'Translating massively parallel sequencing into clinical diagnostics.

Size: px
Start display at page:

Download "'Translating massively parallel sequencing into clinical diagnostics."

Transcription

1 'Translating massively parallel sequencing into clinical diagnostics. SA Pathology at the Women s and and The University of Adelaide Adelaide, Australia

2 MPS is revolutionising genetics & biology - >100 genes for various rare human disease discovered - de novo mutations (ID, ASD) identified, more to come? - understanding of the cancer, role of somatic mutation - diagnostic re-sequencing

3 ESHG 2011 (Amsterdam, The Netherlands) May 28-31, 2011 H Brunner (Nijmegen, The Netherlands) genetics! Time to be in Capture only genes of interest Capture all and select only those of interest Diagnostic problem = too many unclassified variants? Why do diagnostic exome? Cost effective (~ 2000 EURO/exome) Clinical diagnosis not good enough as a guide for specific inquiry Applicable to singletons MPS is becoming a preference to clinical diagnostic testing They aim for ~500 diagnostic exomes in 2011

4 A D E L A I D E 1/ /2009 3/2010 4/2011 AJHG 4/ / / /2010 6/2011

5 Non-invasive prenatal assessment of trisomy 21 by multiplexed maternal plasma DNA sequencing: large scale validity study. BMJ 1/2011 Women s and 753 pregnant women with high risk of trisomy had fetus with trisomy 21 (full karyotype based) DNA molecules from mL of maternal plasm 6 bp barcode indexing Illumina GA II and IIx 753 pregnancies 314 pregnancies 79.1% sensitivity 0.3 M reads /sample 98.9% specificity 91.9% positive predictive value 96.9% negative predictive value 100% sensitivity 2.3 M reads /sample 97.9% specificity 96.6% positive predictive value 100% negative predictive value

6 Non-invasive prenatal assessment of trisomy 21 by multiplexed maternal plasma DNA sequencing: large scale validity study. BMJ 1/2011 Women s and Our data reveal that the main value of the maternal plasma DNA sequencing test is to rule out fetal trisomy 21. The false positive rates of the current screening programs = 5% Using MPS the trisomy 21 could be ruled out in 98% of those (5%) Leaving only 0.1% of women with referrals for amniocentesis or CVS

7 X chromosome 5% of the genome 3% of the exome Women s and

8 NLGN4 AP1S2 RSK2 ARX IL1RAPL1 TM4SF2 ZNF674 ZNF41 ZNF81 FTSJ1 PQBP1 SYP1 SHROOM4 JARID1C IQSEC2 HUWE1 FGD1 OPHN1 SLC16A2 DLG3 NLGN3 XNP/ATRX MAGT1 BRWD3 ZNF711 ACSL4 PAK3 AGTR2 CUL4B GRIA3 UPF3B ZDHHC9 SLC9A6 ARHGEF6 FMR2 (FRAXE) MECP2 RPL10 GDI1 SLC6A8 RAB39B pter qter MID1, HCCS OFD1, FANCB CDKL5, NHS, SMS, PDHA1 GK DMD OTC BCOR, ATP6AP2 CASK, MAOA, NDP, PORCN, SYN1, PHF8 SMC1A, HADH2 ARHGEF SLC16A2 9 MCT8, KIA2022, PGK1, ATP7A MED12 PCDH19 PLP SRPX2 TIMM8A NXF5 PRPS1 SIZN1A DCX LAMP2 UBE2A NDUFA1 OCRL FMR1 GPC3 IDS PHF6 ABCD1 HRPT L1CAM SOX3 AVPR2 FLNA IKBKG DKC1 Women s and Genetic heterogeneity of XLID ~ 95 genes ~ 14 new (unpublished) >> families yet to be resolved

9 X-exome re-sequencing EURO MRX/AU GOLD (V Kalscheuer and H Ropers) Women s and Probands from 248 unsolved families Agilet SureSelect; hybridisation based capture baits; exons Sequenced using Illumine GA IIx 96.8% regions covered by >3 reads Average 4 novel missense variants/x chromosome 99% sequence variants confirm by Sanger sequencing

10 Alignment eresearchsa supercomputer Corvus (552 processors 4.46 trillion calculations per second) Galaxy tool: Variants reported at depth of 10 reads Annotated using SeattleSeq easy to use

11 Sequencing - Coverage Illumina 65 bp single end reads Two samples per lane ~8 x 10 6 reads per sample

12 Chromosome-wide variation in coverage Women s and

13 Chromosome-wide variation in coverage Women s and

14 Example: Five X-chromosome Exomes Mosaik Alignment Sample I II III IV V Mean Minimum Maximum Median # bases covered # bases in bait region % bases in bait covered 92.6% 92.5% 92.2% 91.0% 92.6% % bases in bait covered ( 10 fold) 86.2% 87.4% 85.2% 79.8% 86.9% S. Willis-Owen, unpublished.

15 Highly Discrepant (HD) site Filtration Sample II III IV V All HD sites 103,574 41,989 28,333 65,170 Within bait regions 92,190 36,893 25,130 59,366 Present in only 1 sample 54,599 9,677 5,819 24,315 Proportion of reads matching ref allele <=15% No overlap with dbsnp Blat: best or only match to X Missense Predicted functional effect (any 1 of 4 tools) S. Willis-Owen, unpublished.

16 Zero coverage: Known ID Genes 22/90 known (Gecz et al. TIGs 2009) XLID genes affected Gene N bases ACSL4 129 AFF2 154 AP1S2 140 AR 3 ARX 277 BRWD3 59 DLG3 155 FGD1 402 G6PD 115 HUWE1 99 IDS 126 IQSEC2 424 OCRL 83 PAK3 20 PDHA1 26 PGK1 35 SLC16A2 27 SLC6A8 78 SLC9A6 106 SOX3 99 SYN1 328 ZNF

17 ARX gene Women s and

18 X-exome re-sequencing - Results EURO MRX/AU GOLD (V Kalscheuer and H Ropers) 14 novel XLID genes identified non-recurrent (novel) missense/stop variants 366 non-recurrent (novel) silent variants ~ 90/248 families resolved ~37% 61 families (25%) mutations in known XLID genes 29 families (12%) mutations in new XLID genes 38 families (15%) carry changes in candidate XLID genes 120 families (48%) unresolved

