Supplementary Figures (1-6) Deletion of ADAM-9 in HGF/CDK4 mice impairs melanoma development and metastasis
|
|
- Horace Hill
- 5 years ago
- Views:
Transcription
1 Supplmntary Figurs (1-6) Dltion of ADAM-9 in HGF/CDK4 mic impairs mlanoma vlopmnt an mtastasis Nivs Giblr 1, Alxanr Schönfuß 1, Jnnifr Lansbrg #, Thomas Tüting, Cornlia Mauch an Paola Zigrino*
2 A 25 * ADAM-9 S26 skin tumor ADAM-9 mrna fol chang skin tumor B Tumor-stroma Tumor s t 1µm ADAM-9 ADAM-9 / DAPI Supplmntary Figur 1
3 Supplmntary Figur 1: ADAM-9 in mlanomas from tumor-pron Hgf/Ck4 R24C/R24C mic. Exprssion an localization of ADAM-9 in DMBA-inuc tumors in Hgf/Ck4 R24C/R24C animals. (A) ADAM-9 transcripts tct by RT-PCR in untrat skin (skin) (n=3) an DMBA-inuc tumors (tumor) (n=4) harvst 13 wks aftr DMBA tratmnt. Th graph rprsnts th rlativ intnsity of th bans an shows th avrag of signal intnsitis aftr normalization to S26, us as control. p<.5 (, t-tst). (B) Frozn tumor sctions wr stain for ADAM-9 (grn), an cll nucli (blu). Shown ar rprsntativ picturs of ADAM-9 at th tumor-stroma borr an in intratumoral aras from Hgf/Ck4 R24C/R24C mic post DMBA tratmnt. Th tumor-stroma borr is mark by a ash lin. Th whit arrowhas point to ADAM-9 positiv clls. t, tumor; s, stroma.
4 HGF + 15 Aam-9 mutat/ko HGF + numbr of TRP2+ clls / mm 1 5 Aam-9 mutat/ko H&E K14 / DAPI Loricrin / DAPI Lam β3 / TRP2 / DAPI sc Aam-9 mutat/ko sc 1µ m Supplmntary Figur 2
5 Supplmntary Figur 2: Mic phnotyping. Picturs of control an Aam-9 mutat/ko mic an thir paws showing th HGF inuc black skin phnotyp. Skin sctions from mic at postnatal ay 1 stain by H&E, to arss gnral morphology: cytokratin 14 (r) an loricrin (r) wr us to show pirmal iffrntiation an TRP-2 (grn; tyrosinas rlat protin- 2) to localiz mlanocyts. Cll nucli, stain blu (DAPI). Numbrs of mlanocyts in th skin of postnatal ay 1 mic wr count an hr xprss as an avrag ± SEM (n=3). Th ash lin marks th pirmal-rmal junction., pirmis;, rmis; sc, subcutanous tissu. Th graph isplays th avrag numbrs of mlanocyts in th skin.
6 A B16F1 clls ADAM-9 mrna fol chang [2 Ct ] ** pro ADAM-9 activ ADAM-9 β-actin. shaam-9 B BLM clls ADAM-9 mrna fol chang [2 Ct ] *** pro-adam-9 activ ADAM-9. shaam-9 β-actin C Tumor volum (mm 3 ) * * * shaam Tim (ays) Supplmntary Figur 3
7 Supplmntary Figur 3: Silncing of ADAM-9 in mous an human mlanoma clls an growth of mlanoma in mous. ADAM-9 quantitativ ral-tim PCR, immunoblot analysis of ADAM-9 an cllular prolifration of (A) B16F1 mous mlanoma an (B) BLM human mlanoma clls stably transfct with shrna targt to ADAM-9 (shaam-9) or a scrambl control squnc (). Th graph rprsnts thr inpnnt xprimnts prform in triplicats. Rprsntativ immunoblot analysis to tct ADAM-9 protin xprssion, β-actin was us as a control. p<.1 ( ) an p<.1 ( ), t- tst. (C) Growth of mlanoma aftr injction of control an shaam-9 silnc B16F1 clls in th flank of control animals was monitor ovrtim an hr pict in th graph as avrag ± SEM. Th tabl blow inicats th numbr of tumors visibl as arlir as ay 4 for control an shaam-9 clls. (n=1, control; n=9, shaam-9) *p,3, t- tst
8 wk 13 wk 4 t Aam-9 mutat/ko t % Ki67 positiv clls Aam-9 mutat/ko t Ki67 / cl.casp3 / DAPI t 1µm % Ki67 positiv clls 5 * Aam-9 mutat/ko Supplmntary Figur 4
9 Supplmntary Figur 4: Prolifration an apoptosis of DMBA-inuc tumors grown in control an Aam-9 mutat/ko animals. Frozn tumor sctions from DMBA trat animals wr oubl stain for Ki67 (grn) an clav caspas-3 (r). Th comparison was prform with tumors of comparabl siz (2mm 2 an ~4mm 3, wk 4 an 13, rspctivly ). Cll nucli wr visualiz with DAPI (blu). Th whit arrowhas point to clav casapas-3 positiv clls (r). Th tumor-stroma borr is inicat by th ash lin. t, tumor; s, stroma. Th graphs show th avrag ±SEM numbr of Ki67 positiv clls as % ratio of total count clls (avrag of 3-4 tumors) pr mous. p<.5 (, t-tst) (n=4/6, wk 4 an 13 control/aam-9 mutat/ko ).
