological tolerance and immune regulation Abul K. Abbas UCSF 2 Lecture outline Central and peripheral tolerance Inhibitory receptors of T cells Regulatory T cells 1 The immunological equilibrium:

More information

Update on Type 1 Diabetes Trials to Save Beta Cells

Update on Type 1 Diabetes Trials to Save Beta Cells Benaroya Research Institute Carla Greenbaum MD Seattle, WA Update on Type 1 Diabetes Trials to Save Beta Cells 1552 BC earliest written record of DM 1 st Breakthrough in understanding: 1889 The problem

More information

Autoimmune disease: Type 1 diabetes

Autoimmune disease: Type 1 diabetes Eur. J. Immunol. 2009. 39: 1991 2058 FORUM 2049 Autoimmune disease: Type 1 diabetes Remodeling rodent models to mimic human type 1 diabetes Matthias von Herrath 1 and Gerald T. Nepom 2 1 Center for Type

More information

Yes, We are Close to Preventing Diabetes!

Yes, We are Close to Preventing Diabetes! Yes, We are Close to Preventing Diabetes! Peter A. Gottlieb, MD Barbara Davis Center University of Colorado Health Sciences Center Denver, CO Practical Ways to Achieve Targets in Diabetes Care, Keystone,

More information

GAD65 Autoantibodies Detected by Electrochemiluminescence Assay Identify High Risk for Type 1 Diabetes

GAD65 Autoantibodies Detected by Electrochemiluminescence Assay Identify High Risk for Type 1 Diabetes BRIEF REPORT GAD65 Autoantibodies Detected by Electrochemiluminescence Assay Identify High Risk for Type 1 Diabetes Dongmei Miao, K. Michelle Guyer, Fran Dong, Ling Jiang, Andrea K. Steck, Marian Rewers,

More information

Immunology Lecture 4. Clinical Relevance of the Immune System

Immunology Lecture 4. Clinical Relevance of the Immune System Immunology Lecture 4 The Well Patient: How innate and adaptive immune responses maintain health - 13, pg 169-181, 191-195. Immune Deficiency - 15 Autoimmunity - 16 Transplantation - 17, pg 260-270 Tumor

More information

What is Autoimmunity?

What is Autoimmunity? Autoimmunity What is Autoimmunity? Robert Beatty MCB150 Autoimmunity is an immune response to self antigens that results in disease. The immune response to self is a result of a breakdown in immune tolerance.

More information

What is Autoimmunity?

What is Autoimmunity? Autoimmunity What is Autoimmunity? Robert Beatty MCB150 Autoimmunity is an immune response to self antigens that results in disease. The immune response to self is a result of a breakdown in immune tolerance.

More information

Is It Time to Screen the General Population for Type 1 Diabetes?

Is It Time to Screen the General Population for Type 1 Diabetes? Is It Time to Screen the General Population for Type 1 Diabetes? Kimber M Simmons, MD, MS 1 and Aaron W Michels, MD 2 1. Pediatric Endocrinology and Diabetes Fellow, Children s Hospital Colorado, Aurora,

More information

What is New in Type 1 Diabetes? Prof. Åke Lernmark

What is New in Type 1 Diabetes? Prof. Åke Lernmark What is New in Type 1 Diabetes? Lunds Universitet/CRC Skånes University Hospital SUS Malmö, Sweden 1 What s new in type 1 diabetes? Is the disease still increasing? What is the etiology? What is the pathogenesis?

More information

Chapter 11. Prediction of Type 1A Diabetes: The Natural History of the Prediabetic Period

Chapter 11. Prediction of Type 1A Diabetes: The Natural History of the Prediabetic Period Chapter 11 Prediction of Type 1A Diabetes: The Natural History of the Prediabetic Period Greenbaum et al Diabetes June 11, 212 Fall in C peptide During First 2 Years From Diagnosis: Evidence of at Least

More information

β-cell Preservation and Regeneration After Islet Transplantation

β-cell Preservation and Regeneration After Islet Transplantation β-cell Preservation and Regeneration After Islet Transplantation Jyuhn-Huarng Juang, MD Division of Endocrinology and Metabolism, Department of Internal Medicine, Chang Gung University and Memorial Hospital,

More information

Tolerance 2. Regulatory T cells; why tolerance fails. FOCiS. Lecture outline. Regulatory T cells. Regulatory T cells: functions and clinical relevance

