Département Hospitalo-Universitaire AUToimmune and HORmonal diseases
|
|
- Claire Norton
- 5 years ago
- Views:
Transcription
1 Uth DHU Département Hospitalo-Universitaire AUToimmune and HORmonal diseases rs DIABETES ADRENAL DISEASES VASCULITIDES L immunomodulation du diabète. Quelles applications? quel avenir?
2 incidence [105/year] insulitis TYPE 1 DIABETES MELLITUS an autoimmune disease islet cell autoantibodies b cell selectivity anti-gad anti-ia2 anti-insulin anti-znt8 increasing incidence ( 3-4%/year) & geographical incidence variation (> 65/10 5 /year in Finland) Gianani R 2010, Diabetologia genes numerous numerous s Bottazzo & Doniach 1974, Lancet environment Gepts W 1965, Diabetes absence of a unique environmental factor
3 age Controls mortality rate /10 3 person-yr standardized mortality rate Skrivarhaug et al. Diabetologia 2006 [Norway] T1D MORTALITY Allegheny County childhood-onset (< 18) T1D registry diagnosed increased mortality compared to the general population n = 1075 acute renal cardio vascular Intermediate disease compared to high risk autoimmune diseases infections cancer Secrest et al. Diabetes 2010
4 ß cell mass TYPE 1 DIABETES: A CHRONIC DISEASE patient duration of diabetes heterogeneity diabetes recurrence Insulitis 1 22 years 60 days CD8+ T cells years 44 days CD8+ T cells years 92 days CD8+ T cells + ICA Bingley et al. Diabetologia 2006 diabetes hyperglycemia
5 TYPE I DIABETES NKT IL-4, IFN-g NK IFN-g autoantibodies CD1d APC NKG2D/MIC Cl II T CD4 TNF-a, IFN-g Cl II Cl I T reg b cell IL-10, TGF-b GRZ/perforin Pancreatic islet
6 TYPE I DIABETES immunosuppression APC Cl II insulin replacement therapy T CD4 b cell mass restoration graft regeneration TNF-a, IFN-g Cl II Cl I b cell tolerance induction GRZ/perforin Pancreatic islet
7 TYPE I DIABETES anti-tnfa [Etanercept] IL1 antagonists [Anakinra] autoantibodies anti-cd20 [Rituximab] APC Cl II T CD4 TNF-a, IFN-g Cl II Cl I cyclosporin A azathioprine + corticoids anti-thymoglobulin ± corticoids anti-cd3 GRZ/perforin intensive Insulin therapy b cell nicotinamide Pancreatic islet
8 TREATMENT OF DIABETES WITH ANTI-CD ± 1.86 nmol/l per month ± 1.30 nmol/l per month Herold KC et al. 2002, N Engl J Med
9 TREATMENT OF DIABETES WITH ANTI-CD3 months months months n = 40 (placebo) n = 40 (anti-cd3) Keymeulen B et al. 2005, N Engl J Med
10 TREATMENT OF DIABETES WITH ANTI-CD3 Keymeulen B et al. N Engl J Med 200
11 TYPE I DIABETES intrinsic T cell tolerance anergy changes in gene expression profiles peptides APC Cl II T CD4 TNF-a, IFN-g Cl II low-dose IL-2 Rapamycin/IL-2 T reg Cl I insulin IL-10, TGF-b extrinsic T cell tolerance GRZ/perforin GAD IA2,ZnT8 b cell DiaPep277 Pancreatic islet
12 TREATMENT OF PREDIABETES WITH INSULIN first and second degree relatives 3152 autoantibody positive 5 year risk > 50% in 372/2103 randomization to observation (n = 70) versus s.c. insulin twice daily 0.25 units/kg (n = 69) mean follow up 3.7 years s.c./i.v. & oral insulin (DPT1, 2002, N Engl J Med) Nasal insulin (Näntö-Salonen, 2008, Lancet)
13 TREATMENT OF PREDIABETES WITH ORAL INSULIN Diabetes Prevention Trial-Type first and second degree relatives 3483 autoantibody positive 5 year risk 26-50% in 388/2103 randomization to IAA 80 nu/ml 6.2%/year 10.4%/year 8.2%/year 6.4%/year oral insulin 7.7 mg/24h (n = 186, mean IAA 382 ± 555 nu/ml) versus placebo (n = 186, mean IAA 346 ± 336 nu/ml) Skyler J et al Diabetes Care 2005
14 GAD VACCINATION IN RECENT-ONSET T1D [Intention to treat analysis] n = 35 n = 34 sponse to GAD up to 15 months IL-5/-10/-13/-17/IFNg/TNFa IL-6/ mg GAD-alum days 1 & 30 within 6 months following onset GAD-induced expression of oxp3 & TNFa Ludvigsson et al, N Engl J Med, 2008
15 TrialNet intervention studies: within 100 days from diagnosis Anti-IL1β [Canakinumab] CTLA-4 Ig [Abatacept] in Recent Onset Diabetes Glutamic acid decarboxylase (GAD) in New Onset T1DM Metabolic Control in New Onset Diabetes Rituximab Study (Anti-CD20) Mycophenolate mofitil / dacliumab (MMF/DZB) study TrialNet prevention studies Oral insulin for prevention of Type 1 diabetes Study Anti-CD3 [Teplizumab] for prevention in relatives CTLA4-Ig [Abatacept] for prevention in relatives The Nutritional Intervention to Prevent Type 1 diabetes Study accessed 1st March, 2014.