10 axillary groin 15 6 Volum [mm³] 1 5 Volum [mm³] 4 2 Aam-9 mutat/ko Aam-9 mutat/ko TRP-1 / CD45 / DAPI TRP-1 / CD45 / DAPI Supplmntary Figur 5
11 Supplmntary Figur 5: Effct of ADAM-9 on lymph no mtastasis. Th volums of axillary an groin lymph nos wr masur an xprss as th avrag volum of th right an th lft lymph no of a singl animal. Each ot rprsnts th avrag siz/mous. Photographs show rprsntativ picturs of th macroscopic apparanc of th lymph nos of both gnotyps. Axillary an groin lymph nos, wr oubl stain for CD45 (lukocyts) an TRP-1 (mlanoma clls) to furthr vrify infiltration of mlanoma clls. scal, 1mm
12 shaam-9 Animals with mtastasis livr lung hart shaam-9 5/5 1 % 3/7 43 % Supplmntary Figur 6
13 Supplmntary Figur 6: Effct of ADAM-9 own-rgulation on mlanoma mtastass. Th numbr an prcntag of mtastass-baring mic ar summariz for control an shaam-9 silnc clls injct intravnously (n=5 in s an n=7 for shaam-9). Th photographs show rprsntativ picturs of mtastatic nouls in th livr, lung an hart.
Supplemental Figure 1 Macrophages accumulate in CVU. (A) Immunohistochemistry staining
Supplmntal Information Sindrilaru t al. An unrtraind inflammatory M1 macrophag population inducd by iron impairs wound haling in humans and mic Supplmntal Figur 1 Macrophag accumulat in CVU. (A) Immunohistochmistry
More informationGentamicin Therapy Induced Functional Type VII Collagen in RDEB Patients Harboring Nonsense Mutations. David T. Woodley and Mei Chen
Gntamicin Thrapy Inuc Functional Typ VII Collagn in RDEB Patints Harboring Nonsns Mutations Davi T. Wooly an Mi Chn Dpartmnt of Drmatology, Univrsity of Southrn California, Los Angls, CA EB2017 Mting,
More informationLETTERS NTURE Vol pril 2009 a cat-4 Tyr GTPCH TH DOP bas-1 D D VMT DT b Mol 1 Mol 2 D B E C F D nuron class 1 D nuron class 2 D nuron class 1 D
Vol 458 16 pril 2009 oi:10.1038/natur07929 Gn rgulatory logic of opamin nuron iffrntiation LETTERS Nuria Flams 1 & Olivr Hobrt 1 Dopamin signalling rgulats a varity of complx bhaviours, an fcts in opamin
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Díaz et al., http://www.jcb.org/cgi/content/full/jcb.201209151/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Hypoxia induces invadopodia formation in different epithelial
More information7 C S 7 P S H. t u p P F G IB: HSP70 IB: HSC70
a b Human HSP7 Human HSC7 Human BIP Mus musculus Drosophila auraria S. Crvisia Ssa1 S. Pomb SPAC13G7.2c E.Coli DnaK IB: Panmthyl lysin IB: HSP7 t u p In P F G ALESYAFNMKSAVED-EGLKGKISEADKKKVLDKCQEVISML
More informationRole of Bcl-2 family proteins in a non-apoptotic programmed cell death dependent on autophagy genes
Rol o amily protins in a non-apoptotic programm cll ath pnnt on autophagy gns Shigomi Shimizu 1,2,3, Toku Kanaski 4, Noboru Mizushima 4,5,6, Takshi Mizuta 1,3, Satoko Arakawa-Kobayashi 4, Craig B. Thompson
More informationUpregulation of CD26 expression in epithelial cells and stromal cells during wound-induced skin tumour formation
Oncogn (2012) 31, 992 1000 & 2012 Macmillan Publishrs Limit All rights rsrv 09509232/12 www.natur.com/onc ORIGINAL ARTICLE Uprgulation of xprssion in pithlial clls an stromal clls uring wouninuc skin tumour
More informationNLRP4 negatively regulates type I interferon signaling by targeting the kinase TBK1 for degradation via the ubiquitin ligase DTX4
ngativly rgulats typ I intrfron signaling by targting th kinas for graation via th ubiquitin ligas Jun Cui 13,7, Yinyin Li 1,3,4,7, Liang Zhu 1, Dan Liu 5, Zhou Songyang 5, Hln Y Wang 1,3 & Rong-Fu Wang