Tolerance 2. Regulatory T cells; why tolerance fails. FOCiS. Lecture outline. Regulatory T cells. Regulatory T cells: functions and clinical relevance 1 Tolerance 2. Regulatory T cells; why tolerance fails Abul K. Abbas UCSF FOCiS 2 Lecture outline Regulatory T cells: functions and clinical relevance Pathogenesis of autoimmunity: why selftolerance fails

More information

Low HLA binding of diabetes-associated CD8+ T-cell epitopes is increased by post translational modifications

Low HLA binding of diabetes-associated CD8+ T-cell epitopes is increased by post translational modifications Sidney et al. BMC Immunology (2018) 19:12 https://doi.org/10.1186/s12865-018-0250-3 RESEARCH ARTICLE Open Access Low HLA binding of diabetes-associated CD8+ T-cell epitopes is increased by post translational

More information

Advancing Opportunities To Prevent Type 1 Diabetes

Advancing Opportunities To Prevent Type 1 Diabetes Advancing Opportunities To Prevent Type 1 Diabetes Dr. Allison Green Centre for Immunology and Infection Hull York Medical School York University Type 1 Diabetes Insulin deficiency destabilizes regulation

More information

Early Diagnosis of T1D Through An3body Screening

Early Diagnosis of T1D Through An3body Screening Early Diagnosis of T1D Through An3body Screening Andrea Steck, M.D. Barbara Davis Center for Childhood Diabetes Keystone Conference July 15, 2017 Presenter Disclosure Andrea Steck Disclosed no conflict

More information

Altering The Course Of Type 1 Diabetes

Altering The Course Of Type 1 Diabetes Altering The Course Of Type 1 Diabetes JDRF TypeOneNation Summit 09.18.16 Stephen E. Gitelman, MD UCSF sgitelma@.ucsf.edu Today s Agenda My story The path to Type 1 Diabetes Prevention efforts New-onset

More information

The regenerative therapy of type 1 diabetes mellitus 21April 2017 Girne, Northern Cyprus 53rd Turkish National Diabetes Congress

The regenerative therapy of type 1 diabetes mellitus 21April 2017 Girne, Northern Cyprus 53rd Turkish National Diabetes Congress The regenerative therapy of type 1 diabetes mellitus 21April 2017 Girne, Northern Cyprus 53rd Turkish National Diabetes Congress Thomas Linn Clinical Research Unit Centre of Internal Medicine Justus Liebig

More information

We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors

We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists 4,100 116,000 120M Open access books available International authors and editors Downloads Our

More information

Is there evidence for post-translational modification of beta cell autoantigens in the aetiology and pathogenesis of type 1 diabetes?

Is there evidence for post-translational modification of beta cell autoantigens in the aetiology and pathogenesis of type 1 diabetes? Is there evidence for post-translational modification of beta cell autoantigens in the aetiology and pathogenesis of type 1 diabetes? Lernmark, Åke Published in: Diabetologia DOI: 10.1007/s00125-013-3041-7

More information

Prediction and Prevention of Type 1 Diabetes

Prediction and Prevention of Type 1 Diabetes Prediction and Prevention of Type 1 Diabetes Helping to defuse the diabetes The number of people in the world currently with type 1 diabetes is around 17 million and increasing rapidly. Already there are

More information

Autoimmunity. Mark S. Anderson, MD, PhD University of California San Francisco

Autoimmunity. Mark S. Anderson, MD, PhD University of California San Francisco Autoimmunity Mark S. Anderson, MD, PhD University of California San Francisco Autoimmunity Definition: immune response against self (auto-) antigen General principles: Significant health burden, 5% of

More information

LESSON 2: THE ADAPTIVE IMMUNITY

LESSON 2: THE ADAPTIVE IMMUNITY Introduction to immunology. LESSON 2: THE ADAPTIVE IMMUNITY Today we will get to know: The adaptive immunity T- and B-cells Antigens and their recognition How T-cells work 1 The adaptive immunity Unlike

More information

BDC Keystone Genetics Type 1 Diabetes. Immunology of diabetes book with Teaching Slides

BDC Keystone Genetics Type 1 Diabetes.  Immunology of diabetes book with Teaching Slides BDC Keystone Genetics Type 1 Diabetes www.barbaradaviscenter.org Immunology of diabetes book with Teaching Slides PRACTICAL Trailnet screens relatives and new onset patients for autoantibodies and HLA

