Molecular Biology of Memory Storage: The Persistence of Memory

Size: px
Start display at page:

Download "Molecular Biology of Memory Storage: The Persistence of Memory"

Transcription

1 Molecular Biology of Memory Storage: The Persistence of Memory

2 The Study of Memory Has Two Parts: (1) The Systems Problem of Memory: Where in the brain is memory stored? (2) The Molecular Problem of Memory: How is memory stored at each site?

3 There are Two Major Forms of Long-Term Memory Explicit (Declarative) Implicit (Procedural) Facts and Events People, Objects and Places Skills and Habits Nonassociative and Associative Learning Medial Temporal Lobe Hippocampus Requires Conscious Attention Amygdala, Striatum, Cerebellum, Reflex Pathways Does Not Require Conscious Attention

4 - -

5 There are Two Major Forms of Long-Term Memory Explicit (Declarative) Implicit (Procedural) Place: Spatial Memory Medial Temporal Lobe Hippocampus Requires Conscious Attention Nonassociative Learning: Learned Fear (Sensitization) Reflex Pathways Does Not Require Conscious Attention

6 Parietal Frontal Occipital Temporal

7 Abdominal Ganglion of Aplysia

8 Identified Cells and Clusters of the Abdominal Ganglion

9

10 The Gill Withdrawal Reflex has a Simple Stereotypical Neural Circuit. Repetition of Sensitization Training Leads to Altered Gene Expression and the Growth of New Synaptic Connections.

11

12 Sensitization Produces Both Pre- and Postsynaptic Structural Changes in the Intact Animal (HRP) Control Sensitized

13

14

15 There are Two Major Forms of Long-Term Memory Explicit (Declarative) Implicit (Procedural) Place: Spatial Memory Medial Temporal Lobe Hippocampus Requires Conscious Attention Nonassociative Learning: Learned Fear Reflex Pathways Does Not Require Conscious Attention

16 Hippocampus of Humans Encodes Space (Mental Time Travel) Primrose Hill Route from Hyde Park to Primrose Hill Hyde Park

17 Hippocampus of Mice Also Encodes Space

18 Multi-Sensory Information About Spatial Memory is Brought Together in the CA1 Region of the Hippocampus

19 Relating Molecular Signaling to the Cognitive Map for Space: The Hippocampal Pyramidal Cells in the CA1 Region Encode Space

20 Is Synaptic Plasticity in the Hippocampal Ca1 Region Importand for Learning a Spatial Representation and for Storing a Spatial Memory? LTP

21 The Long-Term Stability of Hippocampal Synaptic Plasticity( Long Term Potentiation) Requires PKA x

22

23 Both the Long-Term Memory for Space and the Long- Term Stability of the Place Cell Map Require PKA Long-Term Stability of the Place Cell Map x Similarity Score WT R(AB) 1 h 24 h Long-Term Memory of Spatial Context % Freezing (5 min) 1 h 24 h

24 How Does Attention Affect the Internal Representation of Space?

25 Is Attention Important to Form the Spatial Map or to Stabilize and Perpetuate it? Four Degrees of Attention

26

27 Short Term Stability of Place Cells Does Not Require Selective Attention Short vs. Long Term Instability min longterm

28 Long Term Place Cell Stability Requires Selective Attention

29 Dopamine as a Candidate Mediator of Attention

30 Both Explicit and Implicit Memory Storage Use Modulatory Transmitters as a Salience Signal and a CREB-Mediated Transcriptional Switch for Converting Short-term to Long-term Memory Aplysia (bottom up modulation) Hippocampus (top down modulation) What- Prefrontal Cortex Where- Posterior Parietal Cortex How is synapse specificity achieved? How is it maintained for the long term?

31

32

33

34 What is the Molecular Nature of the Synaptic Mark?

35 There are Two Molecular Components to the Synaptic Mark 50 camp 0 +rp-camp

36 Rapamycin, a Selective Inhibitor of Protein Synthesis also Blocks the Growth-Dependent Late Phase of LTF Initiation Capture Initiation 5 x 5-HT 1 x 5-HT 5 x 5-HT + or Rapamycin + or Rapamycin Synaptic Capture + Rapamycin Synaptic-Specific LTF + Rapamycin

37 Rapamycin Blocks the Maintenance of 72 Hrs

38 What is the Function of Local Protein Synthesis? How are the mrnas that are Transported to the Synapse Activated Locally?

39 The Cytoplasmic Polyadenylation Element Binding Protein Can Activate Dormant mrna ORF 3UTR CPEB Maskin Symplektin GEF CPSF PAP AAAAAAAAAAAAAAA Protein Richter And Colleagues

40 Branch-specific transduction of tat-ss-cpebas1 in L15 Local inhibition of CPEB blocks maintenance of LTF

41 CPEB: A Switch for Activating Local Protein Synthesis CRE 5 x 5HT mrna: (e.g. N-Actin, Tubulin) CPEB (Synaptic Mark) 1x 5HT PKA PI3 Kinase AA AA AA CPEB mrna Translational Machinery AA Proteins: N-Actin Tubulin

42 How does CPEB remain active for the long term in the absence of any further synaptic stimulation?

43 A Prion-Like Domain at the N-terminal End of Aplysia CPEB 20 Random Aplysia Proteins

44 Properties of a Prion 1) Two distinct conformational states:one of which forms aggregate. 2) The conformational states are metastable and functionally distinct Inactive Active 3) The aggregated state is self-perpetuating

45 The Full-Length CPEB Protein Can Exist in Two Functional Conformational States

46

47

48 Blue White X W303a Kar1-15pO Kar1-15pO

49 CPEB as a Candidate for the Self-Perpetuating Switch of Local Protein Synthesis CRE 5 x 5HT 1 x 5HT Conformation B AA Conformation A AA Growth and proteins

50 3) Is the Aggregated Form The Active Form of CPEB? Only Aggregated Aplysia Neuronal CPEB Protein Binds Selectively to CPE-Containing RNA 1) Aplysia CPEB 2) mcpeb1 3) GEF 4) meif6 Purified proteins RNA Protein Control Proteins Free RNA

51

52 The Prion-Like Properties of Aplysia CPEB Are Different from Known Prions The conversion from one state to the other is regulated by a physiological signal. The dominant self-perpetuating state is the active state. Aplysia CPEB might be representative of a new class of proteins with prion-like properties, which has normal physiological function.