More informationHIV-infected T cells are migratory vehicles for viral dissemination. Human b PBL CD45RA. (μm min 1 ) x (μm)
Homing ratio (human:mous) oi:1.138/natur11398 HIV-infct T clls ar migratory vhicls for viral issmination Thomas T. Murooka 1, Mau Druaz 1, Francsco Marangoni 1, Vlaimir D. Vrbanac 1, Ewar Sung 1, Ulrich
More informationORIGINAL ARTICLE Journal of Investigative Dermatology (2015), Volume The Society for Investigative Dermatology
ORIGINAL ARTICLE Intravnously Aministr Rcombinant Human Typ VII Collagn Driv from Chins Hamstr Ovary Clls Rvrss th Disas Phnotyp in Rcssiv Dystrophic Epirmolysis Bullosa Mic Yingping Hou 1, Lin T. Guy
More informationLETTER. A reserve stem cell population in small intestine renders Lgr5-positive cells dispensable
LETTER oi:10.1038/natur10408 A rsrv stm cll population in small intstin rnrs Lgr5-positiv clls ispnsabl Hua Tian 1, Brian Bihs 2, Sørn Warming 1, Kvin G. Long 3, Lina Rangll 4, Ophir D. Klin 2 & Frric
More informationTRB3 links insulin/igf to tumour promotion by interacting with p62 and impeding autophagic/ proteasomal degradations
RILE Rciv 6 May 5 ccpt 9 Jun 5 Publis 3 ug 5 DOI:.38/ncomms895 OPEN links insulin/igf to tumour promotion by intracting wit an imping autopagic/ protasomal graations Fang Hua,, K Li,,, Jiao-Jiao Yu,, Xiao-Xi
More informationImproving the Surgical Ward Round.
Postr Sssion HRT1317 Innovation Awards Novmbr 2013 Brisban Improving th Surgical Ward Round. Prsntr(s):J. Lin, G. Thompson, M. Pitchr, S.Chan KEY PROBLEM -Ward Round Issus 1. Tim constraints 2. Staff changs
More informationConditional ablation of Stat3 or Socs3 discloses a dual role for reactive astrocytes after spinal cord injury
Natur Publishing Group http://www.natur.com/naturmicin Conitional ablation o Stat3 or Socs3 iscloss a ual rol or ractiv astrocyts atr spinal cor injury Siji Okaa 1 3, Masaya Nakamura, Hiroyuki Katoh, Tamaki
More informationThe CASC15 Long Intergenic Noncoding RNA Locus Is Involved in Melanoma Progression and Phenotype Switching
ORIGINAL ARTICLE Th CASC15 Long Intrgnic Noncoding RNA Locus Is Involvd in Mlanoma Progrssion and Phnotyp Switching Laurnt Lssard 1, Michll Liu 1, Digo M. Marzs 1, Hongwi Wang, Klly Chong 1, Nal Kawas
More informationFusarium vs. Soybean
Fusarium vs. Soyban Gnsata, a company which proucs soyban s for commrcial sal in Nbraska, is rsponing to th migration of Sun Dath Synrom (SDS) into Nbraska soyban fils. An infstation of SDS is far which
More informationChapter 12 Student Lecture Notes 12-1
Chaptr 1 Studnt Lctur Nots 1-1 Businss Statistics: A Dcision-Making Approach 6 th Edition Chaptr 1 Goodnss-of-Fit Tsts and Contingncy Analysis 005 Prntic-Hall, Inc. Chap 1-1 Chaptr Goals Aftr complting
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationTargeting focal adhesion kinase renders pancreatic cancers responsive to checkpoint immunotherapy
a r t i c l s Targting focal adhsion kinas rndrs pancratic cancrs rsponsiv to chckpoint immunothrapy Hong Jiang 1,2, Samarth Hgd 1,2, Brtt L Knolhoff 1,2, Yu Zhu 1,2, John M Hrndon 1,2, Mlissa A Myr 1,2,
More informationSupplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic
Supplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic B cells from WT Nfat2 +/+, TCL1 Nfat2 +/+ and TCL1 Nfat2
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationEctopic lymphoid structures function as microniches for tumor progenitor cells in hepatocellular carcinoma
Ectopic lymphoid structurs function as micronichs for tumor prognitor clls in hpatocllular carcinoma Shlomi Finkin 1,2, Dtian Yuan 3, Ilan Stin 1,2, Koji Taniguchi 4, Achim Wbr, Kristian Ungr 6, Jffry