16 TYPE 1 DIABETES T CELLS TO DIABETES PREVENTION APC T CD4 TNF-a, IFN-g b cell T CD8
17 HUMAN INSULIN 1 MALWMRLLPL 11 LALLALWGPD 21 PAAA FVNQHL 31 CGSHLVEALY 41 LVCGERGFFY 51 TPK PEPTIDE SIGNAL CHAINE B TRREAED 61 LQVGQVELGG 71 GPGAGSLQPL 81 ALEGSLQKRG 91 IVEQCCTSIC 101 SLYQLENYCN PEPTIDE C CHAINE A MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPK SRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN B9-23 MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLCGERGFFYTPM SRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
18 CLASS I ALLELE-SPECIFIC PEPTIDES peptide sequence HLA class I HLVEALYLV A ALYLVCGER A3 A LYLVCGERGF A24 LVCGERGFFY A LVCGERGFFY A3 A11 VCGERGFFYT A1 VCGERGFFYT A2 VCGERGFFYT B8 VCGERGFFYT B18 GERGFFYT A1 GERGFFYT B ERGFFYTPK A FYTPKTRRE B TPKTRREAEDL B8 peptide sequence class I allele 2-11 A2 ALWMRLLPLL A24 ALWMRLLPLL B RLLPLLALL A2 RLLPLLALL A RLLPLLALLAL A LALWGPDPAA A2 LALWGPDPAA A ALWGPDPAAA A2 ALWGPDPAAA A26 Toma et al, PNAS 2005; Diabetes 2009
19 CD8+ T CELL RESPONSE TO A2-RESTRICTED PREPROINSULIN PEPTIDES [ELISPOTassay] peptide binding % CD8+ IFN response 10-4 M 10-6 M long standing recent onset total 34-42* 58% 37% 2/4 4/10 6/ * 36% 65% 7/13 1/4 8/ * 96% 71% 5/15 2/4 7/ * 44% 36% 7/13 0/4 44% 7/ * 96% 94% 7/13 1/4 8/17 * Val 42, L 14, L 16, A 23 & A 24 were identified as C-terminal residues generated by proteasome digestion in vitro. ** 6-14 or 6-16 immunization anti-6-14 or cross-reactives responses anti-6-16 to 6-14 and 6-16 T cell clones Toma et al, PNAS2005; Toma et al. Diabetes 2009
20 PE-A: TTM PE-A PE-A: TTM PE-A PE-A: TTM PE-A TETRAMER RECOGNITION OF BLOOD CD8 + T CELLS TCD8 + b cells class I peptide streptavidin biotin A2.1-restricted peptides class I preproinsulin peptide A A A A A A A A controls 10 4 PDHase MATA Nef Dt1A5 TTM A2 PPIh_Dt1A5 TTM A fcsÉCD3+ CD8+ Dt1A5 TTM A2 PPIh_Dt1A5 TTM A fcsÉCD3+ CD _D124D 6-14.fcsÉCD3+ CD TCD PerCP-A: CD8 PerCP-A PerCP-A: CD8 PerCP-A PerCP-A: CD8 PerCP-A Luce et al. Diabetes 2011 Sandrine Luce
21 TETRAMER RECOGNITION OF BLOOD CD8 + T CELLS A2.1-restricted peptides single cell PCR central memory T cells effector memory T cells Luce et al. Diabetes 2011
22 AUC mg.h/dl mg NEW PRECLINICAL T1D MODELS beta cell mass x A2/DQ8 Tg Human insulin OUF YES Insulin A2.1 DQ8 genes insulin/a2.1/dq8 mice Luce et al. unpublished Intraperitoneal glucose tolerance test s.c./i.v. & oral insulin (DPT1, 2002, N Engl J Med) Nasal insulin (Näntö-Salonen, 2008, Lancet) YES C ol YES C ol
23 DIABETES IN RIP-B7 TRANSGENIC YES MICE % total islets diabetes (%) TCR CD11c CD8 CD28 TCR T cell CD19 CD4 D4 MHC B7.2 dapi non anti-glucagon diabetic anti-cd3 diabetic CD11b RIP-B7 YES Age (weeks) Luce et al. unpublished
24 DIABETES IN RIP-B7 TRANSGENIC YES MICE rdu proliferation assay CD8 + IFNγ Elispot assay CD8 + TMr + expansion assay Luce et al. unpublished
25 FROM RESEARCH TO CLINIC Uth DHU rs FROM PALLIATIVE TREATMENT TO PREVENTION OF TYPE 1 DIABETES diagnosis immunotherapy prediabetes damaged islet of Langerhans diabetes diagnostics T NKT T reg APC NK T CD8 B T CD4 Class II-restricted epitopes modified by inclusion of a thiol-disulfide oxidoreductase motif within flanking residues peptide autoantigen HLA Immunotherapy EU FP7 project Carlier et al. PloSOne 2012 YES mice Luce S et al. Diabetes 2011
26 Uth DHU Département Hospitalo-Universitaire AUToimmune and HORmonal diseases rs DIABETES ADRENAL DISEASES VASCULITIDES Andrea Toma Sandrine Luce Etienne Larger Roberto Mallone François Lemonnier Agnès Lehuen Sylvianne Muller, Jean Paul Briand (CNRS, Strasbourg) Decio Eizirik (Brussels) Charbel Masaad (Paris) Laurent Drouot, Olivier Boyer (Rouen)
Immune Modulation of Type1 Diabetes
Immune Modulation of Type1 Diabetes Jay S. Skyler, MD, MACP Division of Endocrinology, Diabetes, and Metabolism and Diabetes Research Institute University of Miami Miller School of Medicine Ideal Therapeutic
More informationPrediction and Prevention of Type 1 Diabetes. How far to go?