19 X-exome re-sequencing - Results EURO MRX/AU GOLD (V Kalscheuer and H Ropers) 14 novel XLID genes identified non-recurrent (novel) missense/stop variants 366 non-recurrent (novel) silent variants ~ 90/248 families resolved ~37% 61 families (25%) mutations in known XLID genes 29 families (12%) mutations in new XLID genes 38 families (15%) carry changes in candidate XLID genes 120 families (48%) unresolved

20 Example 1: A small in/del detected by MPS (Family with X-linked Joubert syndrome with M Field and I Scheffer) I 1 2 II * III 1 2 * * 9 10 * IV V Wt 2 1 * 3 * * 8 * 9 * 2 ASD

21 pter qter Xp22.2 Xp21.3 (hg18, chrx: 10,052,226-27,452,338) 65,170 59,366 24, All HD sites 100% Within bait regions 91.1% Present in only 1 read 37.3% Proportion of reads matching ref allele <=15% 0.23% No overlap with dbsnp130 (1/2 bp features) 0.035% Best or only match to X (Blat) 0.035% Missense only 0.006% Position (bp) Chr N read s % reads ref % reads alt Allele change chrx % 97.90% G/A Gene Mutation class Original Codo A n A New Codo n A A Blat MAGEB1 0 Missense GTT V ATT I only X chrx % 95.20% T/G SSX1 Missense TTC F TGC C best X chrx % 95.50% G/A TIMM17B Missense CGG R TGG W best X chrx % 94.40% A/T TREX2 Missense CTG L CAG Q best X p del IKMEAK of the OFD1 gene OFD1 NP_ NEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEAL 260 OFD1 NP_ Del 200 NEYKREIEEQLRAEMCQKLKFFKDTEIAK------KKYEKELTMFQNDFEKACQAKSEAL 260

22 Example 2: mutation missed by large scale Sanger sequencing (with M Field and A Hackett, GOLD Newcastle)

23 Sanger family #423 Women s and #423 ACSL4 Sanger sequencing Missed exon 13 (15) of ACSL4 and that is where the R654X mutation is!

24 Example 3: Sanger and BAC acgh negative (with M Field and GOLD NSW) 2 missense changes found of unknown significance A duplication involving DLG3 identified based on read depth

25 Example 4: NO mutations found by Sanger or MPS (exomes) (with M Field and A Hackett, GOLD Newcastle) MRX3 studied since 1989 DXS304-Xq28; LOD max = 2.89

26 Women s and AD EL AI DE

27 Example 5: MRX12 Women s and OLD (with M Field and A Hackett, GOLD Newcastle) LOD max = NEW Mutation in a novel XLID identified in the NEW linkage interval

28 Example 6: IGOLD#586 family Women s and (with Julie McGaughran, Brisbane, QLD) Innocuous DNA variant found my MPS (1/4) Expression profiling Pointed towards CCDC22 gene

29 Summary Women s and The MPS technology on its own will not address all your questions (find all variants) Important to know what MPS can do and what it can not do ALL or a PART (Whole Genome Sequencing or Targeted Enrichment and MPS)? DNA variant annotation or functional effect interpretation Coding variants vs non-coding variants Missense variants vs silent variants Unique variants vs recurrent variants De novo variants vs inherited SNVs vs small in/dels vs large CNVs

30 Thoughts. MPS will not be the only technology in molecular diagnostic testing MPS is likely going to be the first test (WG >> WE >> Targeted) MPS (WGS) done only once & revised according to advancing knowledge (& annotation and tools for data mining) Even if ~50% of MPS tests deliver the causal DNA variant $$ and effort well spent! Currently 1 exome ($1900) = Sanger sequencing of 1 gene (e.g. ARX).

31 XLID genes identified - ~10-15% of ID NS-ARID - >60 genes identified - ~85-90% of ID ~ 500 genes causing ID

32 How much rare variation? Women s and

33 How much rare variation? Women s and

34 How much rare variation? The total somatic mutational load must be enormous. For example, the intestinal epithelium contains approximately 10 6 independent stem cells, each of which generates transient daughter cells every week or two. Thus, the intestinal epithelium of a 60-y-old is expected to harbor >10 9 independent mutations. This implies that, not far beyond the age of 60y, nearly every genomic site is likely to have acquired a mutation in at least one cell in this single organ.

35 M. Shaw, L. Hobson M. Corbett, L. Nguyen Neurogenetics Research C. Shoubridge, A. Gardner Program, Adelaide L. Huang, S. Rujirabanjerd S. Willis-Owen, E. Douglas L. Jolly A. Hackett, M. Field, G. Turner GOLD, Newcastle, AU I. Scheffer et al. Melbourne, AU H. Ropers, V. Kalscheuer Max Planck, Berlin Funding: NH&MRC

36 Thank you for your attention. Women s and

The Japanese collaborated study of Fragile X syndrome and its related disorders

The Japanese collaborated study of Fragile X syndrome and its related disorders The Japanese collaborated study of Fragile X syndrome and its related disorders Yuji Nakayama, PhD Research Center for Bioscience and Technology, Tottori University, Japan TOTTORI Tsukuba Kyoto TOKYO Okayama

More information

devseek (Sequence(Analysis(Panel(for(Neurodevelopmental(Disorders

devseek (Sequence(Analysis(Panel(for(Neurodevelopmental(Disorders ACSL4 Mental/retardation,/XBlinked/63 XLBR ADSL Adenylosuccinase/Deficiency AR AFF2 Mental/retardation,/XBlinked,/FRAXE/type XLBR ALG6 Congenital/disorder/of/glycosylation/type/Ic AR ANK3 Mental/retardation,/autosomal/recessive/37

More information

Outline. Next-Generation Sequencing. The Application of Genomic Medicine in Clinical and Laboratory Practice

Outline. Next-Generation Sequencing. The Application of Genomic Medicine in Clinical and Laboratory Practice Outline The Application of Genomic Medicine in Clinical and Laboratory Practice Jerry Feldman, MD, PhD, FACMG Medical Director, Division of Laboratory Genetics and Molecular Pathology, Detroit Medical