53 A Prion-Like Domain at the N-terminal End of Mouse CPEB-3: Comparison with Aplysia CPEB Aplysia CPEB (1-160) mcpeb-3 (1-232) MQAMAVASQSPQTVDQAISVKTDYEDNQQEHIPSNFEIFRRINALLDNSL EANNVSCSQSQSQQQQQQTQQQQQQQQQQQQQQHLQQVQQQRLLK QQQQQAQRQQIQQQLLQQQQQKQQLQQQQQQEQLQQQQLQLQQQL QQQLQHIQKEPSSHTYTPGP MQDDLLMDKSKTQPQSQQQQRQQQQQQQQLQPEPGAAEAPSTPLSSEIP KPEDSSAVPALSPASAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPT APGASLSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGG TFSPQIGLAQTQHHQQPPPPAPQPPQPAQPPQAQPSQQRRSPASPSQAPYAQ RSAAAYGHQPIMTSKPSSSSAVAAAAA ~48% Q/N ~18% Q/N Average Q/N content in mammalian proteins mcpeb-2 mcpeb-1 mcpeb-4 mcpeb-3

54 Modulatory Transmitters Serve as Salience Signals to Stabilize Synaptic Plasticity and Behavior for Both Implicit and Explicit Memory Is the mechanism for maintenance also general? Implicit Memory: Sensitization in Aplysia Explicit Memory: Spatial Memory in the Mouse

55 Naveen Agnihortri Cliff Kentros Joung-Hun Kim Kelsey Martin Maurizio Giustetto Amit Etkin Martin Theis Angel Barco Juan Marcos Alarcon Isabel Muzzio Kausik Si Robert Muller Craig Bailey Susan Lindquist

Cellular Mechanisms of Learning and the Biological Basis of Individuality

Cellular Mechanisms of Learning and the Biological Basis of Individuality The Study of Memory Has Two Parts: Cellular Mechanisms of Learning and the Biological Basis of Individuality (1) The Systems Problem of Memory: Where in the brain is memory stored? (2) The Molecular Problem

More information

Sustained CPEB-Dependent Local Protein Synthesis Is Required to Stabilize Synaptic Growth for Persistence of Long-Term Facilitation in Aplysia

Sustained CPEB-Dependent Local Protein Synthesis Is Required to Stabilize Synaptic Growth for Persistence of Long-Term Facilitation in Aplysia Article Sustained CPEB-Dependent Local Protein Synthesis Is Required to Stabilize Synaptic Growth for Persistence of Long-Term Facilitation in Aplysia Maria Concetta Miniaci, 2,4 Joung-Hun Kim, 2,5 Sathyanarayanan

More information

CASE 49. What type of memory is available for conscious retrieval? Which part of the brain stores semantic (factual) memories?

CASE 49. What type of memory is available for conscious retrieval? Which part of the brain stores semantic (factual) memories? CASE 49 A 43-year-old woman is brought to her primary care physician by her family because of concerns about her forgetfulness. The patient has a history of Down syndrome but no other medical problems.

More information

Systems Neuroscience November 29, Memory

Systems Neuroscience November 29, Memory Systems Neuroscience November 29, 2016 Memory Gabriela Michel http: www.ini.unizh.ch/~kiper/system_neurosci.html Forms of memory Different types of learning & memory rely on different brain structures

More information

COLUMBIA. Brain and Mind. May 13, Eric Kandel, MD The Storage and Persistence of Memory. columbia university. Introduction by Gerald Fischbach

COLUMBIA. Brain and Mind. May 13, Eric Kandel, MD The Storage and Persistence of Memory. columbia university. Introduction by Gerald Fischbach COLUMBIA columbia university DIGITAL KNOWLEDGE VENTURES Brain and Mind May 13, 2004 Eric Kandel, MD The Storage and Persistence of Memory Introduction by Gerald Fischbach Gerald Fischbach: Thank you, Richard.

More information

9.01 Introduction to Neuroscience Fall 2007

9.01 Introduction to Neuroscience Fall 2007 MIT OpenCourseWare http://ocw.mit.edu 9.01 Introduction to Neuroscience Fall 2007 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Working memory short-term

More information

Neuronal Plasticity, Learning and Memory. David Keays Institute of Molecular Pathology

Neuronal Plasticity, Learning and Memory. David Keays Institute of Molecular Pathology Neuronal Plasticity, Learning and Memory David Keays Institute of Molecular Pathology http://keayslab.org Structure 1. What is learning and memory? 2. Anatomical basis 3. Cellular basis 4. Molecular

More information

The Neurobiology of Learning and Memory

The Neurobiology of Learning and Memory The Neurobiology of Learning and Memory JERRY W. RUDY University of Colorado, Boulder Sinauer Associates, Inc. Publishers Sunderland, Massachusetts 01375 Table of Contents CHAPTER 1 Introduction: Fundamental

More information

Synap&c Plas&city. long-term plasticity (~30 min to lifetime) Long-term potentiation (LTP) / Long-term depression (LTD)