More information* * * * Supplementary Figure 1. DS Lv CK HSA CK HSA. CK Col-3. CK Col-3. See overleaf for figure legend. Cancer cells
Supplementary Figure 1 Cancer cells Desmoplastic stroma Hepatocytes Pre-existing sinusoidal blood vessel New blood vessel a Normal liver b Desmoplastic HGP c Pushing HGP d Replacement HGP e f g h i DS
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationMATH 1300: Finite Mathematics EXAM 1 15 February 2017
MATH 1300: Finit Mathmatics EXAM 1 15 Fbruary 2017 NAME:... SECTION:... INSTRUCTOR:... SCORE Corrct (A): /15 = % INSTRUCTIONS 1. DO NOT OPEN THIS EXAM UNTIL INSTRUCTED TO BY YOUR ROOM LEADER. All xam pags
More informationReliability Demonstration Test Plan
Rliability Dmonstration Tst Plan STATGRAPHICS Cnturion Rv. 6/7/04 Summary... Exampl... Analysis Window... Output... 4 Calculations... 5 Distributions... 5 Summary This procdur crats tst plans to dmonstrat
More informationApplication of Biomedical Digital Solutions: Virtual Flow Cytometry and Hematometrics in Pathology and Research
Application of Biomdical Digital Solutions: Virtual Flow Cytomtry and Hmatomtrics in Pathology and Rsarch Hrnani D Cualing IHCFLOW Inc Lutz, FL, USA Can ths diagnostic imags bcom data instad of just picturs?
More informationPHA Exam 1. Spring 2013
PHA 5128 Exam 1 Spring 2013 1 Antibiotics (5 points) 2 Body Wight/Pdiatrics (5 points) 3 Rnal Disas (10 points) 4 Aminoglycosids (5 points) 5 Amikacin (10 points) 6 Gntamicin (10 points) 7 Aminoglycosids
More informationSUPPLEMENTARY FIGURES AND TABLE
SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).
More informationP215 Cardiovascular System Blood Vessels Chapter 14 Introduction
P215 Cardiovascular Systm Blood Vssls Chaptr 14 Introduction vins tubs for blood flow lumn - for blood flow wall - Blood Flow Through Blood Vssls largst vins hart largst artris blood always containd by
More informationTGFβ attenuates tumour response to PD-L1 blockade by contributing to exclusion of T cells
Lttr doi:.8/natur55 Fβ attnuats tumour rspons to blockad by contributing to xclusion of T clls Sanjv Mariathasan, Shannon J. Turly, Doroth Nickls, Alssandra Castiglioni, Kob Yun, Yuli Wang, Edward E. Kadl
More informationDisease Models & Mechanisms DMM Accepted manuscript
First post onlin on 8 March 2013 as 10.1242/mm.010397 2013. Publish by Th Company of Biologists Lt. This Accss is an Opn th Accss most articl rcnt istribut vrsion unr at th http://mm.biologists.org/lookup/oi/10.1242/mm.010397
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationDr She Lok, Dr David Greenberg, Barbara Gill, Andrew Murphy, Dr Linda McNamara
Dr Sh Lok, Dr David Grnbrg, Barbara Gill, Andrw Murphy, Dr Linda McNamara This is a joint working projct btwn Mount Vrnon Cancr ntwork and Roch Products Ltd. 1 Introduction Dscrib th work that Mount Vrnon
More informationAllosteric inhibition of lysyl oxidase like-2 impedes the development of a pathologic microenvironment
a r t i c l s Allostric inhibition of lysyl oxidas lik-2 impds th dvlopmnt of a pathologic micronvironmnt Vivian Barry-Hamilton 1, Rhyannon Spanglr 1, Drk Marshall 1, Scott McCauly 1, Hctor M Rodriguz
More informationMales- Western Diet WT KO Age (wks) Females- Western Diet WT KO Age (wks)
Relative Arv1 mrna Adrenal 33.48 +/- 6.2 Skeletal Muscle 22.4 +/- 4.93 Liver 6.41 +/- 1.48 Heart 5.1 +/- 2.3 Brain 4.98 +/- 2.11 Ovary 4.68 +/- 2.21 Kidney 3.98 +/-.39 Lung 2.15 +/-.6 Inguinal Subcutaneous
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationFigure S1. Figure S2. Figure S3.