More information

PITTSBURGH CYTOGENETICS LABORATORY

PITTSBURGH CYTOGENETICS LABORATORY PITTSBURGH CYTOGENETICS LABORATORY GENES COVERED BY X-HR AND SYNDROMES DETECTED BY X-HR # GENES LOCI DISORDERS 1 ABCB7 Xq12-q13 Anemia, sideroblastic, with ataxia 2 ABCD1 Xq28 Adrenoleukodystrophy 3 ACSL4

More information

Rare Disease Research and the UK 100,000 Genome Project

Rare Disease Research and the UK 100,000 Genome Project Rare Disease Research and the UK 100,000 Genome Project Prof F Lucy Raymond MA DPhil FRCP Department of Medical Genetics University of Cambridge UK Flr24@cam.ac.uk Copenhagen October Precision Medicine

More information

Targeted Genes and Methodology Details for Epilepsy/Seizure Genetic Panels

Targeted Genes and Methodology Details for Epilepsy/Seizure Genetic Panels Targeted s and Methodology Details for Epilepsy/Seizure tic Panels Reference transcripts based on build GRCh37 (hg19) interrogated by Epilepsy/Seizure tic Panels Epilepsy Expanded Panel Epilepsy Expanded

More information

Using the Bravo Liquid-Handling System for Next Generation Sequencing Sample Prep

Using the Bravo Liquid-Handling System for Next Generation Sequencing Sample Prep Using the Bravo Liquid-Handling System for Next Generation Sequencing Sample Prep Tom Walsh, PhD Division of Medical Genetics University of Washington Next generation sequencing Sanger sequencing gold

More information

Advance Your Genomic Research Using Targeted Resequencing with SeqCap EZ Library

Advance Your Genomic Research Using Targeted Resequencing with SeqCap EZ Library Advance Your Genomic Research Using Targeted Resequencing with SeqCap EZ Library Marilou Wijdicks International Product Manager Research For Life Science Research Only. Not for Use in Diagnostic Procedures.

More information

Cytogenetics 101: Clinical Research and Molecular Genetic Technologies

Cytogenetics 101: Clinical Research and Molecular Genetic Technologies Cytogenetics 101: Clinical Research and Molecular Genetic Technologies Topics for Today s Presentation 1 Classical vs Molecular Cytogenetics 2 What acgh? 3 What is FISH? 4 What is NGS? 5 How can these

More information

Implementation of the DDD/ClinGen OGT (CytoSure v3) Microarray

Implementation of the DDD/ClinGen OGT (CytoSure v3) Microarray Implementation of the DDD/ClinGen OGT (CytoSure v3) Microarray OGT UGM Birmingham 08/09/2016 Dom McMullan Birmingham Women's NHS Trust WM chromosomal microarray (CMA) testing Population of ~6 million (10%)

More information

No mutations were identified.

No mutations were identified. Hereditary High Cholesterol Test ORDERING PHYSICIAN PRIMARY CONTACT SPECIMEN Report date: Aug 1, 2017 Dr. Jenny Jones Sample Medical Group 123 Main St. Sample, CA Kelly Peters Sample Medical Group 123

More information

Multiplex target enrichment using DNA indexing for ultra-high throughput variant detection

Multiplex target enrichment using DNA indexing for ultra-high throughput variant detection Multiplex target enrichment using DNA indexing for ultra-high throughput variant detection Dr Elaine Kenny Neuropsychiatric Genetics Research Group Institute of Molecular Medicine Trinity College Dublin

More information

August 7, Dear Ms. Verma: RE: 2018 Preliminary Gapfill Payment Determinations for CY2019. Dear Ms. Verma:

August 7, Dear Ms. Verma: RE: 2018 Preliminary Gapfill Payment Determinations for CY2019. Dear Ms. Verma: ASSOCIATION FOR MOLECULAR PATHOLOGY Education. Innovation & Improved Patient Care. Advocacy. 9650 Rockville Pike. Bethesda, Maryland 20814 Tel: 301-634-7939 Fax: 301-634-7995 amp@amp.org www.amp.org August

More information

Medical Policy. MP Invasive Prenatal (Fetal) Diagnostic Testing

Medical Policy. MP Invasive Prenatal (Fetal) Diagnostic Testing Medical Policy MP 2.04.116 BCBSA Ref. Policy: 2.04.116 Last Review: 04/30/2018 Effective Date: 04/30/2018 Section: Medicine Related Policies 2.04.59 Genetic Testing for Developmental Delay/Intellectual

More information

I. New Syndromes and Localizations

I. New Syndromes and Localizations Information posted on this page is intended to complement and update the Atlas of X-Linked Intellectual Disability Syndromes, Edition 2, by R.E. Stevenson, C.E. Schwartz, and R.C. Rogers (Oxford University

More information

CRISPR/Cas9 Enrichment and Long-read WGS for Structural Variant Discovery

CRISPR/Cas9 Enrichment and Long-read WGS for Structural Variant Discovery CRISPR/Cas9 Enrichment and Long-read WGS for Structural Variant Discovery PacBio CoLab Session October 20, 2017 For Research Use Only. Not for use in diagnostics procedures. Copyright 2017 by Pacific Biosciences

More information

Analysis of Massively Parallel Sequencing Data Application of Illumina Sequencing to the Genetics of Human Cancers

Analysis of Massively Parallel Sequencing Data Application of Illumina Sequencing to the Genetics of Human Cancers Analysis of Massively Parallel Sequencing Data Application of Illumina Sequencing to the Genetics of Human Cancers Gordon Blackshields Senior Bioinformatician Source BioScience 1 To Cancer Genetics Studies

More information

Global variation in copy number in the human genome

Global variation in copy number in the human genome Global variation in copy number in the human genome Redon et. al. Nature 444:444-454 (2006) 12.03.2007 Tarmo Puurand Study 270 individuals (HapMap collection) Affymetrix 500K Whole Genome TilePath (WGTP)

More information

Invasive Prenatal (Fetal) Diagnostic Testing

Invasive Prenatal (Fetal) Diagnostic Testing Protocol Invasive Prenatal (Fetal) Diagnostic Testing (204116) Medical Benefit Effective Date: 04/01/18 Next Review Date: 01/19 Preauthorization Yes Review Dates: 01/15, 01/16, 01/17, 01/18 Preauthorization

More information

Genetics update and implications for (General) Practice

Genetics update and implications for (General) Practice Genetics update and implications for (General) Practice May 12 th 2018 Women s Health Symposium Clearwater Estate Dr Kate Gibson MB BCh, MRCP, FRACP Topics NZ Clinical Genetics delivery New Technologies