Synap&c Plas&city. long-term plasticity (~30 min to lifetime) Long-term potentiation (LTP) / Long-term depression (LTD) Synap&c Plas&city synaptic connectivity constantly changes in response to activity and other factors During development: provides the basic wiring of the brain s circuits Throughout rest of life: basis

More information

synapse neurotransmitters Extension of a neuron, ending in branching terminal fibers, through which messages pass to other neurons, muscles, or glands

synapse neurotransmitters Extension of a neuron, ending in branching terminal fibers, through which messages pass to other neurons, muscles, or glands neuron synapse The junction between the axon tip of a sending neuron and the dendrite of a receiving neuron Building block of the nervous system; nerve cell Chemical messengers that cross the synaptic

More information

Behavioral Neurobiology

Behavioral Neurobiology Behavioral Neurobiology The Cellular Organization of Natural Behavior THOMAS J. CAREW University of California, Irvine Sinauer Associates, Inc. Publishers Sunderland, Massachusetts PART I: Introduction

More information

BIPN 140 Problem Set 6

BIPN 140 Problem Set 6 BIPN 140 Problem Set 6 1) The hippocampus is a cortical structure in the medial portion of the temporal lobe (medial temporal lobe in primates. a) What is the main function of the hippocampus? The hippocampus

More information

1) Drop off in the Bi 150 box outside Baxter 331 or to the head TA (jcolas).

1) Drop off in the Bi 150 box outside Baxter 331 or  to the head TA (jcolas). Bi/CNS/NB 150 Problem Set 5 Due: Tuesday, Nov. 24, at 4:30 pm Instructions: 1) Drop off in the Bi 150 box outside Baxter 331 or e-mail to the head TA (jcolas). 2) Submit with this cover page. 3) Use a

More information

Let me begin by telling a little story.

Let me begin by telling a little story. Chapter 19 Learning and Memory Let me begin by telling a little story. When I was a graduate student we had to take an exam that Cornell does in an interesting way. They put you in a swivelchair surrounded

More information

BIPN 140 Problem Set 6

BIPN 140 Problem Set 6 BIPN 140 Problem Set 6 1) Hippocampus is a cortical structure in the medial portion of the temporal lobe (medial temporal lobe in primates. a) What is the main function of the hippocampus? The hippocampus

More information

Ch 8. Learning and Memory

Ch 8. Learning and Memory Ch 8. Learning and Memory Cognitive Neuroscience: The Biology of the Mind, 2 nd Ed., M. S. Gazzaniga,, R. B. Ivry,, and G. R. Mangun,, Norton, 2002. Summarized by H.-S. Seok, K. Kim, and B.-T. Zhang Biointelligence

More information

Ch 8. Learning and Memory

Ch 8. Learning and Memory Ch 8. Learning and Memory Cognitive Neuroscience: The Biology of the Mind, 2 nd Ed., M. S. Gazzaniga, R. B. Ivry, and G. R. Mangun, Norton, 2002. Summarized by H.-S. Seok, K. Kim, and B.-T. Zhang Biointelligence

More information

Theories of memory. Memory & brain Cellular bases of learning & memory. Epileptic patient Temporal lobectomy Amnesia

Theories of memory. Memory & brain Cellular bases of learning & memory. Epileptic patient Temporal lobectomy Amnesia Cognitive Neuroscience: The Biology of the Mind, 2 nd Ed., M. S. Gazzaniga, R. B. Ivry, and G. R. Mangun, Norton, 2002. Theories of Sensory, short-term & long-term memories Memory & brain Cellular bases

More information

The Role of Smoking in Cocaine. Addiction

The Role of Smoking in Cocaine. Addiction The Role of Smoking in Cocaine Addiction Luca Colnaghi Eric Kandel Laboratory Columbia University in the City of New York Department of Neuroscience Index 1- The Brain, memory, metaplasticity 2- Cocaine

More information

The molecular biology of memory: camp, PKA, CRE, CREB-1, CREB-2, and CPEB. Eric R Kandel

The molecular biology of memory: camp, PKA, CRE, CREB-1, CREB-2, and CPEB. Eric R Kandel Molecular Brain This Provisional PDF corresponds to the article as it appeared upon acceptance. Fully formatted PDF and full text (HTML) versions will be made available soon. The molecular biology of memory:

More information

Synaptic plasticityhippocampus. Neur 8790 Topics in Neuroscience: Neuroplasticity. Outline. Synaptic plasticity hypothesis

Synaptic plasticityhippocampus. Neur 8790 Topics in Neuroscience: Neuroplasticity. Outline. Synaptic plasticity hypothesis Synaptic plasticityhippocampus Neur 8790 Topics in Neuroscience: Neuroplasticity Outline Synaptic plasticity hypothesis Long term potentiation in the hippocampus How it s measured What it looks like Mechanisms

More information

Synaptic plasticity. Mark van Rossum. Institute for Adaptive and Neural Computation University of Edinburgh

Synaptic plasticity. Mark van Rossum. Institute for Adaptive and Neural Computation University of Edinburgh Synaptic plasticity Mark van Rossum Institute for Adaptive and Neural Computation University of Edinburgh 1 Human memory systems 2 Psychologists have split up memory in: Declarative memory * Episodic memory

More information

Psychology 320: Topics in Physiological Psychology Lecture Exam 2: March 19th, 2003

Psychology 320: Topics in Physiological Psychology Lecture Exam 2: March 19th, 2003 Psychology 320: Topics in Physiological Psychology Lecture Exam 2: March 19th, 2003 Name: Student #: BEFORE YOU BEGIN!!! 1) Count the number of pages in your exam. The exam is 8 pages long; if you do not