Prediction and Prevention of Type 1 Diabetes. How far to go? Peter Colman Diabetes and Endocrinology Royal Melbourne Hospital Royal Melbourne Hospital Lancet, Saturday 30 th November 1974; p. 1279-1282
More informationDesigning An)gen- specific Immunotherapy for Treatment of Type 1 Diabetes.
Designing An)gen- specific Immunotherapy for Treatment of Type 1 Diabetes. Kristin V. Tarbell Immune Tolerance Unit, Diabetes Endocrinology and Obesity Branch, NIDDK Outline Background on type 1 diabetes
More informationNew targets for prevention of type 1 diabetes George S. Eisenbarth Barbara Davis Center Unversity Colorado
New targets for prevention of type 1 diabetes George S. Eisenbarth Barbara Davis Center Unversity Colorado WEB BOOK: Immunology of Type 1 Diabetes HTTP://WWW.BARBARADAVISCENTER.ORG Board Member/Advisory
More informationImmune therapy in type 1 diabetes mellitus.
Immune therapy in type 1 diabetes mellitus. Lernmark, Åke; Elding Larsson, Helena Published in: Nature Reviews Endocrinology DOI: 10.1038/nrendo.2012.237 2013 Link to publication Citation for published
More informationTargeting the Trimolecular Complex for Immune Intervention. Aaron Michels MD
Targeting the Trimolecular Complex for Immune Intervention Aaron Michels MD Disclosures Research Grant from Novartis. Research Grant from NovoNordisk. Take Home Points Type 1 diabetes is an immunologic
More informationDr Dario Tuccinardi University Campus Bio-Medico of Rome
Dr Dario Tuccinardi University Campus Bio-Medico of Rome d.tuccinardi@unicampus.it Topics to be discussed Epidemiology (increase in incidence) Genetics (more cases with moderate HLA risk alleles) Pathogenesis
More informationChapter 10. Humoral Autoimmunity 6/20/2012
Chapter 10 Humoral Autoimmunity 6/20/2012 DIPP Populations Study: Quartile Levels Insulin Autoantibodies (6 month post first IAA) and progression to Diabetes Parrika et al Diabetologia 2012 MSD ELECTROCHEMILUMINESCENT
More informationDepleting T cells in newly diagnosed autoimmune (type 1) diabetes--are we getting anywhere?
Depleting T cells in newly diagnosed autoimmune (type 1) diabetes--are we getting anywhere? Lernmark, Åke Published in: Diabetes DOI: 10.2337/db13-1207 Published: 2013-01-01 Link to publication Citation
More informationIMMUNOTHERAPIE DU DIABETE AUTO-IMMUN
IMMUNOTHERAPIE DU DIABETE AUTO-IMMUN INSERM U1013 INSTITUT UNIVERSITAIRE DE FRANCE Natural history of type 1 diabetes b cell function (%) Time AN ALARMING EPIDEMIOLOGICAL TREND EURODIAB registered 29 311
More informationDiabetes mellitus is a complex of syndromes characterized metabolically by hyperglycemia and altered glucose metabolism, and associated
Diabetes mellitus is a complex of syndromes characterized metabolically by hyperglycemia and altered glucose metabolism, and associated pathologically with specific microvascular and macrovascular complications.
More informationEvgenija Homšak,M.Ph., M.Sc., EuSpLM. Department for laboratory diagnostics University Clinical Centre Maribor Slovenia
Evgenija Homšak,M.Ph., M.Sc., EuSpLM. Department for laboratory diagnostics University Clinical Centre Maribor Slovenia 14th EFLM Continuing Postgraduate Course in Clinical Chemistry and Laboratory Medicine
More informationStaging of Type 1 Diabetes: Clinical Implications. April Deborah Hefty, MN, RN, CDE.
Staging of Type 1 Diabetes: TT Clinical Implications April 2016 Deborah Hefty, MN, RN, CDE dhefty@benaroyaresearch.org BRI s major contributions to type 1 diabetes research Identified type 1 diabetes susceptibility
More informationT Cell Activation, Costimulation and Regulation
1 T Cell Activation, Costimulation and Regulation Abul K. Abbas, MD University of California San Francisco 2 Lecture outline T cell antigen recognition and activation Costimulation, the B7:CD28 family
More informationDisclosures. Sanofi Advisory Board DSMB for Novo Nordisk Consultant for NeoStem. Altering The Course Of Type 1 Diabetes. UCSF Diabetes Update 4.29.