Figure S1. PSA expression in VCaP was not dependent on the residual androgens in hormonedepleted medium. VCaP or LNCaP cells grown in CSS medium or SFM (serum-free medium) were treated with ethanol (-)
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informatione/m apparatus (two similar, but non-identical ones, from different manufacturers; we call them A and B ) meter stick black cloth
Stony Brook Physics Laboratory Manuals Lab 6 - / of th lctron Th purpos of this laboratory is th asurnt of th charg ovr ass ratio / for th lctron and to study qualitativly th otion of chargd particls in
More informationDigital Signal Processing Homework 7 Solutions in progress
Digital Signal Prossing Homwork 7 Solutions in progrss Du Wnsay 0 Novmbr 00 Problm 46 a, b, ) Fin th maximum valu of th magnitu of th frquny rspons ) Fin th pols an ros of H() f) Compar th minimum an maximum
More information8,000. Cytokine concentration 6,000. (pg ml 1 ) 4,000 2,000. c Colon histological score. Isotype. Anti-IL-17. Isotype
Vol 9 April 1 doi:1.13/natur99 Innat lymphoid clls driv intrlukin-3-dpndnt innat intstinal pathology Sofia Buonocor 1, Philip P. Ahrn 1, Holm H. Uhlig 3, Ivaylo I. Ivanov, Dan R. Littman, Kvin J. Maloy
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationSupplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated,
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated, embedded in matrigel and exposed
More informationW e have previously found using confocal immunofluorescence. Hrs sorts ubiquitinated proteins into clathrin-coated microdomains of early endosomes
Hrs sorts ubiquitinat protins into clathrin-coat microomains of arly nosoms Camilla Raiborg*, Kristi G. Bach*, Davi J. Gillooly*, Ingr Hln Mashus, Espn Stang an Haral Stnmark* *Dpartmnt of Biochmistry,
More informationAAV9-mediated central nervous system targeted gene delivery via cisterna magna route in mice
itation: Molcular Thrapy Mthods & linical Dvlopmnt (2016) 3, 15055; doi:10.1038/mtm.2015.55 All rights rsrvd 2329-0501/16 www.natur.com/mtm Articl AAV9-mdiatd cntral nrvous systm targtd gn dlivry via cistrna
More informationList 3 ways these pictures are the same, and three ways they are different.
List 3 ways ths picturs ar th sam, and thr ways thy ar diffrnt. Human Nuron Comptition i i i i Follow dirctions on th sht in Bindr. 1. Mak Storyboard today and all plans to show nuron firing 2. Monday
More informationmch log height Counts GFP log height mch log height Counts GFP log height mch log height Counts high flux % Hist: 8.34 EBSS shctrl Counts
DOI:.8/n2886 mchrry-gfp-lc3 Autophgy Rportr: Autophgosom Autolysosom mchrry GFP LC3 mchrry GFP LC3 X ph >6. ph
More informationSupplementary Table 1. List of primers used in this study
Supplementary Table 1. List of primers used in this study Gene Forward primer Reverse primer Rat Met 5 -aggtcgcttcatgcaggt-3 5 -tccggagacacaggatgg-3 Rat Runx1 5 -cctccttgaaccactccact-3 5 -ctggatctgcctggcatc-3
More informationNature Medicine doi: /nm.3957
Supplementary Fig. 1. p38 alternative activation, IL-21 expression, and T helper cell transcription factors in PDAC tissue. (a) Tissue microarrays of pancreatic tissue from 192 patients with pancreatic
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2535 Figure S1 SOX10 is expressed in human giant congenital nevi and its expression in human melanoma samples suggests that SOX10 functions in a MITF-independent manner. a, b, Representative
More informationAn ALOX12 12-HETE GPR31 signaling axis is a key mediator of hepatic ischemia reperfusion injury
a r t i c l s An ALOX -HETE GP signaling axis is a ky miator of atic iscmia rrfusion injury 7 Natur Amrica, Inc., part of Springr Natur. All rigts rsrv. Xiao-Jing Zang,, Xu Cng,, Zn-Zn Yan 5,, Jing Fang,,
More informationSupplementary Figure 1
A B D Relative TAp73 mrna p73 Supplementary Figure 1 25 2 15 1 5 p63 _-tub. MDA-468 HCC1143 HCC38 SUM149 MDA-468 HCC1143 HCC38 SUM149 HCC-1937 MDA-MB-468 ΔNp63_ TAp73_ TAp73β E C Relative ΔNp63 mrna TAp73