More information

63 Cellular Mechanisms of Learning and the Biological Basis of Individuality

63 Cellular Mechanisms of Learning and the Biological Basis of Individuality Back 63 Cellular Mechanisms of Learning and the Biological Basis of Individuality Eric R. Kandel THROUGHOUT THIS BOOK we have emphasized that all behavior is a function of the brain and that malfunctions

More information

Synaptic Plasticity and NO-cGMP-PKG Signaling Regulate Pre- and Postsynaptic Alterations at Rat Lateral Amygdala Synapses Following Fear Conditioning

Synaptic Plasticity and NO-cGMP-PKG Signaling Regulate Pre- and Postsynaptic Alterations at Rat Lateral Amygdala Synapses Following Fear Conditioning Synaptic Plasticity and NO-cGMP-PKG Signaling Regulate Pre- and Postsynaptic Alterations at Rat Lateral Amygdala Synapses Following Fear Conditioning Kristie T. Ota 1, Melissa S. Monsey 1, Melissa S. Wu

More information

Introduction the basics of psychological learning and memory theory. From Mechanisms of Memory by J. David Sweatt, Ph.D.

Introduction the basics of psychological learning and memory theory. From Mechanisms of Memory by J. David Sweatt, Ph.D. Introduction the basics of psychological learning and memory theory. From Mechanisms of Memory by J. David Sweatt, Ph.D. Definitions Learning: The acquisition of an altered behavioral response due to an

More information

Chapter 23: Wiring the Brain

Chapter 23: Wiring the Brain Chapter 23: Wiring the Brain Introduction Operation of the brain Precise interconnections among 100 billion neurons Brain development Begins as a tube Neurogenesis, synaptogenesis, pathway formation, connections

More information

Computational Explorations in Cognitive Neuroscience Chapter 7: Large-Scale Brain Area Functional Organization

Computational Explorations in Cognitive Neuroscience Chapter 7: Large-Scale Brain Area Functional Organization Computational Explorations in Cognitive Neuroscience Chapter 7: Large-Scale Brain Area Functional Organization 1 7.1 Overview This chapter aims to provide a framework for modeling cognitive phenomena based

More information

Neural plasticity in infants - relevance to baby swimming. Morten Overgaard

Neural plasticity in infants - relevance to baby swimming. Morten Overgaard Neural plasticity in infants - relevance to baby swimming Morten Overgaard Programme What is neuroscience? Totally superficial neuroanatomy Paradoxes of functional localization Mechanisms of neural plasticity

More information

Cellular Neurobiology BIPN140

Cellular Neurobiology BIPN140 Cellular Neurobiology BIPN140 Second midterm is next Tuesday!! Covers lectures 7-12 (Synaptic transmission, NT & receptors, intracellular signaling & synaptic plasticity). Review session is on Monday (Nov

More information

The molecular biology of memory: camp, PKA, CRE, CREB-1, CREB-2, and CPEB

The molecular biology of memory: camp, PKA, CRE, CREB-1, CREB-2, and CPEB Kandel Molecular Brain 2012, 5:14 REVIEW Open Access The molecular biology of memory: camp, PKA, CRE, CREB-1, CREB-2, and CPEB Eric R Kandel Abstract The analysis of the contributions to synaptic plasticity

More information

Why is dispersion of memory important*

Why is dispersion of memory important* What is memory* It is a web of connections Research has shown that people who lose their memory also lose the ability to connect things to each other in their mind It is these connections that let us understand

More information

serotonin in learning and plasticity

serotonin in learning and plasticity serotonin in learning and plasticity pt.1 immediate action L P H N NRX N N R X N CDH RhoA/ROCK RAC1 DAG [Ca2+] camp GIRK2 P11 Gq CASK PICK1 VELI MINT-1 CaMK Ca2+ channel AC Gi mglur7 mglur5 Glutamate NMDAR

More information

CISC 3250 Systems Neuroscience

CISC 3250 Systems Neuroscience CISC 3250 Systems Neuroscience Levels of organization Central Nervous System 1m 10 11 neurons Neural systems and neuroanatomy Systems 10cm Networks 1mm Neurons 100μm 10 8 neurons Professor Daniel Leeds

More information

The Nervous System. Neuron 01/12/2011. The Synapse: The Processor

The Nervous System. Neuron 01/12/2011. The Synapse: The Processor The Nervous System Neuron Nucleus Cell body Dendrites they are part of the cell body of a neuron that collect chemical and electrical signals from other neurons at synapses and convert them into electrical

More information

Neuroplasticity:. Happens in at least 3 ways: - - -

Neuroplasticity:. Happens in at least 3 ways: - - - BRAIN PLASTICITY Neuroplasticity:. Happens in at least 3 ways: - - - Recently, it was found that new neurons and glial cells are born in specific brain regions - reorganization. Brain plasticity occurs

More information

Summarized by. Biointelligence Laboratory, Seoul National University

Summarized by. Biointelligence Laboratory, Seoul National University Ch 8. Learning and Memory Cognitive Neuroscience: The Biology of the Mind, 3 rd Ed., M. S. Gazzaniga, R. B. Ivry, and G. R. Mangun, Norton, 2008. Summarized by H.-S. Seok, K. Kim, and db.-t. TZhang Biointelligence

More information

BRAIN PLASTICITY. Neuroplasticity:. Happens in at least 3 ways: - - -

BRAIN PLASTICITY. Neuroplasticity:. Happens in at least 3 ways: - - - BRAIN PLASTICITY Neuroplasticity:. Happens in at least 3 ways: - - - Recently, it was found that new neurons and glial cells are born in specific brain regions - reorganization. Brain plasticity occurs