More information

Antigen Presentation and T Lymphocyte Activation. Abul K. Abbas UCSF. FOCiS

Antigen Presentation and T Lymphocyte Activation. Abul K. Abbas UCSF. FOCiS 1 Antigen Presentation and T Lymphocyte Activation Abul K. Abbas UCSF FOCiS 2 Lecture outline Dendritic cells and antigen presentation The role of the MHC T cell activation Costimulation, the B7:CD28 family

More information

Determinants of Immunogenicity and Tolerance. Abul K. Abbas, MD Department of Pathology University of California San Francisco

Determinants of Immunogenicity and Tolerance. Abul K. Abbas, MD Department of Pathology University of California San Francisco Determinants of Immunogenicity and Tolerance Abul K. Abbas, MD Department of Pathology University of California San Francisco EIP Symposium Feb 2016 Why do some people respond to therapeutic proteins?

More information

Ray A. Kroc & Robert L. Kroc. BDC Lectureship 2014

Ray A. Kroc & Robert L. Kroc. BDC Lectureship 2014 Ray A. Kroc & Robert L. Kroc BDC Lectureship 2014 Ray Kroc (Big Mack) 1902-1984 Predominant establisher of the McDonald's Corporation (1961) Philanthropist: Research and treatment of alcoholism, diabetes,

More information

Mucosal Immune System

Mucosal Immune System Exam Format 100 points - 60 pts mandatory; 40 points where 4, 10 point questions will be chosen Some open-ended questions, some short answer. Kuby question Cytokines Terminology How do cytokines achieve

More information

Tolerance 2. Regulatory T cells; why tolerance fails. Abul K. Abbas UCSF. FOCiS

Tolerance 2. Regulatory T cells; why tolerance fails. Abul K. Abbas UCSF. FOCiS 1 Tolerance 2. Regulatory T cells; why tolerance fails Abul K. Abbas UCSF FOCiS 2 Lecture outline Regulatory T cells: functions and clinical relevance Pathogenesis of autoimmunity: why selftolerance fails

More information

Part XI Type 1 Diabetes

Part XI Type 1 Diabetes Part XI Type 1 Diabetes Introduction Åke Lernmark Epidemiology Type 1 diabetes is increasing worldwide and shows epidemic proportions in several countries or regions [1]. There is evidence to suggest that

More information

Attribution: University of Michigan Medical School, Department of Microbiology and Immunology

Attribution: University of Michigan Medical School, Department of Microbiology and Immunology Attribution: University of Michigan Medical School, Department of Microbiology and Immunology License: Unless otherwise noted, this material is made available under the terms of the Creative Commons Attribution

More information

Diabetes vaccines: review of the clinical evidence

Diabetes vaccines: review of the clinical evidence Diabetes vaccines: review of the clinical evidence Clin. Invest. (2011) 1(1), 157 169 As preservation of residual b-cell function is clinically important, such an effect constitutes clinical evidence.

More information

Biochemical markers could predict type-1 diabetes mellitus

Biochemical markers could predict type-1 diabetes mellitus Molecular and Biochemical Diagnosis (MBD) Vol 2, No 1, 2016 Original Article Biochemical markers could predict type-1 diabetes mellitus Ragaa H. M. Salama 1*, Yasser F. Abd-Elraheem 2, Khaled H. Mahmoud

More information

IMMUNOTHERAPY FOR CANCER A NEW HORIZON. Ekaterini Boleti MD, PhD, FRCP Consultant in Medical Oncology Royal Free London NHS Foundation Trust

IMMUNOTHERAPY FOR CANCER A NEW HORIZON. Ekaterini Boleti MD, PhD, FRCP Consultant in Medical Oncology Royal Free London NHS Foundation Trust IMMUNOTHERAPY FOR CANCER A NEW HORIZON Ekaterini Boleti MD, PhD, FRCP Consultant in Medical Oncology Royal Free London NHS Foundation Trust ASCO Names Advance of the Year: Cancer Immunotherapy No recent

More information

Diseases of Immunity 2017 CL Davis General Pathology. Paul W. Snyder, DVM, PhD Experimental Pathology Laboratories, Inc.