4/3/15 Altering The Course Of Type 1 Diabetes UCSF Diabetes Update 4.29.15 Stephen E. Gitelman, MD UCSF sgitelma@ucsf.edu Disclosures Sanofi Advisory Board DSMB for Novo Nordisk Consultant for NeoStem 1
More informationCover Page. The handle holds various files of this Leiden University dissertation
Cover Page The handle http://hdl.handle.net/1887/39620 holds various files of this Leiden University dissertation Author: Alkemade, Gonnie Title: Destruction, regeneration and replacement of beta-cells
More informationIPS Modern management of childhood diabetes mellitus
Modern management of childhood diabetes mellitus Professor Philippe LYSY, MD PhD Pediatric endocrinology and diabetology Institut de Recherche Expérimentale et Clinique Université Catholique de Louvain
More informationTYPE 1 DIABETES MELLITUS: AUTOIMMUNE DIABETES
27 th Nov. 2015 TYPE 1 DIABETES MELLITUS: AUTOIMMUNE DIABETES Bo Kyung Koo CONTENTS 1. Introduction on Type 1 diabetes (T1DM) 2. Pathogenesis of T1DM 3. Immunologic Markers in T1DM 4. Atypical T1DM 1 Diabetes
More informationImmune system and diabetes. Chairmen: J. Belkhadir (Morocco) N.M. Lalic (Serbia)
Immune system and diabetes Chairmen: J. Belkhadir (Morocco) N.M. Lalic (Serbia) Autoimmunity and prevention of type 1 diabetes R. Mallone (France) Autoimmunity and Prevention of Type 1 Diabetes Roberto
More informationBenaroya Research Institute. Update on Type 1 Diabetes Trials. to Save Beta Cells. Carla Greenbaum MD. Seattle, WA
Benaroya Research Institute Update on Type 1 Diabetes Trials Carla Greenbaum MD Seattle, WA to Save Beta Cells 1552 BC earliest written record of DM 1 st Breakthrough in understanding: 1889 The problem
More informationFOCiS. Lecture outline. The immunological equilibrium: balancing lymphocyte activation and control. Immunological tolerance and immune regulation -- 1
1 Immunological tolerance and immune regulation -- 1 Abul K. Abbas UCSF FOCiS 2 Lecture outline Principles of immune regulation Self-tolerance; mechanisms of central and peripheral tolerance Inhibitory
More informationAntigen-Based Prediction and Prevention of Type 1 Diabetes
DOCTOR OF MEDICAL SCIENCE Antigen-Based Prediction and Prevention of Type 1 Diabetes Jacob Sten Petersen This review has been accepted as a thesis together with ten previously published papers, by the
More informationEnhancing the Clinical Activity of HER2/neu Specific T Cells. William Gwin, MD Internal Medicine, Resident University of Washington
Enhancing the Clinical Activity of HER2/neu Specific T Cells William Gwin, MD Internal Medicine, Resident University of Washington Immunotherapy and Cancer Cancer vaccines were originally used in melanoma
More informationSelf-tolerance. Lack of immune responsiveness to an individual s own tissue antigens. Central Tolerance. Peripheral tolerance
Autoimmunity Self-tolerance Lack of immune responsiveness to an individual s own tissue antigens Central Tolerance Peripheral tolerance Factors Regulating Immune Response Antigen availability Properties
More informationLecture outline. Immunological tolerance and immune regulation. Central and peripheral tolerance. Inhibitory receptors of T cells. Regulatory T cells
1 Immunological tolerance and immune regulation Abul K. Abbas UCSF 2 Lecture outline Central and peripheral tolerance Inhibitory receptors of T cells Regulatory T cells 1 The immunological equilibrium:
More informationUpdate on Type 1 Diabetes Trials to Save Beta Cells
Benaroya Research Institute Carla Greenbaum MD Seattle, WA Update on Type 1 Diabetes Trials to Save Beta Cells 1552 BC earliest written record of DM 1 st Breakthrough in understanding: 1889 The problem
More informationAutoimmune disease: Type 1 diabetes
Eur. J. Immunol. 2009. 39: 1991 2058 FORUM 2049 Autoimmune disease: Type 1 diabetes Remodeling rodent models to mimic human type 1 diabetes Matthias von Herrath 1 and Gerald T. Nepom 2 1 Center for Type
More informationYes, We are Close to Preventing Diabetes!
Yes, We are Close to Preventing Diabetes! Peter A. Gottlieb, MD Barbara Davis Center University of Colorado Health Sciences Center Denver, CO Practical Ways to Achieve Targets in Diabetes Care, Keystone,
More informationGAD65 Autoantibodies Detected by Electrochemiluminescence Assay Identify High Risk for Type 1 Diabetes
BRIEF REPORT GAD65 Autoantibodies Detected by Electrochemiluminescence Assay Identify High Risk for Type 1 Diabetes Dongmei Miao, K. Michelle Guyer, Fran Dong, Ling Jiang, Andrea K. Steck, Marian Rewers,
More informationImmunology Lecture 4. Clinical Relevance of the Immune System
Immunology Lecture 4 The Well Patient: How innate and adaptive immune responses maintain health - 13, pg 169-181, 191-195. Immune Deficiency - 15 Autoimmunity - 16 Transplantation - 17, pg 260-270 Tumor
More informationWhat is Autoimmunity?
Autoimmunity What is Autoimmunity? Robert Beatty MCB150 Autoimmunity is an immune response to self antigens that results in disease. The immune response to self is a result of a breakdown in immune tolerance.
More informationWhat is Autoimmunity?
Autoimmunity What is Autoimmunity? Robert Beatty MCB150 Autoimmunity is an immune response to self antigens that results in disease. The immune response to self is a result of a breakdown in immune tolerance.
More informationIs It Time to Screen the General Population for Type 1 Diabetes?