More information

Behavioral Neuroscience: Fear thou not. Rony Paz

Behavioral Neuroscience: Fear thou not. Rony Paz Behavioral Neuroscience: Fear thou not Rony Paz Rony.paz@weizmann.ac.il Thoughts What is a reward? Learning is best motivated by threats to survival Threats are much better reinforcers Fear is a prime

More information

THE CENTRAL NERVOUS SYSTEM. The Brain & Spinal Cord

THE CENTRAL NERVOUS SYSTEM. The Brain & Spinal Cord THE CENTRAL NERVOUS SYSTEM The Brain & Spinal Cord Review: Nervous System Parallel Distributed Processing Composition of the CNS Nuclei: Clusters of neurons in the CNS ( neighborhoods ) Fiber Tracts/Pathways:

More information

Why do we have a hippocampus? Short-term memory and consolidation

Why do we have a hippocampus? Short-term memory and consolidation Why do we have a hippocampus? Short-term memory and consolidation So far we have talked about the hippocampus and: -coding of spatial locations in rats -declarative (explicit) memory -experimental evidence

More information

Introduction to Physiological Psychology Review

Introduction to Physiological Psychology Review Introduction to Physiological Psychology Review ksweeney@cogsci.ucsd.edu www.cogsci.ucsd.edu/~ksweeney/psy260.html n Learning and Memory n Human Communication n Emotion 1 What is memory? n Working Memory:

More information

NEURONS COMMUNICATE WITH OTHER CELLS AT SYNAPSES 34.3

NEURONS COMMUNICATE WITH OTHER CELLS AT SYNAPSES 34.3 NEURONS COMMUNICATE WITH OTHER CELLS AT SYNAPSES 34.3 NEURONS COMMUNICATE WITH OTHER CELLS AT SYNAPSES Neurons communicate with other neurons or target cells at synapses. Chemical synapse: a very narrow

More information

Name: Period: Chapter 2 Reading Guide The Biology of Mind

Name: Period: Chapter 2 Reading Guide The Biology of Mind Name: Period: Chapter 2 Reading Guide The Biology of Mind The Nervous System (pp. 55-58) 1. What are nerves? 2. Complete the diagram below with definitions of each part of the nervous system. Nervous System

More information

DNA and Histone Methylation in Learning and Memory

DNA and Histone Methylation in Learning and Memory EXPERIMENTAL BIOLOGY ANNUAL MEETING April 2010 DNA and Histone Methylation in Learning and Memory J. David Sweatt Dept of Neurobiology McKnight Brain Institute UAB School of Medicine The Molecular Basis

More information

Activity-Dependent Development II April 25, 2007 Mu-ming Poo

Activity-Dependent Development II April 25, 2007 Mu-ming Poo Activity-Dependent Development II April 25, 2007 Mu-ming Poo 1. The neurotrophin hypothesis 2. Maps in somatic sensory and motor cortices 3. Development of retinotopic map 4. Reorganization of cortical

More information

Lesson 14. The Nervous System. Introduction to Life Processes - SCI 102 1

Lesson 14. The Nervous System. Introduction to Life Processes - SCI 102 1 Lesson 14 The Nervous System Introduction to Life Processes - SCI 102 1 Structures and Functions of Nerve Cells The nervous system has two principal cell types: Neurons (nerve cells) Glia The functions

More information

Learning and Memory. The Case of H.M.

Learning and Memory. The Case of H.M. Learning and Memory Learning deals with how experience changes the brain Memory refers to how these changes are stored and later reactivated The Case of H.M. H.M. suffered from severe, intractable epilepsy

More information

Chapter 11: Inherited Disorders of Human Memory Mental Retardation Syndromes. From Mechanisms of Memory, second edition By J. David Sweatt, Ph.D.

Chapter 11: Inherited Disorders of Human Memory Mental Retardation Syndromes. From Mechanisms of Memory, second edition By J. David Sweatt, Ph.D. Chapter 11: Inherited Disorders of Human Memory Mental Retardation Syndromes From Mechanisms of Memory, second edition By J. David Sweatt, Ph.D. Chapter 11: Mental Retardation Syndromes Table I: Mouse

More information

PSYC& 100: Biological Psychology (Lilienfeld Chap 3) 1

PSYC& 100: Biological Psychology (Lilienfeld Chap 3) 1 PSYC& 100: Biological Psychology (Lilienfeld Chap 3) 1 1 What is a neuron? 2 Name and describe the functions of the three main parts of the neuron. 3 What do glial cells do? 4 Describe the three basic

More information

Cerebral Cortex: Association Areas and Memory Tutis Vilis

Cerebral Cortex: Association Areas and Memory Tutis Vilis 97 Cerebral Cortex: Association Areas and Memory Tutis Vilis a) Name the 5 main subdivisions of the cerebral cortex. Frontal, temporal, occipital, parietal, and limbic (on the medial side) b) Locate the

More information

Declarative memory includes semantic, episodic, and spatial memory, and

Declarative memory includes semantic, episodic, and spatial memory, and Gallo Taste Learning and Memory in Aging Milagros Gallo, PhD Declarative memory includes semantic, episodic, and spatial memory, and in humans involves conscious recall. 1 Visual recognition memory is

More information

The Molecular Biology of Memory Storage: A Dialogue Between Genes and Synapses. DOI: /science

The Molecular Biology of Memory Storage: A Dialogue Between Genes and Synapses. DOI: /science The Molecular Biology of Memory Storage: A Dialogue Between Genes and Synapses Eric R. Kandel, et al. Science 294, 1030 (2001); DOI: 10.1126/science.1067020 The following resources related to this article