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationFructose Promotes Uptake and Activity of Oligonucleotides With Different Chemistries in a Context-dependent Manner in mdx Mice
Citation: olcular hrapy Nuclic cids (6) 5, 39; doi:.38/mtna.6.46 Offici journ of th mric Socity of n & Cll hrapy www.natur.com/mtna ucs Promots Uptak d ctivity of Oligonuclotids With Diffrnt Chmistris
More informationTechnology offer. Safe and effective Salmonella vaccines for poultry
Tchnology offr Saf and ffctiv Salmonlla vaccins for poultry Attnuatd vaccins basd on Salmonlla dltion mutant strains (with dfctiv multi drug rsistanc (MDR) fflux pump systms) Targt markt and valu Th two
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSupplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation
Neuron, Volume 100 Supplemental Information Menin Deficiency Leads to Depressive-like Behaviors in Mice by Modulating Astrocyte-Mediated Neuroinflammation Lige Leng, Kai Zhuang, Zeyue Liu, Changquan Huang,
More informationSUPPLEMENTARY DATA. Supplementary Table 1. Primer sequences for qrt-pcr
Supplementary Table 1. Primer sequences for qrt-pcr Gene PRDM16 UCP1 PGC1α Dio2 Elovl3 Cidea Cox8b PPARγ AP2 mttfam CyCs Nampt NRF1 16s-rRNA Hexokinase 2, intron 9 β-actin Primer Sequences 5'-CCA CCA GCG
More informationAmyotrophic lateral sclerosis is a neurodegenerative disorder
https://doi.org/.8/s9-8-- Modling sporadic ALS in ipsc-drivd motor nurons idntifis a potntial thraputic agnt Koki Fujimori, Mitsuru Ishikawa, Asako Otomo,,, Naoki Atsuta, Ryoichi Nakamura, Ttsuya Akiyama
More informationPathomechanisms underlying the psoriasiform skin disease in CD18 hypomorphic PL/J mice
Univrsität Ulm Univrsitätsklinik für Drmatologi un Allrgologi Ärztlic Dirktorin: Prof. Dr. Karin ScarffttrKocank Patomcanisms unrlying t psoriasiform skin isas in morpic PL/J mic Dissrtation zur Erlangung
More informationSupplemental Table S1
Supplemental Table S. Tumorigenicity and metastatic potential of 44SQ cell subpopulations a Tumorigenicity b Average tumor volume (mm ) c Lung metastasis d CD high /4 8. 8/ CD low /4 6./ a Mice were injected
More informationCattle Finishing Net Returns in 2017 A Bit Different from a Year Ago Michael Langemeier, Associate Director, Center for Commercial Agriculture
May 2017 Cattl Finishing Nt Rturns in 2017 A Bit Diffrnt from a Yar Ago Michal Langmir, Associat Dirctor, Cntr for Commrcial Agricultur With th xcption of May 2016, monthly fd cattl nt rturns wr ngativ
More informationEXPERIMENT 4 DETERMINATION OF ACCELERATION DUE TO GRAVITY AND NEWTON S SECOND LAW
EXPERIMENT 4 DETERMINATION OF ACCELERATION DUE TO GRAVITY AND NEWTON S SECOND LAW I. Introduction. Thr ar two objctivs in this laboratory xrcis. Th first objctiv, (A), is th study of th bhavior of a body
More informationMALIGNANT AXILLARY LYMPHADENOPATHY -
MALIGNANT AXILLARY LYMPHADENOPATHY - A PROBLEM FOR MANAGEMENT C T Lim, R Nambiar ABSTRACT Axillary lymph nod nlargmnt can b th first and only manifstation of malignancy. Although lymphoma and mtastasis
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationBreast-cancer-secreted mir-122 reprograms glucose metabolism in premetastatic niche to promote metastasis
A RT I C L E Brast-cancr-scrtd mir- rprograms glucos mtabolism in prmtastatic nich to promot mtastasis iranda Y. Fong, Wiying Zhou, Liang Liu,, Ailn Y. Alontaga 3, anasa Chandra,, Jonathan Ashby 5, Amy
More informationDegeneration and impaired regeneration of gray matter oligodendrocytes in amyotrophic lateral sclerosis
Dgnration and impaird rgnration of gray mattr oligodndrocyts in amyotrophic latral sclrosis Shin H Kang 1,6,7, Ying Li 2,7, Masahiro Fukaya 3, Ilana Lornzini 1,4, Don W Clvland 5, Lyl W Ostrow 2,4, Jffry
More informationMUDRA PHYSICAL SCIENCES
Physical Scincs For ET & SET Exams. Of UGC-CSIR MUDRA PHYSICAL SCIECES VOLUME-05 PART B & C MODEL QUESTIO BAK FOR THE TOPICS: 7. Exprimntal Tchniqus and Data Analysis UIT-I UIT-II 5 UIT-III 9 8. Atomic
More informationSHREE ET AL, SUPPLEMENTAL MATERIALS. (A) Workflow for tumor cell line derivation and orthotopic implantation.