Is It Time to Screen the General Population for Type 1 Diabetes? Kimber M Simmons, MD, MS 1 and Aaron W Michels, MD 2 1. Pediatric Endocrinology and Diabetes Fellow, Children s Hospital Colorado, Aurora,
More informationWhat is New in Type 1 Diabetes? Prof. Åke Lernmark
What is New in Type 1 Diabetes? Lunds Universitet/CRC Skånes University Hospital SUS Malmö, Sweden 1 What s new in type 1 diabetes? Is the disease still increasing? What is the etiology? What is the pathogenesis?
More informationChapter 11. Prediction of Type 1A Diabetes: The Natural History of the Prediabetic Period
Chapter 11 Prediction of Type 1A Diabetes: The Natural History of the Prediabetic Period Greenbaum et al Diabetes June 11, 212 Fall in C peptide During First 2 Years From Diagnosis: Evidence of at Least
More informationβ-cell Preservation and Regeneration After Islet Transplantation
β-cell Preservation and Regeneration After Islet Transplantation Jyuhn-Huarng Juang, MD Division of Endocrinology and Metabolism, Department of Internal Medicine, Chang Gung University and Memorial Hospital,
More informationTolerance 2. Regulatory T cells; why tolerance fails. FOCiS. Lecture outline. Regulatory T cells. Regulatory T cells: functions and clinical relevance
1 Tolerance 2. Regulatory T cells; why tolerance fails Abul K. Abbas UCSF FOCiS 2 Lecture outline Regulatory T cells: functions and clinical relevance Pathogenesis of autoimmunity: why selftolerance fails
More informationLow HLA binding of diabetes-associated CD8+ T-cell epitopes is increased by post translational modifications
Sidney et al. BMC Immunology (2018) 19:12 https://doi.org/10.1186/s12865-018-0250-3 RESEARCH ARTICLE Open Access Low HLA binding of diabetes-associated CD8+ T-cell epitopes is increased by post translational
More informationAdvancing Opportunities To Prevent Type 1 Diabetes
Advancing Opportunities To Prevent Type 1 Diabetes Dr. Allison Green Centre for Immunology and Infection Hull York Medical School York University Type 1 Diabetes Insulin deficiency destabilizes regulation
More informationEarly Diagnosis of T1D Through An3body Screening
Early Diagnosis of T1D Through An3body Screening Andrea Steck, M.D. Barbara Davis Center for Childhood Diabetes Keystone Conference July 15, 2017 Presenter Disclosure Andrea Steck Disclosed no conflict
More informationAltering The Course Of Type 1 Diabetes
Altering The Course Of Type 1 Diabetes JDRF TypeOneNation Summit 09.18.16 Stephen E. Gitelman, MD UCSF sgitelma@.ucsf.edu Today s Agenda My story The path to Type 1 Diabetes Prevention efforts New-onset
More informationThe regenerative therapy of type 1 diabetes mellitus 21April 2017 Girne, Northern Cyprus 53rd Turkish National Diabetes Congress
The regenerative therapy of type 1 diabetes mellitus 21April 2017 Girne, Northern Cyprus 53rd Turkish National Diabetes Congress Thomas Linn Clinical Research Unit Centre of Internal Medicine Justus Liebig
More informationWe are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors
We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists 4,100 116,000 120M Open access books available International authors and editors Downloads Our
More informationIs there evidence for post-translational modification of beta cell autoantigens in the aetiology and pathogenesis of type 1 diabetes?
Is there evidence for post-translational modification of beta cell autoantigens in the aetiology and pathogenesis of type 1 diabetes? Lernmark, Åke Published in: Diabetologia DOI: 10.1007/s00125-013-3041-7
More informationPrediction and Prevention of Type 1 Diabetes
Prediction and Prevention of Type 1 Diabetes Helping to defuse the diabetes The number of people in the world currently with type 1 diabetes is around 17 million and increasing rapidly. Already there are
More informationAutoimmunity. Mark S. Anderson, MD, PhD University of California San Francisco
Autoimmunity Mark S. Anderson, MD, PhD University of California San Francisco Autoimmunity Definition: immune response against self (auto-) antigen General principles: Significant health burden, 5% of
More informationLESSON 2: THE ADAPTIVE IMMUNITY
Introduction to immunology. LESSON 2: THE ADAPTIVE IMMUNITY Today we will get to know: The adaptive immunity T- and B-cells Antigens and their recognition How T-cells work 1 The adaptive immunity Unlike
More informationBDC Keystone Genetics Type 1 Diabetes. Immunology of diabetes book with Teaching Slides
BDC Keystone Genetics Type 1 Diabetes www.barbaradaviscenter.org Immunology of diabetes book with Teaching Slides PRACTICAL Trailnet screens relatives and new onset patients for autoantibodies and HLA
More informationAntigen Presentation and T Lymphocyte Activation. Abul K. Abbas UCSF. FOCiS
1 Antigen Presentation and T Lymphocyte Activation Abul K. Abbas UCSF FOCiS 2 Lecture outline Dendritic cells and antigen presentation The role of the MHC T cell activation Costimulation, the B7:CD28 family
More informationDeterminants of Immunogenicity and Tolerance. Abul K. Abbas, MD Department of Pathology University of California San Francisco
Determinants of Immunogenicity and Tolerance Abul K. Abbas, MD Department of Pathology University of California San Francisco EIP Symposium Feb 2016 Why do some people respond to therapeutic proteins?