More information

Analysis with SureCall 2.1

Analysis with SureCall 2.1 Analysis with SureCall 2.1 Danielle Fletcher Field Application Scientist July 2014 1 Stages of NGS Analysis Primary analysis, base calling Control Software FASTQ file reads + quality 2 Stages of NGS Analysis

More information

AVENIO ctdna Analysis Kits The complete NGS liquid biopsy solution EMPOWER YOUR LAB

AVENIO ctdna Analysis Kits The complete NGS liquid biopsy solution EMPOWER YOUR LAB Analysis Kits The complete NGS liquid biopsy solution EMPOWER YOUR LAB Analysis Kits Next-generation performance in liquid biopsies 2 Accelerating clinical research From liquid biopsy to next-generation

More information

Investigating rare diseases with Agilent NGS solutions

Investigating rare diseases with Agilent NGS solutions Investigating rare diseases with Agilent NGS solutions Chitra Kotwaliwale, Ph.D. 1 Rare diseases affect 350 million people worldwide 7,000 rare diseases 80% are genetic 60 million affected in the US, Europe

More information

Genomic structural variation

Genomic structural variation Genomic structural variation Mario Cáceres The new genomic variation DNA sequence differs across individuals much more than researchers had suspected through structural changes A huge amount of structural

More information

Identifying Mutations Responsible for Rare Disorders Using New Technologies

Identifying Mutations Responsible for Rare Disorders Using New Technologies Identifying Mutations Responsible for Rare Disorders Using New Technologies Jacek Majewski, Department of Human Genetics, McGill University, Montreal, QC Canada Mendelian Diseases Clear mode of inheritance

More information

Mutation Detection and CNV Analysis for Illumina Sequencing data from HaloPlex Target Enrichment Panels using NextGENe Software for Clinical Research

Mutation Detection and CNV Analysis for Illumina Sequencing data from HaloPlex Target Enrichment Panels using NextGENe Software for Clinical Research Mutation Detection and CNV Analysis for Illumina Sequencing data from HaloPlex Target Enrichment Panels using NextGENe Software for Clinical Research Application Note Authors John McGuigan, Megan Manion,

More information

Clinical Genetics. Functional validation in a diagnostic context. Robert Hofstra. Leading the way in genetic issues

Clinical Genetics. Functional validation in a diagnostic context. Robert Hofstra. Leading the way in genetic issues Clinical Genetics Leading the way in genetic issues Functional validation in a diagnostic context Robert Hofstra Clinical Genetics Leading the way in genetic issues Future application of exome sequencing

More information

Characterisation of structural variation in breast. cancer genomes using paired-end sequencing on. the Illumina Genome Analyser

Characterisation of structural variation in breast. cancer genomes using paired-end sequencing on. the Illumina Genome Analyser Characterisation of structural variation in breast cancer genomes using paired-end sequencing on the Illumina Genome Analyser Phil Stephens Cancer Genome Project Why is it important to study cancer? Why

More information

Van test naar diagnose naar

Van test naar diagnose naar Van test naar diagnose naar V therapie op maat Marjolein Kriek, LUMC Joris Veltman, RUNMC Exome diagnostics in genetically heterogeneous disease Joris Veltman, PhD Department of Human Genetics Radboud

More information

Epi4K. Epi4K Consortium. Epi4K: gene discovery in 4,000 genomes, Epilepsia, 2012 Aug;53(8):

Epi4K. Epi4K Consortium. Epi4K: gene discovery in 4,000 genomes, Epilepsia, 2012 Aug;53(8): Epi4K Epi4K Consortium. Epi4K: gene discovery in 4,000 genomes, Epilepsia, 2012 Aug;53(8):1457-67. Genetics of Epileptic Encephalopathies Infantile Spasms (IS) 1 in 3000 live births and onset between 4-12

More information

AVENIO family of NGS oncology assays ctdna and Tumor Tissue Analysis Kits

AVENIO family of NGS oncology assays ctdna and Tumor Tissue Analysis Kits AVENIO family of NGS oncology assays ctdna and Tumor Tissue Analysis Kits Accelerating clinical research Next-generation sequencing (NGS) has the ability to interrogate many different genes and detect

More information

Genetics and Genomics: Applications to Developmental Disability

Genetics and Genomics: Applications to Developmental Disability Tuesday, 12:30 2:00, B1 Objective: Genetics and Genomics: Applications to Developmental Disability Helga Toriello 616-234-2712 toriello@msu.edu Identify advances in clinical assessment and management of

More information

DNA-seq Bioinformatics Analysis: Copy Number Variation

DNA-seq Bioinformatics Analysis: Copy Number Variation DNA-seq Bioinformatics Analysis: Copy Number Variation Elodie Girard elodie.girard@curie.fr U900 institut Curie, INSERM, Mines ParisTech, PSL Research University Paris, France NGS Applications 5C HiC DNA-seq

More information

Benefits and pitfalls of new genetic tests

Benefits and pitfalls of new genetic tests Benefits and pitfalls of new genetic tests Amanda Krause Division of Human Genetics, NHLS and University of the Witwatersrand Definition of Genetic Testing the analysis of human DNA, RNA, chromosomes,

More information

X-Linked Intellectual Disability (revised January 2019)

X-Linked Intellectual Disability (revised January 2019) X-Linked Intellectual Disability (revised January 2019) Information posted on these pages are intended to complement and update the Atlas of X- Linked Intellectual Disability Syndromes, Edition 2, by Stevenson,

More information

Chromosome microarray analysis in routine prenatal diagnosis practice: a prospective study on 3000 consecutive clinical cases

Chromosome microarray analysis in routine prenatal diagnosis practice: a prospective study on 3000 consecutive clinical cases Chromosome microarray analysis in routine prenatal diagnosis practice: a prospective study on 3000 consecutive clinical cases Fiorentino F, Napoletano S, Caiazzo F, Sessa M, Bono S, Spizzichino L, Gordon

More information

X inactivation enables Dosage Compensation in mammals H. J. Muller first proposed the concept of dosage compensation as a result of his studies on the expression of X-linked genes in Drosophila. Muller,

More information

CITATION FILE CONTENT/FORMAT

CITATION FILE CONTENT/FORMAT CITATION For any resultant publications using please cite: Matthew A. Field, Vicky Cho, T. Daniel Andrews, and Chris C. Goodnow (2015). "Reliably detecting clinically important variants requires both combined

More information

Nature Genetics: doi: /ng Supplementary Figure 1. PCA for ancestry in SNV data.