Diseases of Immunity 2017 CL Davis General Pathology. Paul W. Snyder, DVM, PhD Experimental Pathology Laboratories, Inc. Diseases of Immunity 2017 CL Davis General Pathology Paul W. Snyder, DVM, PhD Experimental Pathology Laboratories, Inc. Autoimmunity Reflects a loss of immunologic tolerance Mechanisms Auto-antibodies

More information

Delay of Type I diabetes in high risk, first degree relatives by parenteral antigen administration: the Schwabing Insulin Prophylaxis Pilot Trial

Delay of Type I diabetes in high risk, first degree relatives by parenteral antigen administration: the Schwabing Insulin Prophylaxis Pilot Trial Diabetologia (1998) 41: 536±541 Ó Springer-Verlag 1998 Delay of Type I diabetes in high risk, first degree relatives by parenteral antigen administration: the Schwabing Insulin Prophylaxis Pilot Trial

More information

T Lymphocyte Activation and Costimulation. FOCiS. Lecture outline

T Lymphocyte Activation and Costimulation. FOCiS. Lecture outline 1 T Lymphocyte Activation and Costimulation Abul K. Abbas, MD UCSF FOCiS 2 Lecture outline T cell activation Costimulation, the B7:CD28 family Inhibitory receptors of T cells Targeting costimulators for

More information

b-cell Autoantibodies and Their Function in Taiwanese Children With Type 1 Diabetes Mellitus

b-cell Autoantibodies and Their Function in Taiwanese Children With Type 1 Diabetes Mellitus ORIGINAL ARTICLE b-cell Autoantibodies and Their Function in Taiwanese Children With Type 1 Diabetes Mellitus Yi-Ching Tung, 1 Mei-Huei Chen, 2 Cheng-Ting Lee, 1 Wen-Yu Tsai 1 * Background/Purpose: To

More information

Short communication. Abstract

Short communication. Abstract Diabetologia (1999) 42: 574±578 Short communication Ó Springer-Verlag 1999 Immunological abnormalities in islets at diagnosis paralleled further deterioration of glycaemic control in patients with recent-onset

More information

T-cell activation T cells migrate to secondary lymphoid tissues where they interact with antigen, antigen-presenting cells, and other lymphocytes:

T-cell activation T cells migrate to secondary lymphoid tissues where they interact with antigen, antigen-presenting cells, and other lymphocytes: Interactions between innate immunity & adaptive immunity What happens to T cells after they leave the thymus? Naïve T cells exit the thymus and enter the bloodstream. If they remain in the bloodstream,

More information

T-cell activation T cells migrate to secondary lymphoid tissues where they interact with antigen, antigen-presenting cells, and other lymphocytes:

T-cell activation T cells migrate to secondary lymphoid tissues where they interact with antigen, antigen-presenting cells, and other lymphocytes: Interactions between innate immunity & adaptive immunity What happens to T cells after they leave the thymus? Naïve T cells exit the thymus and enter the bloodstream. If they remain in the bloodstream,

More information

Prevention of type 1 diabetes

Prevention of type 1 diabetes Published Online July 2, 2011 Prevention of type 1 diabetes S. L. Thrower and P. J. Bingley * School of Clinical Sciences, University of Bristol, Bristol, UK Introduction *Correspondence address. Diabetes

More information

Atypical and Ketosis Prone Diabetes. Ashok Balasubramanyam, MD Baylor College of Medicine Houston, Texas

Atypical and Ketosis Prone Diabetes. Ashok Balasubramanyam, MD Baylor College of Medicine Houston, Texas Atypical and Ketosis Prone Diabetes Ashok Balasubramanyam, MD Baylor College of Medicine Houston, Texas Atypical Diabetes in the Spectrum Classified as T1D Classified as T2D Auto-immune T1D T2D A- - KPD

More information

CHARACTERIZATION AND IMMUNOMODULATION OF REGULATORY T CELLS IN TYPE 1 DIABETES KEVIN SCOTT GOUDY

CHARACTERIZATION AND IMMUNOMODULATION OF REGULATORY T CELLS IN TYPE 1 DIABETES KEVIN SCOTT GOUDY CHARACTERIZATION AND IMMUNOMODULATION OF REGULATORY T CELLS IN TYPE 1 DIABETES KEVIN SCOTT GOUDY A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment

More information

Clinical and Laboratory Characteristics of Childhood Diabetes Mellitus: A Single-Center Study from 2000 to 2013

Clinical and Laboratory Characteristics of Childhood Diabetes Mellitus: A Single-Center Study from 2000 to 2013 Original Article www.cmj.ac.kr Clinical and Laboratory Characteristics of Childhood Diabetes Mellitus: A Single-Center Study from 2000 to 2013 Tae Hyun Park 1, Min Sun Kim 1,2, * and Dae-Yeol Lee 1,2 1

More information

THE ASSOCIATION OF SINGLE NUCLEOTIDE POLYMORPHISMS IN INTRONIC REGIONS OF ISLET CELL AUTOANTIGEN 1 AND TYPE 1 DIABETES MELLITUS.