More informationRay A. Kroc & Robert L. Kroc. BDC Lectureship 2014
Ray A. Kroc & Robert L. Kroc BDC Lectureship 2014 Ray Kroc (Big Mack) 1902-1984 Predominant establisher of the McDonald's Corporation (1961) Philanthropist: Research and treatment of alcoholism, diabetes,
More informationMucosal Immune System
Exam Format 100 points - 60 pts mandatory; 40 points where 4, 10 point questions will be chosen Some open-ended questions, some short answer. Kuby question Cytokines Terminology How do cytokines achieve
More informationTolerance 2. Regulatory T cells; why tolerance fails. Abul K. Abbas UCSF. FOCiS
1 Tolerance 2. Regulatory T cells; why tolerance fails Abul K. Abbas UCSF FOCiS 2 Lecture outline Regulatory T cells: functions and clinical relevance Pathogenesis of autoimmunity: why selftolerance fails
More informationPart XI Type 1 Diabetes
Part XI Type 1 Diabetes Introduction Åke Lernmark Epidemiology Type 1 diabetes is increasing worldwide and shows epidemic proportions in several countries or regions [1]. There is evidence to suggest that
More informationAttribution: University of Michigan Medical School, Department of Microbiology and Immunology
Attribution: University of Michigan Medical School, Department of Microbiology and Immunology License: Unless otherwise noted, this material is made available under the terms of the Creative Commons Attribution
More informationDiabetes vaccines: review of the clinical evidence
Diabetes vaccines: review of the clinical evidence Clin. Invest. (2011) 1(1), 157 169 As preservation of residual b-cell function is clinically important, such an effect constitutes clinical evidence.
More informationBiochemical markers could predict type-1 diabetes mellitus
Molecular and Biochemical Diagnosis (MBD) Vol 2, No 1, 2016 Original Article Biochemical markers could predict type-1 diabetes mellitus Ragaa H. M. Salama 1*, Yasser F. Abd-Elraheem 2, Khaled H. Mahmoud
More informationIMMUNOTHERAPY FOR CANCER A NEW HORIZON. Ekaterini Boleti MD, PhD, FRCP Consultant in Medical Oncology Royal Free London NHS Foundation Trust
IMMUNOTHERAPY FOR CANCER A NEW HORIZON Ekaterini Boleti MD, PhD, FRCP Consultant in Medical Oncology Royal Free London NHS Foundation Trust ASCO Names Advance of the Year: Cancer Immunotherapy No recent
More informationDiseases of Immunity 2017 CL Davis General Pathology. Paul W. Snyder, DVM, PhD Experimental Pathology Laboratories, Inc.
Diseases of Immunity 2017 CL Davis General Pathology Paul W. Snyder, DVM, PhD Experimental Pathology Laboratories, Inc. Autoimmunity Reflects a loss of immunologic tolerance Mechanisms Auto-antibodies
More informationDelay of Type I diabetes in high risk, first degree relatives by parenteral antigen administration: the Schwabing Insulin Prophylaxis Pilot Trial
Diabetologia (1998) 41: 536±541 Ó Springer-Verlag 1998 Delay of Type I diabetes in high risk, first degree relatives by parenteral antigen administration: the Schwabing Insulin Prophylaxis Pilot Trial
More informationT Lymphocyte Activation and Costimulation. FOCiS. Lecture outline
1 T Lymphocyte Activation and Costimulation Abul K. Abbas, MD UCSF FOCiS 2 Lecture outline T cell activation Costimulation, the B7:CD28 family Inhibitory receptors of T cells Targeting costimulators for
More informationb-cell Autoantibodies and Their Function in Taiwanese Children With Type 1 Diabetes Mellitus
ORIGINAL ARTICLE b-cell Autoantibodies and Their Function in Taiwanese Children With Type 1 Diabetes Mellitus Yi-Ching Tung, 1 Mei-Huei Chen, 2 Cheng-Ting Lee, 1 Wen-Yu Tsai 1 * Background/Purpose: To
More informationShort communication. Abstract
Diabetologia (1999) 42: 574±578 Short communication Ó Springer-Verlag 1999 Immunological abnormalities in islets at diagnosis paralleled further deterioration of glycaemic control in patients with recent-onset
More informationT-cell activation T cells migrate to secondary lymphoid tissues where they interact with antigen, antigen-presenting cells, and other lymphocytes:
Interactions between innate immunity & adaptive immunity What happens to T cells after they leave the thymus? Naïve T cells exit the thymus and enter the bloodstream. If they remain in the bloodstream,
More informationT-cell activation T cells migrate to secondary lymphoid tissues where they interact with antigen, antigen-presenting cells, and other lymphocytes:
Interactions between innate immunity & adaptive immunity What happens to T cells after they leave the thymus? Naïve T cells exit the thymus and enter the bloodstream. If they remain in the bloodstream,
More informationPrevention of type 1 diabetes
Published Online July 2, 2011 Prevention of type 1 diabetes S. L. Thrower and P. J. Bingley * School of Clinical Sciences, University of Bristol, Bristol, UK Introduction *Correspondence address. Diabetes
More informationAtypical and Ketosis Prone Diabetes. Ashok Balasubramanyam, MD Baylor College of Medicine Houston, Texas
Atypical and Ketosis Prone Diabetes Ashok Balasubramanyam, MD Baylor College of Medicine Houston, Texas Atypical Diabetes in the Spectrum Classified as T1D Classified as T2D Auto-immune T1D T2D A- - KPD
More informationCHARACTERIZATION AND IMMUNOMODULATION OF REGULATORY T CELLS IN TYPE 1 DIABETES KEVIN SCOTT GOUDY
CHARACTERIZATION AND IMMUNOMODULATION OF REGULATORY T CELLS IN TYPE 1 DIABETES KEVIN SCOTT GOUDY A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment
More informationClinical and Laboratory Characteristics of Childhood Diabetes Mellitus: A Single-Center Study from 2000 to 2013
Original Article www.cmj.ac.kr Clinical and Laboratory Characteristics of Childhood Diabetes Mellitus: A Single-Center Study from 2000 to 2013 Tae Hyun Park 1, Min Sun Kim 1,2, * and Dae-Yeol Lee 1,2 1
More informationTHE ASSOCIATION OF SINGLE NUCLEOTIDE POLYMORPHISMS IN INTRONIC REGIONS OF ISLET CELL AUTOANTIGEN 1 AND TYPE 1 DIABETES MELLITUS.
