European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1

Size: px
Start display at page:

Download "European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1"

Transcription

1 PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session: European Respiratory Society Annual Congress Preclinical models for the development of new drugs for respiratory diseases Barcelona, Spain, September 7-11, 2013 Page 1

2 Background The pathobiological mechanisms underlying the development of idiopathic pulmonary fibrosis (IPF) are highly complex. PBI-4050, a novel first-in-class, orally active low molecular weight compound, plays a key role in inflammation/fibrosis regulation by reducing pro-fibrotic cytokines, fibrocyte differentiation, myofibroblast activation and EMT, resulting in improvement of organ function. The aim of this study is to compare the anti-fibrotic activity of PBI-4050, pirfenidone and combination of both compounds in the bleomycin-induced lung fibrosis model. Barcelona, Spain, September 7-11, 2013 Page 2

3 Study Design Mice were randomized according to their bleomycin-induced body weight loss, and treatments with PBI-4050 and pirfenidone or combination of both compounds started on day 7. Only animals that recovered their body weight loss by day 20 were used for data analysis. Barcelona, Spain, September 7-11, 2013 Page 3

4 Toxicity No toxicity was reported with PBI 4050 treatment. Treatment with Pirfenidone induced severe vertigo that was reduced with the PBI pirfenidone combination therapy. PBI-4050 (200 mg/kg) No toxicity observed Pirfenidone (400 mg/kg) vertigo ++++ PBI Pirfenidone vertigo ++ Barcelona, Spain, September 7-11, 2013 Page 4

5 PBI-4050 alone, or in combination with pirfenidone, significantly reduces histological lesions in bleomycininduced lung fibrosis Barcelona, Spain, September 7-11, 2013 Page 5

6 % of lung area affected by bleomycin is reduced by PBI-4050 alone as well as by the combination of PBI-4050 & pirfenidone Barcelona, Spain, September 7-11, 2013 Page 6

7 Significant reduction of the % of leukocyte infiltration in lung determined in Masson s trichrome staining (Morphometric evaluation) Barcelona, Spain, September 7-11, 2013 Page 7

8 Significant reduction of [% leukocyte infiltration] X [% of collagen in leukocyte infiltration] in lung determined in Masson s trichrome staining (Morphometric evaluation) Effect of PBI-4050, pirfenidone and combination therapy on lung collagen in leukocyte infiltrates quantified by histomorphometric analysis. Barcelona, Spain, September 7-11, 2013 Page 8

9 Effect of treatment regimen on lung fibrosis Ashcroft s score (HEP and Masson s Trichrome staining) for PBI-4050 and combination therapy were both significantly reduced compared to bleomycin under ANOVA / Dunnett s analysis. Visual grading of pulmonary fibrosis was also determined according to Ashcroft s score. Briefly, the entire fields of each lung section were read by a blinded examiner, and each field was visually graded from 0 to 8. Criteria for grading lung fibrosis were as follows: Grade 0= normal lung; Grade 1= minimal fibrous thickening of alveolar or bronchiolar walls; Grade 3= moderate thickening of walls without obvious damage to lung architecture; Grad 5= increased fibrosis with definitive damage to lung structure and formation of fibrous bands or small fibrous masses; Grade 7= severe distortion of structure and large fibrous area; Grade 8= total fibrous obliteration of lung fields. Barcelona, Spain, September 7-11, 2013 Page 9

10 Histological lesions in bleomycin (bleo)-induced lung fibrosis reduced by PBI-4050 alone and by PBI pirfenidone combination Photomicrographs of lung tissue from mice treated with PBI-4050 showing the reduction of histological lesions (disrupted lung architecture and thickness of alveolar wall, (trichrome staining, 40X) by PBI-4050 alone and by the combination therapy. Pirfenidone alone has no effect. Barcelona, Spain, September 7-11, 2013 Page 10