More information

Fig Copyright 2002 Pearson Education, Inc., publishing as Benjamin Cummings

Fig Copyright 2002 Pearson Education, Inc., publishing as Benjamin Cummings Fig. 48.1 Fig. 48.2 Axon endings are called synaptic terminals. They contain neurotransmitters which conduct a signal across a synapse. A synapse is the junction between a presynaptic and postsynaptic

More information

Synapse. Structure & Function. Neurotransmitter Sequence. Integration. History: 10/4/12 original version

Synapse. Structure & Function. Neurotransmitter Sequence. Integration. History: 10/4/12 original version Synapse History: 10/4/12 original version Structure & Function (This content is covered in Sinjin's presentation, see link in calendar) Neurotransmitters Synaptic cleft Post-synaptic potential Excitation

More information

BRAIN MECHANISMS OF REWARD AND ADDICTION

BRAIN MECHANISMS OF REWARD AND ADDICTION BRAIN MECHANISMS OF REWARD AND ADDICTION TREVOR.W. ROBBINS Department of Experimental Psychology, University of Cambridge Many drugs of abuse, including stimulants such as amphetamine and cocaine, opiates

More information

Memory retention the synaptic stability versus plasticity dilemma

Memory retention the synaptic stability versus plasticity dilemma Memory retention the synaptic stability versus plasticity dilemma Paper: Abraham, Wickliffe C., and Anthony Robins. "Memory retention the synaptic stability versus plasticity dilemma." Trends in neurosciences

More information

To understand AD, it is important to

To understand AD, it is important to To understand AD, it is important to know a bit about the brain. This part of Unraveling the Mystery gives an inside view of the normal brain, how it works, and what happens during aging. The brain is

More information

Feedback Education and Neuroscience. Pankaj Sah

Feedback Education and Neuroscience. Pankaj Sah Feedback Education and Neuroscience Pankaj Sah Science of Learning Learning The process of acquiring a skill or knowledge that leads to a change in behaviour Memory The ability to retain and recover information

More information

Selective Memory Generalization by Spatial Patterning of Protein Synthesis

Selective Memory Generalization by Spatial Patterning of Protein Synthesis Selective Memory Generalization by Spatial Patterning of Protein Synthesis Cian O Donnell and Terrence J. Sejnowski Neuron 82, 398-412 (2014) Referred by Kristjan-Julius Laak Spatial Protein Synthesis

More information

More dendritic spines, changes in shapes of dendritic spines More NT released by presynaptic membrane

More dendritic spines, changes in shapes of dendritic spines More NT released by presynaptic membrane LEARNING AND MEMORY (p.1) You are your learning and memory! (see movie Total Recall) L&M, two sides of the same coin learning refers more to the acquisition of new information & brain circuits (storage)

More information

Y a-t il un pilote dans le cerveau? Données récentes Sur les bases neuronales de l orientation spatiale

Y a-t il un pilote dans le cerveau? Données récentes Sur les bases neuronales de l orientation spatiale Laboratory of Cognitive Neuroscience, Marseille NeuroSTIC Grenoble, June 23 24, 2016 Y a-t il un pilote dans le cerveau? Données récentes Sur les bases neuronales de l orientation spatiale Why is it important

More information

biological psychology, p. 40 The study of the nervous system, especially the brain. neuroscience, p. 40

biological psychology, p. 40 The study of the nervous system, especially the brain. neuroscience, p. 40 biological psychology, p. 40 The specialized branch of psychology that studies the relationship between behavior and bodily processes and system; also called biopsychology or psychobiology. neuroscience,

More information

Brain and behaviour (Wk 6 + 7)

Brain and behaviour (Wk 6 + 7) Brain and behaviour (Wk 6 + 7) What is a neuron? What is the cell body? What is the axon? The basic building block of the nervous system, the individual nerve cell that receives, processes and transmits

More information

Unit 3: The Biological Bases of Behaviour

Unit 3: The Biological Bases of Behaviour Unit 3: The Biological Bases of Behaviour Section 1: Communication in the Nervous System Section 2: Organization in the Nervous System Section 3: Researching the Brain Section 4: The Brain Section 5: Cerebral

More information

Organization of the nervous system. The withdrawal reflex. The central nervous system. Structure of a neuron. Overview

Organization of the nervous system. The withdrawal reflex. The central nervous system. Structure of a neuron. Overview Overview The nervous system- central and peripheral The brain: The source of mind and self Neurons Neuron Communication Chemical messengers Inside the brain Parts of the brain Split Brain Patients Organization

More information

9.01 Introduction to Neuroscience Fall 2007

9.01 Introduction to Neuroscience Fall 2007 MIT OpenCourseWare http://ocw.mit.edu 9.01 Introduction to Neuroscience Fall 2007 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Declarative memory conscious,

More information

Acetylcholine (ACh) Action potential. Agonists. Drugs that enhance the actions of neurotransmitters.

Acetylcholine (ACh) Action potential. Agonists. Drugs that enhance the actions of neurotransmitters. Acetylcholine (ACh) The neurotransmitter responsible for motor control at the junction between nerves and muscles; also involved in mental processes such as learning, memory, sleeping, and dreaming. (See

More information

Behavioral Neuroscience: Fear thou not. Rony Paz

Behavioral Neuroscience: Fear thou not. Rony Paz Behavioral Neuroscience: Fear thou not Rony Paz Rony.paz@weizmann.ac.il Thoughts What is a reward? Learning is best motivated by threats to survival? Threats are much better reinforcers? Fear is a prime

More information

Name: Period: Test Review: Chapter 2

Name: Period: Test Review: Chapter 2 Name: Period: Test Review: Chapter 2 1. The function of dendrites is to A) receive incoming signals from other neurons. B) release neurotransmitters into the spatial junctions between neurons. C) coordinate