THE ASSOCIATION OF SINGLE NUCLEOTIDE POLYMORPHISMS IN INTRONIC REGIONS OF ISLET CELL AUTOANTIGEN 1 AND TYPE 1 DIABETES MELLITUS. THE ASSOCIATION OF SINGLE NUCLEOTIDE POLYMORPHISMS IN INTRONIC REGIONS OF ISLET CELL AUTOANTIGEN 1 AND TYPE 1 DIABETES MELLITUS by Carrie Lynn Blout B.S., Dickinson College, 2004 Submitted to the Graduate

More information

1. PATHOPHYSIOLOGY OF DIABETES MELLITUS

1. PATHOPHYSIOLOGY OF DIABETES MELLITUS 1. PATHOPHYSIOLOGY OF DIABETES MELLITUS Prof. Vladimir Palicka, M.D., Ph.D. Institute for Clinical Biochemistry and Diagnostics, University Hospital Hradec Kralove, Czech Republic Diabetes mellitus is

More information

Dysregulation of glucose metabolism in preclinical type 1 diabetes

Dysregulation of glucose metabolism in preclinical type 1 diabetes Pediatric Diabetes 2016: 17(Suppl. 22): 25 30 doi: 10.1111/pedi.12392 All rights reserved Pediatric Diabetes Review Article Dysregulation of glucose metabolism in preclinical type 1 diabetes Veijola R,

More information

Distinguishing T1D vs. T2D in Childhood: a case report for discussion

Distinguishing T1D vs. T2D in Childhood: a case report for discussion Distinguishing T1D vs. T2D in Childhood: a case report for discussion Alba Morales, MD Associate Professor of Pediatrics Division of Pediatric Endocrinology and Diabetes Disclosure I have no financial

More information

Basic Immunology. Immunological tolerance. Cellular and molecular mechanisms of the immunological tolerance. Lecture 23 rd

Basic Immunology. Immunological tolerance. Cellular and molecular mechanisms of the immunological tolerance. Lecture 23 rd Basic Immunology Lecture 23 rd Immunological tolerance Cellular and molecular mechanisms of the immunological tolerance Tolerated skin grafts on MHC (H2) identical mice TOLERANCE & AUTOIMMUNITY Upon encountering

More information

Diabetes in Chronic Pancreatitis: When is it type 3c? Melena Bellin, MD Associate Professor, Pediatrics & Surgery Schulze Diabetes Institute

Diabetes in Chronic Pancreatitis: When is it type 3c? Melena Bellin, MD Associate Professor, Pediatrics & Surgery Schulze Diabetes Institute Diabetes in Chronic Pancreatitis: When is it type 3c? Melena Bellin, MD Associate Professor, Pediatrics & Surgery Schulze Diabetes Institute Disclosure Information Melena D. Bellin Disclosure of Relevant

More information

Gamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells

Gamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells Gamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells Gérald J. Prud homme, MD, FRCPC Keenan Research Centre for Biomedical

More information

Immunological Tolerance

Immunological Tolerance Immunological Tolerance Introduction Definition: Unresponsiveness to an antigen that is induced by exposure to that antigen Tolerogen = tolerogenic antigen = antigen that induces tolerance Important for

More information

Definition of diabetes mellitus

Definition of diabetes mellitus Diabetes mellitus II - III First and second type of diabetes mellitus Lecture from pathological physiology Oliver Rácz, 2011-2018 Definition of diabetes mellitus Diabetes mellitus is a group of metabolic

More information

Prevention of type 1 diabetes mellitus using a novel vaccine

Prevention of type 1 diabetes mellitus using a novel vaccine Therapeutic Advances in Endocrinology and Metabolism Review Prevention of type 1 diabetes mellitus using a novel vaccine Tihamer Orban and Janos Tibor Kis Abstract: Type 1 diabetes mellitus (T1DM) affects

More information

T cell maturation. T-cell Maturation. What allows T cell maturation?