SHREE ET AL, SUPPLEMENTAL MATERIALS SUPPLEMENTAL FIGURE AND TABLE LEGENDS Supplemental Figure 1. Derivation and characterization of TS1-TGL and TS2-TGL PyMT cell lines and development of an orthotopic
More informationActivated protein C inhibits tissue plasminogen activator induced brain hemorrhage
6 Natur Publishing Group http://www.natur.com/naturmdicin Activatd protin C inhibits tissu plasminogn activatorinducd brain hmorrhag Tong Chng,5, Anthony L Ptraglia,5, Zhang Li, Mnakshisundaram Thiyagarajan,
More informationShort Summary on Materials Testing and Analysis
Short Summary on Matrials Tsting and Analysis Parts that wr analyzd Stl parts Worm with garing Bowl Spindl Hat tratabl stl C45 Hat tratabl stl C45 Polymr parts Sal Rings Rctangular Rings O-Rings Polyamid
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/2/1/ra81/dc1 Supplementary Materials for Delivery of MicroRNA-126 by Apoptotic Bodies Induces CXCL12- Dependent Vascular Protection Alma Zernecke,* Kiril Bidzhekov,
More informationOr-Light Efficiency and Tolerance New-generation intense and pulsed light system
Or-Light Efficincy and Tolranc Nw-gnration intns and pulsd light systm Dr Patricia BERGER INTRODUCTION Th us of pulsd and intns light systms (polychromatic, non-cohrnt and non-focussd light) is a commonly
More informationEXPRESSION OF KERATINS, EPIDERMAL PROTEINS AND INFLAMMATORY CELLS IN SUPERFICIAL PEMPHIGUS DOGS
Bulgarian Journal of Vtrinary Micin, 2018, 21, No 2, 186 197 ISSN 1311-1477; DOI: 10.15547/bjvm.1066 Original articl EXPRESSION OF KERATINS, EPIDERMAL PROTEINS AND INFLAMMATORY CELLS IN SUPERFICIAL PEMPHIGUS
More informationSupplementary Online Content
Supplmntary Onlin Contnt Luk C, Jons S, Thomas C, t al. Diagnosi spora Crutzfldt-Jakob disas by th dtction of abnormal prion protin in patint urin. JAMA Nurol. Publishd onlin Octobr 3, 2016. doi:10.1001/jamanurol.2016.3733
More informationPharmacologic inhibition of histone demethylation as a therapy for pediatric brainstem glioma
Supplementary information for: Pharmacologic inhibition of histone demethylation as a therapy for pediatric brainstem glioma Rintaro Hashizume 1, Noemi Andor 2, Yuichiro Ihara 2, Robin Lerner 2, Haiyun
More informationOrthopedics Update. «Die Kinderhüfte» 24. November The importance of bony. reconstruction in dislocated hip in patients with cerebral palsy
Th importanc of bony Orthopdics Updat rconstruction in dislocatd hip in patints with crbral palsy «Di Kindrhüft» 24. Novmbr 2011 Stfan Diraur Goal in patints with crbral palsy prvntion of p o rth O U s
More informationSupplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses
Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses using an anti-cre antibody; testes at 1 week (left panel),
More information<10. IL-1β IL-6 TNF + _ TGF-β + IL-23
3 ns 25 ns 2 IL-17 (pg/ml) 15 1 ns ns 5 IL-1β IL-6 TNF
More informationsupplementary information
DOI: 10.1038/ncb1875 Figure S1 (a) The 79 surgical specimens from NSCLC patients were analysed by immunohistochemistry with an anti-p53 antibody and control serum (data not shown). The normal bronchi served
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Increased ABHD5 expression in human colon cancer associated macrophages. (a) Murine peritoneal macrophages were treated with regular culture medium (Ctrl) or
More informationCD4 and CD8 T cells show a similar accumulation in the tumor stroma.