Nature Genetics: doi: /ng Supplementary Figure 1. PCA for ancestry in SNV data. Supplementary Figure 1 PCA for ancestry in SNV data. (a) EIGENSTRAT principal-component analysis (PCA) of SNV genotype data on all samples. (b) PCA of only proband SNV genotype data. (c) PCA of SNV genotype

More information

CURRENT GENETIC TESTING TOOLS IN NEONATAL MEDICINE. Dr. Bahar Naghavi

CURRENT GENETIC TESTING TOOLS IN NEONATAL MEDICINE. Dr. Bahar Naghavi 2 CURRENT GENETIC TESTING TOOLS IN NEONATAL MEDICINE Dr. Bahar Naghavi Assistant professor of Basic Science Department, Shahid Beheshti University of Medical Sciences, Tehran,Iran 3 Introduction Over 4000

More information

Dr Rick Tearle Senior Applications Specialist, EMEA Complete Genomics Complete Genomics, Inc.

Dr Rick Tearle Senior Applications Specialist, EMEA Complete Genomics Complete Genomics, Inc. Dr Rick Tearle Senior Applications Specialist, EMEA Complete Genomics Topics Overview of Data Processing Pipeline Overview of Data Files 2 DNA Nano-Ball (DNB) Read Structure Genome : acgtacatgcattcacacatgcttagctatctctcgccag

More information

Supplemental Data. De Novo Truncating Mutations in WASF1. Cause Intellectual Disability with Seizures

Supplemental Data. De Novo Truncating Mutations in WASF1. Cause Intellectual Disability with Seizures The American Journal of Human Genetics, Volume 13 Supplemental Data De Novo Truncating Mutations in WASF1 Cause Intellectual Disability with Seizures Yoko Ito, Keren J. Carss, Sofia T. Duarte, Taila Hartley,

More information

Exomes and Beyond Addressing the Genome with OneSeq. Madhuri Hegde, PhD, FACMG Emory University Emory Genetics Laboratory Atlanta, GA

Exomes and Beyond Addressing the Genome with OneSeq. Madhuri Hegde, PhD, FACMG Emory University Emory Genetics Laboratory Atlanta, GA Exomes and Beyond Addressing the Genome with OneSeq Madhuri Hegde, PhD, FACMG Emory University Emory Genetics Laboratory Atlanta, GA Technologies to Detect Various Types of Mutations RESOLUTION Targeted

More information

Region Chr. Start bp End bp Band Disease OMIM 4x180K 8x60K 4x44K

Region Chr. Start bp End bp Band Disease OMIM 4x180K 8x60K 4x44K ISCA The industry standard ISCA design is followed on the CytoChip ISCA 4x44K, 8x60K and 4x180K arrays. The design includes high density probe coverage of the regions detailed in this table. ISCA design

More information

Illuminating the genetics of complex human diseases

Illuminating the genetics of complex human diseases Illuminating the genetics of complex human diseases Michael Schatz Sept 27, 2012 Beyond the Genome @mike_schatz / #BTG2012 Outline 1. De novo mutations in human diseases 1. Autism Spectrum Disorder 2.

More information

Single-strand DNA library preparation improves sequencing of formalin-fixed and paraffin-embedded (FFPE) cancer DNA

Single-strand DNA library preparation improves sequencing of formalin-fixed and paraffin-embedded (FFPE) cancer DNA www.impactjournals.com/oncotarget/ Oncotarget, Supplementary Materials 2016 Single-strand DNA library preparation improves sequencing of formalin-fixed and paraffin-embedded (FFPE) DNA Supplementary Materials

More information

Rare Variant Burden Tests. Biostatistics 666

Rare Variant Burden Tests. Biostatistics 666 Rare Variant Burden Tests Biostatistics 666 Last Lecture Analysis of Short Read Sequence Data Low pass sequencing approaches Modeling haplotype sharing between individuals allows accurate variant calls

More information

The Amazing Brain Webinar Series: Select Topics in Neuroscience and Child Development for the Clinician

The Amazing Brain Webinar Series: Select Topics in Neuroscience and Child Development for the Clinician The Amazing Brain Webinar Series: Select Topics in Neuroscience and Child Development for the Clinician Part VII Recent Advances in the Genetics of Autism Spectrum Disorders Abha R. Gupta, MD, PhD Jointly

More information

Identification of genomic alterations in cervical cancer biopsies by exome sequencing

Identification of genomic alterations in cervical cancer biopsies by exome sequencing Chapter- 4 Identification of genomic alterations in cervical cancer biopsies by exome sequencing 105 4.1 INTRODUCTION Athough HPV has been identified as the prime etiological factor for cervical cancer,

More information

MOLECULAR DIAGNOSIS for X-LINKED INTELLECTUAL DISABILITY

MOLECULAR DIAGNOSIS for X-LINKED INTELLECTUAL DISABILITY MOLECULAR DIAGNOSIS for X-LINKED INTELLECTUAL DISABILITY Intellectual disability (ID) or mental retardation is characterized by significant limitations in cognitive abilities and social/behavioral adaptive

More information

Reporting TP53 gene analysis results in CLL

Reporting TP53 gene analysis results in CLL Reporting TP53 gene analysis results in CLL Mutations in TP53 - From discovery to clinical practice in CLL Discovery Validation Clinical practice Variant diversity *Leroy at al, Cancer Research Review

More information

REVIEW ARTICLE The Role of Neuronal Complexes in Human X-Linked Brain Diseases

REVIEW ARTICLE The Role of Neuronal Complexes in Human X-Linked Brain Diseases REVIEW ARTICLE The Role of Neuronal Complexes in Human X-Linked Brain Diseases Frédéric Laumonnier, Peter C. Cuthbert, and Seth G. N. Grant Beyond finding individual genes that are involved in medical

More information

September 23, The Role of In Vitro Diagnostic Tests in Pediatric Master Protocol Development

September 23, The Role of In Vitro Diagnostic Tests in Pediatric Master Protocol Development The Role of In Vitro Diagnostic Tests in Pediatric Master Protocol Development September 23, 2016 Anand Pathak, MD, PhD, MPH Medical Officer Molecular Genetics Branch Division of Molecular Genetics and