T cell maturation. T-cell Maturation. What allows T cell maturation? T-cell Maturation What allows T cell maturation? Direct contact with thymic epithelial cells Influence of thymic hormones Growth factors (cytokines, CSF) T cell maturation T cell progenitor DN DP SP 2ry

More information

Supplementary Table 1. Functional avidities of survivin-specific T-cell clones against LML-peptide

Supplementary Table 1. Functional avidities of survivin-specific T-cell clones against LML-peptide Supplementary Table 1. Functional avidities of survivin-specific T-cell clones against LML-peptide pulsed T2 cells. clone avidity by 4-hour 51 Cr-release assay 50% lysis at E:T 10:1 [LML peptide, M] #24

More information

Supplemental Figure 1. IL-3 blockade with Fab CSL362 depletes plasmacytoid dendritic cells (pdcs), but not basophils, at higher doses.

Supplemental Figure 1. IL-3 blockade with Fab CSL362 depletes plasmacytoid dendritic cells (pdcs), but not basophils, at higher doses. Supplemental Figure 1. IL-3 blockade with Fab CSL362 depletes plasmacytoid dendritic cells (pdcs), but not basophils, at higher doses. Percentage of viable (A) pdcs (Sytox Blue-, Lin1-, HLADR+, BDCA2++)

More information

Making progress: preserving beta cells in type 1 diabetes

Making progress: preserving beta cells in type 1 diabetes Ann. N.Y. Acad. Sci. ISSN 0077-8923 ANNALS OF THE NEW YORK ACADEMY OF SCIENCES Issue: The Year in Diabetes and Obesity Making progress: preserving beta cells in type 1 diabetes Mary Pat Gallagher, 1 Robin

More information

Immune responses in autoimmune diseases

Immune responses in autoimmune diseases Immune responses in autoimmune diseases Erika Jensen-Jarolim Dept. of Pathophysiology Medical University Vienna CCHD Lecture January 24, 2007 Primary immune organs: Bone marrow Thymus Secondary: Lymph

More information

[AUTOIMMUNITY] July 14, 2013

[AUTOIMMUNITY] July 14, 2013 This sheet includes only the extra notes. Slide 5,6: [AUTOIMMUNITY] July 14, 2013 Autoimmunity is the condition or case where the immune system is activated by self antigensand when the immune system no

More information

Immune Checkpoints. PD Dr med. Alessandra Curioni-Fontecedro Department of Hematology and Oncology Cancer Center Zurich University Hospital Zurich

Immune Checkpoints. PD Dr med. Alessandra Curioni-Fontecedro Department of Hematology and Oncology Cancer Center Zurich University Hospital Zurich Immune Checkpoints PD Dr med. Alessandra Curioni-Fontecedro Department of Hematology and Oncology Cancer Center Zurich University Hospital Zurich Activation of T cells requires co-stimulation Science 3

More information

Autoimmunity Origins. Horror autotoxicus: Literally, the horror of self-toxicity.

Autoimmunity Origins. Horror autotoxicus: Literally, the horror of self-toxicity. Autoimmunity Autoimmunity Origins Horror autotoxicus: Literally, the horror of self-toxicity. A term coined by the German immunologist Paul Ehrlich (1854-1915) to describe the body's innate aversion to

More information

Through the Fog: Recent Clinical Trials to Preserve b-cell Function in Type 1 Diabetes

Through the Fog: Recent Clinical Trials to Preserve b-cell Function in Type 1 Diabetes PERSPECTIVES IN DIABETES Through the Fog: Recent Clinical Trials to Preserve b-cell Function in Type 1 Diabetes Carla J. Greenbaum, 1 Desmond A. Schatz, 2 Michael J. Haller, 2 and Srinath Sanda 1,3 Dawn

More information

Prognostic Accuracy of Immunologic and Metabolic Markers for Type 1 Diabetes in a High-Risk Population

Prognostic Accuracy of Immunologic and Metabolic Markers for Type 1 Diabetes in a High-Risk Population Clinical Care/Education/Nutrition/Psychosocial Research O R I G I N A L A R T I C L E Prognostic Accuracy of Immunologic and Metabolic Markers for Type 1 Diabetes in a High-Risk Population Receiver operating