Fig S1 CD4 Fibronectin EpCM CD8 CD4 and CD8 T cells show a similar accumulation in the tumor stroma. Fluorescently-labeled CD4 (CMFD, green) and CD8 (Hoechst, yellow) T cells were added to a human lung
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationSupplementary Figure 1. mrna expression of chitinase and chitinase-like protein in splenic immune cells. Each splenic immune cell population was
Supplementary Figure 1. mrna expression of chitinase and chitinase-like protein in splenic immune cells. Each splenic immune cell population was sorted by FACS. Surface markers for sorting were CD11c +
More informationSGLT2 inhibitors and risk of cancer in type 2 diabetes: a systematic review and
Elctronic Supplmntary Matrial (ESM) SGLT2 inhibitors and risk of cancr in typ 2 diabts: a systmatic rviw and mta-analysis of randomisd controlld trials Huilin Tang, Qi Dai, Wilong Shi, Suodi Zhai, Yiqing
More informationTherapeutic activation of macrophages and microglia to suppress brain tumor-initiating cells
Thraputi ativation of marophags an miroglia to supprss brain tumor-initiating lls Susobhan Sarkar 1,, Axinia Döring 1,,6, Franz J Zmp 3,6, Clauia Silva 1,, Xuqing Lun 3, Xiuling Wang 3, John Klly 1,, Waltr
More informationCell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice
Supplementary Methods: Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice and gently meshed in DMEM containing 10% FBS to prepare for single cell suspensions. CD4 + CD25
More informationc Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.
a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8
More informationPro-apoptotic signalling through Toll-like receptor 3 involves TRIF-dependent
Pro-apoptotic signalling through Toll-like receptor 3 involves TRIF-dependent activation of caspase-8 and is under the control of inhibitor of apoptosis proteins in melanoma cells Arnim Weber, Zofia Kirejczyk,
More informationSupplemental Figure 1. Signature gene expression in in vitro differentiated Th0, Th1, Th2, Th17 and Treg cells. (A) Naïve CD4 + T cells were cultured
Supplemental Figure 1. Signature gene expression in in vitro differentiated Th0, Th1, Th2, Th17 and Treg cells. (A) Naïve CD4 + T cells were cultured under Th0, Th1, Th2, Th17, and Treg conditions. mrna
More informationCerebrovascular disease Defined from diagnosis ICD10: I60-69, ICD8:
Supplmntary Tabl 1: ICD cods Diagnoss, surgical procdurs, and pharmacothrapy usd for dfining th study population, comorbidity, and outcoms Study population Myocardial Infarction ICD8: 430 ICD10: I21-22
More informationCHRONIC REJECTION is a major cause of late liver
r' Chronic Livr Allograft Rjction and Oblitrativ Artriopathy: Possibl Pathognic Mchanisms S. Oguma' T. Zrb' B. Bannr' S. Bll2 T.E. Starzl3 and A.J. Dmtris' CHRONC REJECTON is a major caus of lat livr allograft
More informationPathologic Stage. Lymph node Stage
ASC ASC a c Patient ID BMI Age Gleason score Non-obese PBMC 1 22.1 81 6 (3+3) PBMC 2 21.9 6 6 (3+3) PBMC 3 22 84 8 (4+4) PBMC 4 24.6 68 7 (3+4) PBMC 24. 6 (3+3) PBMC 6 24.7 73 7 (3+4) PBMC 7 23. 67 7 (3+4)
More informationSupplementary Information
Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1
More informationPKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65
SUPPLEMENTARY INFORMATION TITLE: PKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65 RUNNING TITLE: PKCζ-NFκB Signaling in Breast Cancer
More informationLocalization Performance of Real and Virtual Sound Sources
M.Sc.E.E. Jan Abildgaard Pdrsn AM3D A/S Riihimäkivj 6 DK-9200 Aalborg Dnmark M.Sc.E.E. Torbn Jørgnsn Trma A/S Hovmarkn 4 DK-8520 Lystrup Dnmark E-mail: jap@am3d.com / toj@trma.dk ABSTRACT This papr dscribs
More informationFerroptosis as a p53-mediated activity during tumour suppression
ARTICLE oi:1.138/natur14344 Frroptosis as a p53-miat ativity uring tumour supprssion L Jiang 1 *, Ning Kon 1 *, Tongyuan Li 1, Shang-Jui Wang 1, Tao Su 2,3, Hanina Hishoosh 2,3, Rihar Bar 1,2,3 & Wi Gu
More informationCombined use of calcipotriol solution (SOp.g/ ml) and Polytar liquid in scalp psoriasis.
MCS9506INT 27 April1999 Pag 11 of 189 Summary This documnt has bn dov.;nloadd from \v\vw.lo-pharma.com subjct to th trms of us stat on th wbsit. It contains data and rsults rgarding approvd and non-approvd
More information