More information

Geography of the Forehead

Geography of the Forehead 5. Brain Areas Geography of the Forehead Everyone thinks the brain is so complicated, but let s look at the facts. The frontal lobe, for example, is located in the front! And the temporal lobe is where

More information

Neural Communication. Central Nervous System Peripheral Nervous System. Communication in the Nervous System. 4 Common Components of a Neuron

Neural Communication. Central Nervous System Peripheral Nervous System. Communication in the Nervous System. 4 Common Components of a Neuron Neural Communication Overview of CNS / PNS Electrical Signaling Chemical Signaling Central Nervous System Peripheral Nervous System Somatic = sensory & motor Autonomic = arousal state Parasympathetic =

More information

Cephalization. Nervous Systems Chapter 49 11/10/2013. Nervous systems consist of circuits of neurons and supporting cells

Cephalization. Nervous Systems Chapter 49 11/10/2013. Nervous systems consist of circuits of neurons and supporting cells Nervous Systems Chapter 49 Cephalization Nervous systems consist of circuits of neurons and supporting cells Nervous system organization usually correlates with lifestyle Organization of the vertebrate

More information

Introduction to Physiological Psychology Learning and Memory II

Introduction to Physiological Psychology Learning and Memory II Introduction to Physiological Psychology Learning and Memory II ksweeney@cogsci.ucsd.edu cogsci.ucsd.edu/~ksweeney/psy260.html Memory Working Memory Long-term Memory Declarative Memory Procedural Memory

More information

Supplementary Material S3 Further Seed Regions

Supplementary Material S3 Further Seed Regions Supplementary Material S3 Further Seed Regions Figure I. Changes in connectivity with the right anterior insular cortex. (A) wake > mild sedation, showing a reduction in connectivity between the anterior

More information

Teacher Memory Lanes. Memory Lanes. Lesson Overview

Teacher Memory Lanes. Memory Lanes.  Lesson Overview 1 Lesson Overview Students will be introduced to an online activity where they follow the routes different drivers in London and assess changes in their brain anatomy. Students will then research the various

More information

UNRAVELING THE MYSTERY MOLECULE BY MOLECULE CELL BY CELL NETWORK BY NETWORK

UNRAVELING THE MYSTERY MOLECULE BY MOLECULE CELL BY CELL NETWORK BY NETWORK UNRAVELING THE MYSTERY MOLECULE BY MOLECULE CELL BY CELL NETWORK BY NETWORK Center for Learning and Memory The University of Texas at Austin The Center for Learning and Memory at The University of Texas

More information

Biological Psychology 2012 Spring 2005 Patterson

Biological Psychology 2012 Spring 2005 Patterson Final Exam Biological Psychology 2012 Spring 2005 Patterson There are two versions of this exam. You have version A. Before starting the exam, mark A on question 60. MULTIPLE CHOICE. Choose the one alternative

More information

The Nobel Prize in Physiology or Medicine 2000

The Nobel Prize in Physiology or Medicine 2000 The Nobel Prize in Physiology or Medicine 2000 Press Release NOBELFÖRSAMLINGEN KAROLINSKA INSTITUTET THE NOBEL ASSEMBLY AT THE KAROLINSKA INSTITUTE 9 October 2000 The Nobel Assembly at Karolinska Institutet

More information

Introduction to Physiological Psychology

Introduction to Physiological Psychology Introduction to Physiological Psychology Review Kim Sweeney ksweeney@cogsci.ucsd.edu www.cogsci.ucsd.edu/~ksweeney/psy260.html Today n Discuss Final Paper Proposal (due 3/10) n General Review 1 The article

More information

Henry Molaison. Biography. From Wikipedia, the free encyclopedia

Henry Molaison. Biography. From Wikipedia, the free encyclopedia Henry Molaison From Wikipedia, the free encyclopedia Henry Gustav Molaison (February 26, 1926 December 2, 2008), known widely as H.M., was an American memory disorder patient who had a bilateral medial

More information

3/20/13. :: Slide 1 :: :: Slide 39 :: How Is the Nervous System Organized? Central Nervous System Peripheral Nervous System and Endocrine System

3/20/13. :: Slide 1 :: :: Slide 39 :: How Is the Nervous System Organized? Central Nervous System Peripheral Nervous System and Endocrine System :: Slide 1 :: :: Slide 39 :: How Is the Nervous System Organized? Central Nervous System Peripheral Nervous System and Endocrine System The nervous system is organized into several major branches, each

More information

Chapter 2. Investigation into mir-346 Regulation of the nachr α5 Subunit

Chapter 2. Investigation into mir-346 Regulation of the nachr α5 Subunit 15 Chapter 2 Investigation into mir-346 Regulation of the nachr α5 Subunit MicroRNA s (mirnas) are small (< 25 base pairs), single stranded, non-coding RNAs that regulate gene expression at the post transcriptional

More information

The Methods of Cognitive Neuroscience. Sensory Systems and Perception: Auditory, Mechanical, and Chemical Senses 93

The Methods of Cognitive Neuroscience. Sensory Systems and Perception: Auditory, Mechanical, and Chemical Senses 93 Contents in Brief CHAPTER 1 Cognitive Neuroscience: Definitions, Themes, and Approaches 1 CHAPTER 2 The Methods of Cognitive Neuroscience CHAPTER 3 Sensory Systems and Perception: Vision 55 CHAPTER 4 CHAPTER

More information

Synaptic plasticity and hippocampal memory

Synaptic plasticity and hippocampal memory Synaptic plasticity and hippocampal memory Tobias Bast School of Psychology, University of Nottingham tobias.bast@nottingham.ac.uk Synaptic plasticity as the neurophysiological substrate of learning Hebb

More information

Suppl. Information Supplementary Figure 1. Strategy/latency analysis of individual mice during maze learning. a,