More information

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Test Disease Population Triad Disease name Epileptic encephalopathy, early infantile 4. OMIM number for disease 612164 Disease

More information

RACP Congress 2017 Genetics of Intellectual Disability and Autism: Past Present and Future 9 th May 2017

RACP Congress 2017 Genetics of Intellectual Disability and Autism: Past Present and Future 9 th May 2017 RACP Congress 2017 Genetics of Intellectual Disability and Autism: Past Present and Future 9 th May 2017 Why causation? Explanation for family Prognosis Recurrence risk and reproductive options Guide medical

More information

MULTIPLE CHOICE QUESTIONS

MULTIPLE CHOICE QUESTIONS SHORT ANSWER QUESTIONS-Please type your awesome answers on a separate sheet of paper. 1. What is an X-linked inheritance pattern? Use a specific example to explain the role of the father and mother in

More information

NGS in neurodegenerative disorders - our experience

NGS in neurodegenerative disorders - our experience Neurology Clinic, Clinical Center of Serbia Faculty of Medicine, University of Belgrade Belgrade, Serbia NGS in neurodegenerative disorders - our experience Marija Branković, MSc Belgrade, 2018 Next Generation

More information

Integration of targeted sequencing and NIPT into clinical practice in a Chinese family with Maple syrup urine disease

Integration of targeted sequencing and NIPT into clinical practice in a Chinese family with Maple syrup urine disease American College of Medical Genetics and Genomics Integration of targeted sequencing and NIPT into clinical practice in a Chinese family with Maple syrup urine disease [Q] Yanqin You, Yan Sun, Xuchao Li,,5,

More information

Next Generation Sequencing as a tool for breakpoint analysis in rearrangements of the globin-gene clusters

Next Generation Sequencing as a tool for breakpoint analysis in rearrangements of the globin-gene clusters Next Generation Sequencing as a tool for breakpoint analysis in rearrangements of the globin-gene clusters XXXth International Symposium on Technical Innovations in Laboratory Hematology Honolulu, Hawaii

More information

PERSONALIZED GENETIC REPORT CLIENT-REPORTED DATA PURPOSE OF THE X-SCREEN TEST

PERSONALIZED GENETIC REPORT CLIENT-REPORTED DATA PURPOSE OF THE X-SCREEN TEST INCLUDED IN THIS REPORT: REVIEW OF YOUR GENETIC INFORMATION RELEVANT TO ENDOMETRIOSIS PERSONAL EDUCATIONAL INFORMATION RELEVANT TO YOUR GENES INFORMATION FOR OBTAINING YOUR ENTIRE X-SCREEN DATA FILE PERSONALIZED

More information

Integration of targeted sequencing and NIPT into clinical practice in a Chinese family with maple syrup urine disease

Integration of targeted sequencing and NIPT into clinical practice in a Chinese family with maple syrup urine disease American College of Medical Genetics and Genomics Integration of targeted sequencing and NIPT into clinical practice in a Chinese family with maple syrup urine disease Yanqin You, MS 1, Yan Sun, MS 2 4,

More information

Supplementary Figure 1. Estimation of tumour content

Supplementary Figure 1. Estimation of tumour content Supplementary Figure 1. Estimation of tumour content a, Approach used to estimate the tumour content in S13T1/T2, S6T1/T2, S3T1/T2 and S12T1/T2. Tissue and tumour areas were evaluated by two independent

More information

Supplemental Information For: The genetics of splicing in neuroblastoma

Supplemental Information For: The genetics of splicing in neuroblastoma Supplemental Information For: The genetics of splicing in neuroblastoma Justin Chen, Christopher S. Hackett, Shile Zhang, Young K. Song, Robert J.A. Bell, Annette M. Molinaro, David A. Quigley, Allan Balmain,

More information

How many disease-causing variants in a normal person? Matthew Hurles

How many disease-causing variants in a normal person? Matthew Hurles How many disease-causing variants in a normal person? Matthew Hurles Summary What is in a genome? What is normal? Depends on age What is a disease-causing variant? Different classes of variation Final

More information

Supplementary Figure 1. Quantile-quantile (Q-Q) plot of the log 10 p-value association results from logistic regression models for prostate cancer

Supplementary Figure 1. Quantile-quantile (Q-Q) plot of the log 10 p-value association results from logistic regression models for prostate cancer Supplementary Figure 1. Quantile-quantile (Q-Q) plot of the log 10 p-value association results from logistic regression models for prostate cancer risk in stage 1 (red) and after removing any SNPs within

More information

Phone: Referring Provider: NPI #: Referring Laboratory (if different): Physician signature: Name: Name: Address: Address:

Phone: Referring Provider: NPI #: Referring Laboratory (if different): Physician signature: Name: Name: Address: Address: MOLECULAR (DNA) TEST REQUISITION FOR CHG LAB USE ONLY: Center for Human Genetics, Inc. Date received: Riverside Technology Center Pedigree #: 840 Memorial Drive, Suite 101 Family name: Cambridge, MA 02139

More information

Phone: Address: Address: City State Zip Code City State Zip Code. Phone: Fax: Phone: Fax: Genetic Counselor:

Phone: Address: Address: City State Zip Code City State Zip Code. Phone: Fax: Phone: Fax: Genetic Counselor: MOLECULAR (DNA) TEST REQUISITION FOR CHG LAB USE ONLY: Center for Human Genetics, Inc. Date received: Riverside Technology Center Pedigree #: 840 Memorial Drive, Suite 101 Family name: Cambridge, MA 02139

More information

GENETICS ROTATION OBJECTIVES MATERNAL-FETAL MEDICINE FELLOWSHIP

GENETICS ROTATION OBJECTIVES MATERNAL-FETAL MEDICINE FELLOWSHIP GENETICS ROTATION OBJECTIVES MATERNAL-FETAL MEDICINE FELLOWSHIP University of New Mexico 1. General Description: UNM MFM fellows rotate through genetics during their PGY5 and PGY7 years. The PGY5 fellow

More information

Disclosure. Summary. Circulating DNA and NGS technology 3/27/2017. Disclosure of Relevant Financial Relationships. JS Reis-Filho, MD, PhD, FRCPath

Disclosure. Summary. Circulating DNA and NGS technology 3/27/2017. Disclosure of Relevant Financial Relationships. JS Reis-Filho, MD, PhD, FRCPath Circulating DNA and NGS technology JS Reis-Filho, MD, PhD, FRCPath Director of Experimental Pathology, Department of Pathology Affiliate Member, Human Oncology and Pathogenesis Program Disclosure of Relevant

More information

TP53 mutational profile in CLL : A retrospective study of the FILO group.