11 Histological lesions in bleomycin (bleo)-induced lung fibrosis reduced by PBI-4050 alone and by PBI pirfenidone combination Photomicrographs of lung tissue from mice treated with PBI-4050 showing the reduction of histological lesions (disrupted lung architecture and thickness of alveolar wall, (trichrome staining, 100X) by PBI-4050 and the combination therapy. Pirfenidone alone has no effect. Barcelona, Spain, September 7-11, 2013 Page 11

12 Effect of treatment regimen on inflammatory/ pro-fibrotic cytokines mrna expression in lung Bleomycin induced a significant increase in mrna expression of all key mediators in the lung. PBI-4050 and PBI Pirfenidone combination therapy significantly decreased: TGF- 1 (slide 13), CTGF (slide 14), IL-23p19 (slide 15) and IL-6 (slide 16) expression in lung, Pirfenidone alone had no significant effect on CTGF and IL-23p19. Barcelona, Spain, September 7-11, 2013 Page 12

13 Effect of treatment regimen on inflammatory/pro-fibrotic cytokines mrna expression in lung TGF- 1 Effect of PBI-4050, pirfenidone and combination therapy on TGF- 1 expression in bleomycininduced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 13

14 Effect of treatment regimen on inflammatory/pro-fibrotic cytokines mrna expression in lung (Cont d) CTGF Effect of PBI-4050, pirfenidone and combination therapy on CTGF expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 14

15 Effect of treatment regimen on inflammatory/ pro-fibrotic cytokines mrna expression in lung (Cont d) IL-23p19 Effect of PBI-4050, pirfenidone and combination therapy on IL-23p19 expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 15

16 Effect of treatment regimen on inflammatory/pro-fibrotic cytokines mrna expression in lung (Cont d) IL-6 Effect of PBI-4050, pirfenidone and combination therapy on IL-6 expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 16

17 Effect of treatment regimen on fibrotic markers mrna expression in lung IPF is characterized by exaggerated fibroblast proliferation and accumulation of collagens and fibronectin. All treatments induced a significant reduction of collagen I (slide 18) and fibronectin 1 (slide 19) expression to the control level (no bleomycin). Barcelona, Spain, September 7-11, 2013 Page 17

18 Effect of treatment regimen on fibrotic markers mrna expression in lung Collagen I Effect of PBI-4050, pirfenidone and combination therapy on collagen I expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 18

19 Effect of treatment regimen on fibrotic markers mrna expression in lung (Cont d) Fibronectin 1 Effect of PBI-4050, pirfenidone and combination therapy on fibronectin 1 expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 19

20 Effect of treatment regimen on remodeling markers mrna expression in lung Bleomycin induced a significant increase in mrna expression of SPARC and MMP-2. PBI-4050 and combination therapy reduced SPARC expression while pirfenidone had no effect (slide 21). MMP-2 mrna expression was significantly reduced in the combination therapy (slide 22). Barcelona, Spain, September 7-11, 2013 Page 20

21 Effect of treatment regimen on remodeling markers mrna expression in lung SPARC Effect of PBI-4050, pirfenidone and combination therapy on SPARC expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 21

22 Effect of treatment regimen on remodeling markers mrna expression in lung (Cont d) MMP-2 Effect of PBI-4050, pirfenidone and combination therapy on MMP-2 expression in bleomycin-induced lung fibrosis. Barcelona, Spain, September 7-11, 2013 Page 22

23 Conclusion Our results show that PBI-4050 and combination of PBI-4050 and pirfenidone: Reduce inflammatory/profibrotic cytokines (TGF- 1, CTGF, IL-23p19 and IL-6) mrna expression Reduce fibrotic markers (collagen I and fibronectin 1) mrna expression Reduce remodeling markers (SPARC and MMP-2) mrna expression Reduce histological lesions PBI-4050 may be an efficacious treatment in IPF. The combination therapy with pirfenidone provides superior outcomes. Barcelona, Spain, September 7-11, 2013 Page 23

KD025 in IPF: Topline Results

KD025 in IPF: Topline Results KD025 in IPF: Topline Results Webcast Presentation February 13, 2018 Kadmon Holdings, Inc. 1 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs

More information

Green tea extract Its potential protective effect on bleomycin induced lung injuries in rats

Green tea extract Its potential protective effect on bleomycin induced lung injuries in rats Green tea extract Its potential protective effect on bleomycin induced lung injuries in rats Azza H. EL-Medany, Jamila EL-Medany The interest in the use of plant extracts in the treatment of several diseases

More information

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Immunological Lung Diseases

Immunological Lung Diseases Emphysema and Fibrosis Universitätsklinik für Pneumologie Prof. Thomas Geiser Head Div. of Pulmonary Medicine and Laboratory of Lung Research, MU50 thomas.geiser@insel.ch The healthy lung: The pathway

More information

Scleroderma. Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis

Scleroderma. Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis Scleroderma Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis Incidence 3.7-22.8 cases/million Female:male 5:1 Pulmonary fibrosis common, severe

More information

Supporting Information

Supporting Information Supporting Information Rock et al. 10.1073/pnas.1117988108 Fig. S1. Heterogeneity of stromal cells in normal and fibrotic mouse lungs. Sections of normal mouse lungs (A and D) and fibrotic lungs collected

More information

Uncovering the mechanisms of wound healing and fibrosis

Uncovering the mechanisms of wound healing and fibrosis Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:

More information

KD : A Phase 2 Trial of KD025 to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF)

KD : A Phase 2 Trial of KD025 to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF) -207: A Phase 2 Trial of to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF) K. F. Gibson 1, F. Averill 2, T.E. Albertson 3, D. M. Baratz 4, S. Chaudhary 5,

More information

Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment

Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure:

More information

CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt

CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,

More information

RESEARCH PAPER A novel, orally active LPA 1 receptor antagonist inhibits lung fibrosis in the mouse bleomycin modelbph_

RESEARCH PAPER A novel, orally active LPA 1 receptor antagonist inhibits lung fibrosis in the mouse bleomycin modelbph_ 828 1699..17131699..1713 British Journal of Pharmacology (2010), 160, 1699 1713 2010 Amira Pharmaceuticals Journal compilation 2010 The British Pharmacological Society All rights reserved 0007-1188/10

More information

The Lung as a Model for Translational Medicine

The Lung as a Model for Translational Medicine The Lung as a Model for Translational Medicine Professor Michael P. Keane MD, FRCPI UCD School of Medicine & Medical Science Scoil an Leighis agus Eolaíocht An Leighis UCD Translational Medicine Interaction

More information

Cannabinoid CB 1. receptor overactivity contributes to the pathogenesis of idiopathic pulmonary fibrosis. Introduction

Cannabinoid CB 1. receptor overactivity contributes to the pathogenesis of idiopathic pulmonary fibrosis. Introduction Cannabinoid CB 1 receptor overactivity contributes to the pathogenesis of idiopathic pulmonary fibrosis Resat Cinar, 1 Bernadette R. Gochuico, 2 Malliga R. Iyer, 1 Tony Jourdan, 1 Tadafumi Yokoyama, 2

More information

i-bodies a new class of protein therapeutics to treat fibrosis

i-bodies a new class of protein therapeutics to treat fibrosis i-bodies a new class of protein therapeutics to treat fibrosis BIOSHARES JULY 2017 Sam Cobb, CEO and Managing Director AdAlta Limited (ASX:1AD) s.cobb@adalta.com.au Disclaimer Investment in AdAlta is subject

More information

Connective Tissue Response in IBD

Connective Tissue Response in IBD Connective Tissue Response in IBD Dr I C Lawrance MB BS, PhD FRACP School of Medicine and Pharmacology, University of Western Australia, Fremantle Hospital Intestinal response to Chronic Inflammation Control

More information

Favorable human safety, pharmacokinetics and pharmacodynamics of the autotaxin inhibitor GLPG1690, a potential new treatment in COPD

Favorable human safety, pharmacokinetics and pharmacodynamics of the autotaxin inhibitor GLPG1690, a potential new treatment in COPD Favorable human safety, pharmacokinetics and pharmacodynamics of the autotaxin inhibitor GLPG1690, a potential new treatment in COPD Ellen M. van der Aar, PhD Galapagos, Mechelen, Belgium L. Fagard, J.