More information

Immune surveillance: The immune system can recognize and destroy nascent malignant cells

Immune surveillance: The immune system can recognize and destroy nascent malignant cells Immune surveillance: The immune system can recognize and destroy nascent malignant cells Control Escape APC T C T H B NKT NK Innate Tumor T cells are believed to play a major role in controlling tumor

More information

Class I Ag processing. TAP= transporters associated with antigen processing Transport peptides into ER

Class I Ag processing. TAP= transporters associated with antigen processing Transport peptides into ER Antigen processing Class I Ag processing TAP= transporters associated with antigen processing Transport peptides into ER Proteosome degrades cytosolic proteins Large, multi-subunit complex Degrades foreign

More information

Anti-islet autoantibodies in Japanese type 1 diabetes

Anti-islet autoantibodies in Japanese type 1 diabetes 15 th Korea Japan Symposium on Diabetes Anti-islet autoantibodies in Japanese type 1 diabetes Eiji Kawasaki, Katsumi Eguchi Nagasaki University Hospital, Nagasaki, Japan November 20 21, 21 2009 Cheju Islend

More information

Decreased GAD(65) -specific Th1/Tc1 phenotype in children with Type 1 diabetes treated with GAD-alum.

Decreased GAD(65) -specific Th1/Tc1 phenotype in children with Type 1 diabetes treated with GAD-alum. Decreased GAD(65) -specific Th1/Tc1 phenotype in children with Type 1 diabetes treated with GAD-alum. Stina Axelsson, Maria Hjorth, Johnny Ludvigsson and Rosaura Casas Linköping University Post Print N.B.:

More information

Chapter 12. Clinical Trials for the Prevention of Type 1 Diabetes

Chapter 12. Clinical Trials for the Prevention of Type 1 Diabetes Chapter 12 Clinical Trials for the Prevention of Type 1 Diabetes Selected New Onset Trials as of 2012 Delay Loss C-peptide Cyclosporine Anti-CD3 Anti-CD20 (B cells) CTLA4-Ig (Co-stim block) Cytoxan-ATG-GCSF

More information

Autoimmune diseases. Autoimmune diseases. Autoantibodies. Autoimmune diseases relatively common

Autoimmune diseases. Autoimmune diseases. Autoantibodies. Autoimmune diseases relatively common Autoimmune diseases Fundamental abnormality: the adaptive immune system is triggered by self antigens to initiate a sustained immune response against self molecules that results in tissue injury Specificity

More information

Inflammation & Type 2 Diabetes Prof. Marc Y. Donath

Inflammation & Type 2 Diabetes Prof. Marc Y. Donath Inflammation & Type 2 Diabetes 1, MD Chief Endocrinology, Diabetes & Metabolism University Hospital Basel Petersgraben 4 CH-431 Basel, Switzerland MDonath@uhbs.ch Innate immunity as a sensor of metabolic

More information

Mechanisms of antagonism of HIVspecific CD4+ T cell responses BSRI

Mechanisms of antagonism of HIVspecific CD4+ T cell responses BSRI Mechanisms of antagonism of HIVspecific CD4+ T cell responses BSRI Problems Virus escape from immune recognition Antagonism of T cell responses Peptide-MHC-TCR interaction T cell antagonism Variants of

More information

Immunological profile and aspects of immunotherapy in type 1 diabetes

Immunological profile and aspects of immunotherapy in type 1 diabetes Linköping University Medical Dissertations No. 1161 Immunological profile and aspects of immunotherapy in type 1 diabetes Maria Hjorth Division of Pediatrics Department of Clinical and Experimental Medicine

More information

Risk Factors and Primary Prevention Trials for Type 1 Diabetes

Risk Factors and Primary Prevention Trials for Type 1 Diabetes 666 Ivyspring International Publisher Research Paper International Journal of Biological Sciences 2013; 9(7):666-679. doi: 10.7150/ijbs.6610 Risk Factors and Primary Prevention Trials for Type 1 Diabetes

More information

Clinical impact of de-novo HLA antibodies in pancreas and islet transplantation

Clinical impact of de-novo HLA antibodies in pancreas and islet transplantation Clinical impact of de-novo HLA antibodies in pancreas and islet transplantation David Turner, PhD, FRCPath Lead for H&I Services, Scottish National Blood Transfusion Service Treatment of Type I DM Insulin

More information