TP53 mutational profile in CLL : A retrospective study of the FILO group. TP53 mutational profile in CLL : A retrospective study of the FILO group. Fanny Baran-Marszak Hopital Avicenne Bobigny France 2nd ERIC workshop on TP53 analysis in CLL, Stresa 2017 TP53 abnormalities :

More information

Approach to the Genetic Diagnosis of Neurological Disorders

Approach to the Genetic Diagnosis of Neurological Disorders Approach to the Genetic Diagnosis of Neurological Disorders Dr Wendy Jones MBBS MRCP Great Ormond Street Hospital for Children National Hospital for Neurology and Neurosurgery What is a genetic diagnosis?

More information

Integration of Next-Generation Sequencing into Epilepsy Clinical Care. Michelle Demos University of British Columbia BC Children s Hospital

Integration of Next-Generation Sequencing into Epilepsy Clinical Care. Michelle Demos University of British Columbia BC Children s Hospital Integration of Next-Generation Sequencing into Epilepsy Clinical Care Michelle Demos University of British Columbia BC Children s Hospital No Disclosures Learning Objectives To review: the impact of using

More information

Understanding The Genetics of Diamond Blackfan Anemia

Understanding The Genetics of Diamond Blackfan Anemia Understanding The Genetics of Diamond Blackfan Anemia Jason Farrar, MD jefarrar@ About Me Assistant Professor of Pediatrics at University of Arkansas for Medical Sciences & Arkansas Children s Hospital

More information

Comprehensive Chromosome Screening Is NextGen Likely to be the Final Best Platform and What are its Advantages and Quirks?

Comprehensive Chromosome Screening Is NextGen Likely to be the Final Best Platform and What are its Advantages and Quirks? Comprehensive Chromosome Screening Is NextGen Likely to be the Final Best Platform and What are its Advantages and Quirks? Embryo 1 Embryo 2 combine samples for a single sequencing chip Barcode 1 CTAAGGTAAC

More information

DIAGNOSTICS THROUGH MICROARRAY POSTNATAL DIAGNOSIS

DIAGNOSTICS THROUGH MICROARRAY POSTNATAL DIAGNOSIS DIAGNOSTICS THROUGH MICROARRAY POSTNATAL DIAGNOSIS COMPANY PROFILE Microgenomics S.r.l. is a spin-off company of the University of Pavia founded by the research team of Molecular Cytogenetics of the Department

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature13908 Supplementary Tables Supplementary Table 1: Families in this study (.xlsx) All families included in the study are listed. For each family, we show: the genders of the probands and

More information

CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY

CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY More genetic information requires cutting-edge interpretation techniques Whole Exome Sequencing For certain patients the combination of symptoms does not allow

More information

Frequency(%) KRAS G12 KRAS G13 KRAS A146 KRAS Q61 KRAS K117N PIK3CA H1047 PIK3CA E545 PIK3CA E542K PIK3CA Q546. EGFR exon19 NFS-indel EGFR L858R

Frequency(%) KRAS G12 KRAS G13 KRAS A146 KRAS Q61 KRAS K117N PIK3CA H1047 PIK3CA E545 PIK3CA E542K PIK3CA Q546. EGFR exon19 NFS-indel EGFR L858R Frequency(%) 1 a b ALK FS-indel ALK R1Q HRAS Q61R HRAS G13R IDH R17K IDH R14Q MET exon14 SS-indel KIT D8Y KIT L76P KIT exon11 NFS-indel SMAD4 R361 IDH1 R13 CTNNB1 S37 CTNNB1 S4 AKT1 E17K ERBB D769H ERBB

More information

Genetics in Primary Care: An Update

Genetics in Primary Care: An Update Genetics in Primary Care: An Update September 11, 2018 Jagdeep S Walia, MBBS, FRCPC, FCCMG Head, Division of Medical Genetics, Director of Research, Department of Pediatrics, Queen s University Financial

More information

The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve

The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve RCP ADVANCED MEDICINE, LONDON FEB 5 TH 2018 HELEN FIRTH DM FRCP DCH, SANGER INSTITUTE 3,000,000,000 bases in each

More information

Approach to Mental Retardation and Developmental Delay. SR Ghaffari MSc MD PhD

Approach to Mental Retardation and Developmental Delay. SR Ghaffari MSc MD PhD Approach to Mental Retardation and Developmental Delay SR Ghaffari MSc MD PhD Introduction Objectives Definition of MR and DD Classification Epidemiology (prevalence, recurrence risk, ) Etiology Importance

More information

Variant Detection & Interpretation in a diagnostic context. Christian Gilissen

Variant Detection & Interpretation in a diagnostic context. Christian Gilissen Variant Detection & Interpretation in a diagnostic context Christian Gilissen c.gilissen@gen.umcn.nl 28-05-2013 So far Sequencing Johan den Dunnen Marja Jakobs Ewart de Bruijn Mapping Victor Guryev Variant

More information

Introduction to genetic variation. He Zhang Bioinformatics Core Facility 6/22/2016

Introduction to genetic variation. He Zhang Bioinformatics Core Facility 6/22/2016 Introduction to genetic variation He Zhang Bioinformatics Core Facility 6/22/2016 Outline Basic concepts of genetic variation Genetic variation in human populations Variation and genetic disorders Databases

More information

CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY

CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY More genetic information requires cutting-edge interpretation techniques Whole Exome Sequencing For some patients, the combination of symptoms does not allow

More information

Phone: Address: Address: City State Zip Code City State Zip Code. Phone: Fax: Phone: Fax: Genetic Counselor:

Phone: Address: Address: City State Zip Code City State Zip Code. Phone: Fax: Phone: Fax: Genetic Counselor: MOLECULAR (DNA) TEST REQUISITION FOR CHG LAB USE ONLY: Center for Human Genetics, Inc. Date received: Riverside Technology Center Pedigree #: 840 Memorial Drive, Suite 101 Family name: Cambridge, MA 02139