More information

Hirsutella sinensis mycelium attenuates bleomycininduced pulmonary inflammation and fibrosis in vivo

Hirsutella sinensis mycelium attenuates bleomycininduced pulmonary inflammation and fibrosis in vivo University of the Pacific Scholarly Commons Dugoni School of Dentistry Faculty Articles Arthur A. Dugoni School of Dentistry 10-26-2015 Hirsutella sinensis mycelium attenuates bleomycininduced pulmonary

More information

THE RETICULAR NETWORK CONTRIBUTES TO THE STAGING OF IDIOPATHIC LUNG FIBROSIS

THE RETICULAR NETWORK CONTRIBUTES TO THE STAGING OF IDIOPATHIC LUNG FIBROSIS Arch. Biol. Sci., Belgrade, 65 (4), 1599-1604, 2013 DOI:10.2298/ABS1304599D THE RETICULAR NETWORK CONTRIBUTES TO THE STAGING OF IDIOPATHIC LUNG FIBROSIS IRINA STOIA DJESKA 1, RALUCA AMALIA CEAUSU 2, PUSA

More information

Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice

Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice X.X. Li 1,2, D.Y. Jiang 1, X.X. Huang 1, S.L. Guo 1, W. Yuan 1 and H.P. Dai 1 1 Beijing Key Laboratory of Respiratory and

More information

Lung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy

Lung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy 7th to 10th Nov. 2016 Minatec-Grenoble, France. Lung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy Balasubramanayam Annangi bala.annangi@inserm.fr 10 th

More information

Programa Cooperación Farma-Biotech Jornada : Zaragoza. Efficacy of P17, a TGFbeta1 inhibitor peptide, in lung fibrosis and melanoma

Programa Cooperación Farma-Biotech Jornada : Zaragoza. Efficacy of P17, a TGFbeta1 inhibitor peptide, in lung fibrosis and melanoma Programa Cooperación Farma-Biotech Jornada 2-2012: Zaragoza Efficacy of P17, a TGFbeta1 inhibitor peptide, in lung fibrosis and melanoma Zaragoza, 6 de junio de 2012 Programa Cooperación Farma-Biotech

More information

Hsp90 regulation of fibroblast activation in pulmonary fibrosis

Hsp90 regulation of fibroblast activation in pulmonary fibrosis Downloaded from http:// on January 22, 2018. Hsp90 regulation of fibroblast activation in pulmonary fibrosis Vishwaraj Sontake, 1,4 Yunguan Wang, 2 Rajesh K. Kasam, 1,4 Debora Sinner, 3 Geereddy B. Reddy,

More information

Restrictive lung diseases

Restrictive lung diseases Restrictive lung diseases Restrictive lung diseases are diseases that affect the interstitium of the lung. Interstitium of the lung is the very thin walls surrounding the alveoli, it s formed of epithelium

More information

Phenotype of regenerative epithelium in idiopathic interstitial pneumonias

Phenotype of regenerative epithelium in idiopathic interstitial pneumonias J Med Dent Sci 2003; 50: 213 224 Original Article Phenotype of regenerative epithelium in idiopathic interstitial pneumonias Nae Hinata 1,2, Tamiko Takemura 2, Soichiro Ikushima 3, Takashi Yanagawa 3,

More information

Fibrosis, the dysregulated deposition of

Fibrosis, the dysregulated deposition of Eur Respir Rev 2011; 20: 120, 85 97 DOI: 10.1183/09059180.00001111 CopyrightßERS 2011 REVIEW Antifibrotic activities of pirfenidone in animal models C.J. Schaefer, D.W. Ruhrmund, L. Pan, S.D. Seiwert and

More information

Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S100A9

Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S100A9 Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S1A9 Joanna Nikitorowicz-Buniak UCL Division of Medicine Systemic sclerosis

More information

Virginia A. Folcik, Ph.D. and Gerard J. Nuovo, M.D. The Ohio State University at Marion, and Phylogeny, Inc.