THE ASSOCIATION OF SINGLE NUCLEOTIDE POLYMORPHISMS IN INTRONIC REGIONS OF ISLET CELL AUTOANTIGEN 1 AND TYPE 1 DIABETES MELLITUS by Carrie Lynn Blout B.S., Dickinson College, 2004 Submitted to the Graduate
More information1. PATHOPHYSIOLOGY OF DIABETES MELLITUS
1. PATHOPHYSIOLOGY OF DIABETES MELLITUS Prof. Vladimir Palicka, M.D., Ph.D. Institute for Clinical Biochemistry and Diagnostics, University Hospital Hradec Kralove, Czech Republic Diabetes mellitus is
More informationDysregulation of glucose metabolism in preclinical type 1 diabetes
Pediatric Diabetes 2016: 17(Suppl. 22): 25 30 doi: 10.1111/pedi.12392 All rights reserved Pediatric Diabetes Review Article Dysregulation of glucose metabolism in preclinical type 1 diabetes Veijola R,
More informationDistinguishing T1D vs. T2D in Childhood: a case report for discussion
Distinguishing T1D vs. T2D in Childhood: a case report for discussion Alba Morales, MD Associate Professor of Pediatrics Division of Pediatric Endocrinology and Diabetes Disclosure I have no financial
More informationBasic Immunology. Immunological tolerance. Cellular and molecular mechanisms of the immunological tolerance. Lecture 23 rd
Basic Immunology Lecture 23 rd Immunological tolerance Cellular and molecular mechanisms of the immunological tolerance Tolerated skin grafts on MHC (H2) identical mice TOLERANCE & AUTOIMMUNITY Upon encountering
More informationDiabetes in Chronic Pancreatitis: When is it type 3c? Melena Bellin, MD Associate Professor, Pediatrics & Surgery Schulze Diabetes Institute
Diabetes in Chronic Pancreatitis: When is it type 3c? Melena Bellin, MD Associate Professor, Pediatrics & Surgery Schulze Diabetes Institute Disclosure Information Melena D. Bellin Disclosure of Relevant
More informationGamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells
Gamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells Gérald J. Prud homme, MD, FRCPC Keenan Research Centre for Biomedical
More informationImmunological Tolerance
Immunological Tolerance Introduction Definition: Unresponsiveness to an antigen that is induced by exposure to that antigen Tolerogen = tolerogenic antigen = antigen that induces tolerance Important for
More informationDefinition of diabetes mellitus
Diabetes mellitus II - III First and second type of diabetes mellitus Lecture from pathological physiology Oliver Rácz, 2011-2018 Definition of diabetes mellitus Diabetes mellitus is a group of metabolic
More informationPrevention of type 1 diabetes mellitus using a novel vaccine
Therapeutic Advances in Endocrinology and Metabolism Review Prevention of type 1 diabetes mellitus using a novel vaccine Tihamer Orban and Janos Tibor Kis Abstract: Type 1 diabetes mellitus (T1DM) affects
More informationT cell maturation. T-cell Maturation. What allows T cell maturation?
T-cell Maturation What allows T cell maturation? Direct contact with thymic epithelial cells Influence of thymic hormones Growth factors (cytokines, CSF) T cell maturation T cell progenitor DN DP SP 2ry
More informationSupplementary Table 1. Functional avidities of survivin-specific T-cell clones against LML-peptide
Supplementary Table 1. Functional avidities of survivin-specific T-cell clones against LML-peptide pulsed T2 cells. clone avidity by 4-hour 51 Cr-release assay 50% lysis at E:T 10:1 [LML peptide, M] #24
More informationSupplemental Figure 1. IL-3 blockade with Fab CSL362 depletes plasmacytoid dendritic cells (pdcs), but not basophils, at higher doses.