More information

Role of Molecular Genetic Assessment for Autism in Clinical Setting

Role of Molecular Genetic Assessment for Autism in Clinical Setting Role of Molecular Genetic Assessment for Autism in Clinical Setting Young Shin Kim, MD, MS, MPH, PhD Director STAR Center for ASD and NDDs Psychiatric Genetic Epidemiology Associate Professor Dept. of

More information

The 100,000 Genomes Project Harnessing the power of genomics for NHS rare disease and cancer patients

The 100,000 Genomes Project Harnessing the power of genomics for NHS rare disease and cancer patients The 100,000 Genomes Project Harnessing the power of genomics for NHS rare disease and cancer patients Dr Richard Scott, Clinical Lead for Rare Disease Dr Nirupa Murugaesu, Clinical Lead for Cancer Four

More information

AD (Leave blank) TITLE: Genomic Characterization of Brain Metastasis in Non-Small Cell Lung Cancer Patients

AD (Leave blank) TITLE: Genomic Characterization of Brain Metastasis in Non-Small Cell Lung Cancer Patients AD (Leave blank) Award Number: W81XWH-12-1-0444 TITLE: Genomic Characterization of Brain Metastasis in Non-Small Cell Lung Cancer Patients PRINCIPAL INVESTIGATOR: Mark A. Watson, MD PhD CONTRACTING ORGANIZATION:

More information

Performance Characteristics BRCA MASTR Plus Dx

Performance Characteristics BRCA MASTR Plus Dx Performance Characteristics BRCA MASTR Plus Dx with drmid Dx for Illumina NGS systems Manufacturer Multiplicom N.V. Galileïlaan 18 2845 Niel Belgium Table of Contents 1. Workflow... 4 2. Performance Characteristics

More information

Exploding Genetic Knowledge in Developmental Disabilities. Disclosures. The Genetic Principle

Exploding Genetic Knowledge in Developmental Disabilities. Disclosures. The Genetic Principle Exploding Genetic Knowledge in Developmental Disabilities How to acquire the data and how to make use of it Elliott H. Sherr MD PhD Professor of Neurology & Pediatrics UCSF Disclosures InVitae: clinical

More information

Congenital Heart Disease How much of it is genetic?

Congenital Heart Disease How much of it is genetic? Congenital Heart Disease How much of it is genetic? Stephen Robertson Curekids Professor of Paediatric Genetics Dunedin School of Medicine University of Otago Congenital Heart Disease The most common survivable

More information

SUPPORTING INFORMATION

SUPPORTING INFORMATION SUPPORTING INFORMATION SUPPORTING METHODS... 2 SUPPORTING FIGURES... 3 Figure S1. Decisional trees for the molecular diagnosis of intellectual disability.... 3 Figure S2. DYRK1A, two de novo truncating

More information

Applications of Chromosomal Microarray Analysis (CMA) in pre- and postnatal Diagnostic: advantages, limitations and concerns

Applications of Chromosomal Microarray Analysis (CMA) in pre- and postnatal Diagnostic: advantages, limitations and concerns Applications of Chromosomal Microarray Analysis (CMA) in pre- and postnatal Diagnostic: advantages, limitations and concerns جواد کریمزاد حق PhD of Medical Genetics آزمايشگاه پاتوبيولوژي و ژنتيك پارسه

More information

Genetic Assessment and Counseling

Genetic Assessment and Counseling Genetic Assessment and Counseling Genetic counseling is the communication of information and advice about inherited conditions and a person seeking such advice is called a consultand. This process includes

More information

Personalis ACE Clinical Exome The First Test to Combine an Enhanced Clinical Exome with Genome- Scale Structural Variant Detection

Personalis ACE Clinical Exome The First Test to Combine an Enhanced Clinical Exome with Genome- Scale Structural Variant Detection Personalis ACE Clinical Exome The First Test to Combine an Enhanced Clinical Exome with Genome- Scale Structural Variant Detection Personalis, Inc. 1350 Willow Road, Suite 202, Menlo Park, California 94025

More information

Concurrent Practical Session ACMG Classification

Concurrent Practical Session ACMG Classification Variant Effect Prediction Training Course 6-8 November 2017 Prague, Czech Republic Concurrent Practical Session ACMG Classification Andreas Laner / Anna Benet-Pagès 1 Content 1. Background... 3 2. Aim

More information

SCALPEL MICRO-ASSEMBLY APPROACH TO DETECT INDELS WITHIN EXOME-CAPTURE DATA. Giuseppe Narzisi, PhD Schatz Lab

SCALPEL MICRO-ASSEMBLY APPROACH TO DETECT INDELS WITHIN EXOME-CAPTURE DATA. Giuseppe Narzisi, PhD Schatz Lab SCALPEL MICRO-ASSEMBLY APPROACH TO DETECT INDELS WITHIN EXOME-CAPTURE DATA Giuseppe Narzisi, PhD Schatz Lab November 14, 2013 Micro-Assembly Approach to detect INDELs 2 Outline Scalpel micro-assembly pipeline

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTRY INFORMTION Supplementary Figure 1. Q-Q plot of RE/NIMH autism family TDT results. The quantile-quantile plot of the expected and observed P-values is shown. The blue circles represent the

More information

Information leaflet for Patients and families Germline Mosaicism

Information leaflet for Patients and families Germline Mosaicism Information leaflet for Patients and families Germline Mosaicism Introduction Germline mosaicism, also known as gonadal mosaicism, can explain why healthy parents sometimes have more than one child with

More information

TOWARDS ACCURATE GERMLINE AND SOMATIC INDEL DISCOVERY WITH MICRO-ASSEMBLY. Giuseppe Narzisi, PhD Bioinformatics Scientist

TOWARDS ACCURATE GERMLINE AND SOMATIC INDEL DISCOVERY WITH MICRO-ASSEMBLY. Giuseppe Narzisi, PhD Bioinformatics Scientist TOWARDS ACCURATE GERMLINE AND SOMATIC INDEL DISCOVERY WITH MICRO-ASSEMBLY Giuseppe Narzisi, PhD Bioinformatics Scientist July 29, 2014 Micro-Assembly Approach to detect INDELs 2 Outline 1 Detecting INDELs:

More information