Suppl. Information Supplementary Figure 1. Strategy/latency analysis of individual mice during maze learning. a, Goal-oriented searching mediated by ventral hippocampus early in trial-and-error learning Ruediger, S, Spirig, D., Donato, F., Caroni, P. Suppl. Information Supplementary Figure 1. Strategy/latency analysis

More information

The Visual System. Cortical Architecture Casagrande February 23, 2004

The Visual System. Cortical Architecture Casagrande February 23, 2004 The Visual System Cortical Architecture Casagrande February 23, 2004 Phone: 343-4538 Email: vivien.casagrande@mcmail.vanderbilt.edu Office: T2302 MCN Required Reading Adler s Physiology of the Eye Chapters

More information

Plasticity of Cerebral Cortex in Development

Plasticity of Cerebral Cortex in Development Plasticity of Cerebral Cortex in Development Jessica R. Newton and Mriganka Sur Department of Brain & Cognitive Sciences Picower Center for Learning & Memory Massachusetts Institute of Technology Cambridge,

More information

63 Cellular Mechanisms of Learning and the Biological Basis of Individuality

63 Cellular Mechanisms of Learning and the Biological Basis of Individuality Back 63 Cellular Mechanisms of Learning and the Biological Basis of Individuality Eric R. Kandel THROUGHOUT THIS BOOK we have emphasized that all behavior is a function of the brain and that malfunctions

More information

The Nervous System. Biological School. Neuroanatomy. How does a Neuron fire? Acetylcholine (ACH) TYPES OF NEUROTRANSMITTERS

The Nervous System. Biological School. Neuroanatomy. How does a Neuron fire? Acetylcholine (ACH) TYPES OF NEUROTRANSMITTERS Biological School The Nervous System It is all about the body!!!! It starts with an individual nerve cell called a NEURON. Synapse Neuroanatomy Neurotransmitters (chemicals held in terminal buttons that

More information

Memory Systems II How Stored: Engram and LTP. Reading: BCP Chapter 25

Memory Systems II How Stored: Engram and LTP. Reading: BCP Chapter 25 Memory Systems II How Stored: Engram and LTP Reading: BCP Chapter 25 Memory Systems Learning is the acquisition of new knowledge or skills. Memory is the retention of learned information. Many different

More information

Myers Psychology for AP*

Myers Psychology for AP* Myers Psychology for AP* David G. Myers PowerPoint Presentation Slides by Kent Korek Germantown High School Worth Publishers, 2010 *AP is a trademark registered and/or owned by the College Board, which

More information

Nervous System C H A P T E R 2

Nervous System C H A P T E R 2 Nervous System C H A P T E R 2 Input Output Neuron 3 Nerve cell Allows information to travel throughout the body to various destinations Receptive Segment Cell Body Dendrites: receive message Myelin sheath

More information

Memory. Lynn Yen, class of 2009

Memory. Lynn Yen, class of 2009 Memory Lynn Yen, class of 2009 Objectives 1. Understand the different types of memory. 2. Describe where different types of memory are stored and the CNS structures involved in storage. 3. Describe how

More information

Notes: Synapse. Overview. PSYC Summer Professor Claffey PDF. Conversion from an signal to a signal - electrical signal is the

Notes: Synapse. Overview. PSYC Summer Professor Claffey PDF. Conversion from an signal to a signal - electrical signal is the PSYC 170 - Summer 2013 - Professor Claffey Notes: Synapse PDF Overview Conversion from an signal to a signal - electrical signal is the - chemical signal is the Presynaptic - refers to that sends/receives

More information

Chapter 14: Integration of Nervous System Functions I. Sensation.

Chapter 14: Integration of Nervous System Functions I. Sensation. Chapter 14: Integration of Nervous System Functions I. Sensation A. General Organization 1. General senses have receptors a. The somatic senses provide information about & 1. Somatic senses include: a.

More information

CSE511 Brain & Memory Modeling Lect 22,24,25: Memory Systems

CSE511 Brain & Memory Modeling Lect 22,24,25: Memory Systems CSE511 Brain & Memory Modeling Lect 22,24,25: Memory Systems Compare Chap 31 of Purves et al., 5e Chap 24 of Bear et al., 3e Larry Wittie Computer Science, StonyBrook University http://www.cs.sunysb.edu/~cse511

More information

Questions Addressed Through Study of Behavioral Mechanisms (Proximate Causes)

Questions Addressed Through Study of Behavioral Mechanisms (Proximate Causes) Jan 28: Neural Mechanisms--intro Questions Addressed Through Study of Behavioral Mechanisms (Proximate Causes) Control of behavior in response to stimuli in environment Diversity of behavior: explain the

More information

Physiology Unit 2 CONSCIOUSNESS, THE BRAIN AND BEHAVIOR

Physiology Unit 2 CONSCIOUSNESS, THE BRAIN AND BEHAVIOR Physiology Unit 2 CONSCIOUSNESS, THE BRAIN AND BEHAVIOR In Physiology Today What the Brain Does The nervous system determines states of consciousness and produces complex behaviors Any given neuron may

More information

Serial model. Amnesia. Amnesia. Neurobiology of Learning and Memory. Prof. Stephan Anagnostaras. Lecture 3: HM, the medial temporal lobe, and amnesia

Serial model. Amnesia. Amnesia. Neurobiology of Learning and Memory. Prof. Stephan Anagnostaras. Lecture 3: HM, the medial temporal lobe, and amnesia Neurobiology of Learning and Memory Serial model Memory terminology based on information processing models e.g., Serial Model Prof. Stephan Anagnostaras Lecture 3: HM, the medial temporal lobe, and amnesia

More information