Supplemental Figure 1. IL-3 blockade with Fab CSL362 depletes plasmacytoid dendritic cells (pdcs), but not basophils, at higher doses. Percentage of viable (A) pdcs (Sytox Blue-, Lin1-, HLADR+, BDCA2++)
More informationMaking progress: preserving beta cells in type 1 diabetes
Ann. N.Y. Acad. Sci. ISSN 0077-8923 ANNALS OF THE NEW YORK ACADEMY OF SCIENCES Issue: The Year in Diabetes and Obesity Making progress: preserving beta cells in type 1 diabetes Mary Pat Gallagher, 1 Robin
More informationImmune responses in autoimmune diseases
Immune responses in autoimmune diseases Erika Jensen-Jarolim Dept. of Pathophysiology Medical University Vienna CCHD Lecture January 24, 2007 Primary immune organs: Bone marrow Thymus Secondary: Lymph
More information[AUTOIMMUNITY] July 14, 2013
This sheet includes only the extra notes. Slide 5,6: [AUTOIMMUNITY] July 14, 2013 Autoimmunity is the condition or case where the immune system is activated by self antigensand when the immune system no
More informationImmune Checkpoints. PD Dr med. Alessandra Curioni-Fontecedro Department of Hematology and Oncology Cancer Center Zurich University Hospital Zurich
Immune Checkpoints PD Dr med. Alessandra Curioni-Fontecedro Department of Hematology and Oncology Cancer Center Zurich University Hospital Zurich Activation of T cells requires co-stimulation Science 3
More informationAutoimmunity Origins. Horror autotoxicus: Literally, the horror of self-toxicity.
Autoimmunity Autoimmunity Origins Horror autotoxicus: Literally, the horror of self-toxicity. A term coined by the German immunologist Paul Ehrlich (1854-1915) to describe the body's innate aversion to
More informationThrough the Fog: Recent Clinical Trials to Preserve b-cell Function in Type 1 Diabetes
PERSPECTIVES IN DIABETES Through the Fog: Recent Clinical Trials to Preserve b-cell Function in Type 1 Diabetes Carla J. Greenbaum, 1 Desmond A. Schatz, 2 Michael J. Haller, 2 and Srinath Sanda 1,3 Dawn
More informationPrognostic Accuracy of Immunologic and Metabolic Markers for Type 1 Diabetes in a High-Risk Population
Clinical Care/Education/Nutrition/Psychosocial Research O R I G I N A L A R T I C L E Prognostic Accuracy of Immunologic and Metabolic Markers for Type 1 Diabetes in a High-Risk Population Receiver operating
More informationImmune surveillance: The immune system can recognize and destroy nascent malignant cells
Immune surveillance: The immune system can recognize and destroy nascent malignant cells Control Escape APC T C T H B NKT NK Innate Tumor T cells are believed to play a major role in controlling tumor
More informationClass I Ag processing. TAP= transporters associated with antigen processing Transport peptides into ER
Antigen processing Class I Ag processing TAP= transporters associated with antigen processing Transport peptides into ER Proteosome degrades cytosolic proteins Large, multi-subunit complex Degrades foreign
More informationAnti-islet autoantibodies in Japanese type 1 diabetes
15 th Korea Japan Symposium on Diabetes Anti-islet autoantibodies in Japanese type 1 diabetes Eiji Kawasaki, Katsumi Eguchi Nagasaki University Hospital, Nagasaki, Japan November 20 21, 21 2009 Cheju Islend
More informationDecreased GAD(65) -specific Th1/Tc1 phenotype in children with Type 1 diabetes treated with GAD-alum.
Decreased GAD(65) -specific Th1/Tc1 phenotype in children with Type 1 diabetes treated with GAD-alum. Stina Axelsson, Maria Hjorth, Johnny Ludvigsson and Rosaura Casas Linköping University Post Print N.B.:
More informationChapter 12. Clinical Trials for the Prevention of Type 1 Diabetes
Chapter 12 Clinical Trials for the Prevention of Type 1 Diabetes Selected New Onset Trials as of 2012 Delay Loss C-peptide Cyclosporine Anti-CD3 Anti-CD20 (B cells) CTLA4-Ig (Co-stim block) Cytoxan-ATG-GCSF
More informationAutoimmune diseases. Autoimmune diseases. Autoantibodies. Autoimmune diseases relatively common
Autoimmune diseases Fundamental abnormality: the adaptive immune system is triggered by self antigens to initiate a sustained immune response against self molecules that results in tissue injury Specificity
More informationInflammation & Type 2 Diabetes Prof. Marc Y. Donath
Inflammation & Type 2 Diabetes 1, MD Chief Endocrinology, Diabetes & Metabolism University Hospital Basel Petersgraben 4 CH-431 Basel, Switzerland MDonath@uhbs.ch Innate immunity as a sensor of metabolic
More informationMechanisms of antagonism of HIVspecific CD4+ T cell responses BSRI
Mechanisms of antagonism of HIVspecific CD4+ T cell responses BSRI Problems Virus escape from immune recognition Antagonism of T cell responses Peptide-MHC-TCR interaction T cell antagonism Variants of
More informationImmunological profile and aspects of immunotherapy in type 1 diabetes
Linköping University Medical Dissertations No. 1161 Immunological profile and aspects of immunotherapy in type 1 diabetes Maria Hjorth Division of Pediatrics Department of Clinical and Experimental Medicine
More informationRisk Factors and Primary Prevention Trials for Type 1 Diabetes
666 Ivyspring International Publisher Research Paper International Journal of Biological Sciences 2013; 9(7):666-679. doi: 10.7150/ijbs.6610 Risk Factors and Primary Prevention Trials for Type 1 Diabetes
More informationClinical impact of de-novo HLA antibodies in pancreas and islet transplantation
Clinical impact of de-novo HLA antibodies in pancreas and islet transplantation David Turner, PhD, FRCPath Lead for H&I Services, Scottish National Blood Transfusion Service Treatment of Type I DM Insulin
More information