Virginia A. Folcik, Ph.D. and Gerard J. Nuovo, M.D. The Ohio State University at Marion, and Phylogeny, Inc. As close as you can get to finding the cause of disease with Agent-Based Modeling Virginia A. Folcik, Ph.D. and Gerard J. Nuovo, M.D. The Ohio State University at Marion, and Phylogeny, Inc. Koch s Postulates

More information

Non-neoplastic Lung Disease II

Non-neoplastic Lung Disease II Pathobasic Non-neoplastic Lung Disease II Spasenija Savic Prince Pathology Program Systematic approach to surgical lung biopsies with ILD Examples (chronic ILD): Idiopathic interstitial pneumonias: UIP,

More information

Connective Tissue Disorder- Associated Interstitial Lung Disease (CTD-ILD) and Updates

Connective Tissue Disorder- Associated Interstitial Lung Disease (CTD-ILD) and Updates Connective Tissue Disorder- Associated Interstitial Lung Disease (CTD-ILD) and Updates Maria Elena Vega, M.D Assistant Professor of Medicine Lewis Katz School of Medicine at Temple University Nothing to

More information

Regenerative Medicine for Sclerotic Disorders

Regenerative Medicine for Sclerotic Disorders Regenerative Medicine Regenerative Medicine for Sclerotic Disorders JMAJ 7(7): 3 37, Toshikazu NAKAMURA rofessor, Division of Molecular Regenerative Medicine, Course of Advanced Medicine, Osaka University

More information

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3

More information

A translational preclinical model of interstitial pulmonary fibrosis and pulmonary hypertension: mechanistic pathways driving disease pathophysiology

A translational preclinical model of interstitial pulmonary fibrosis and pulmonary hypertension: mechanistic pathways driving disease pathophysiology ORIGINAL RESEARCH Physiological Reports ISSN 2051-817X A translational preclinical model of interstitial pulmonary fibrosis and pulmonary hypertension: mechanistic pathways driving disease pathophysiology

More information

Animal Models of Scarring: The Rabbit Ear Model and its Translational Relevance. Thomas A. Mustoe Northwestern University Chicago,IL USA

Animal Models of Scarring: The Rabbit Ear Model and its Translational Relevance. Thomas A. Mustoe Northwestern University Chicago,IL USA Animal Models of Scarring: The Rabbit Ear Model and its Translational Relevance Thomas A. Mustoe Northwestern University Chicago,IL USA Important Regulators of Scarring Genetics (racial characteristics,

More information

The lysophosphatidic acid receptor LPA 1 links pulmonary fibrosis to lung injury by mediating fibroblast recruitment and vascular leak

The lysophosphatidic acid receptor LPA 1 links pulmonary fibrosis to lung injury by mediating fibroblast recruitment and vascular leak 8 Nature Publishing Group http://www.nature.com/naturemedicine The lysophosphatidic acid receptor LPA links pulmonary fibrosis to lung injury by mediating fibroblast recruitment and vascular leak Andrew

More information

The Function of SPARC as a Mediator of Fibrosis

The Function of SPARC as a Mediator of Fibrosis 146 The Open Rheumatology Journal, 2012, 6, (Suppl 1: M11) 146-155 The Function of SPARC as a Mediator of Fibrosis Jessica Trombetta-eSilva 1,2 and Amy D. Bradshaw *,2,3 Open Access 1 Department of Craniofacial

More information

CD4 T lymphocytes in lung fibrosis: diverse subsets, diverse functions

CD4 T lymphocytes in lung fibrosis: diverse subsets, diverse functions Review CD4 T lymphocytes in lung fibrosis: diverse subsets, diverse functions Sandra Lo Re, Dominique Lison, and François Huaux 1 Louvain Centre for Toxicology and Applied Pharmacology, Institut de Recherche

More information

Postnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter

Postnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter Postnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter Comparative Biosciences, Inc 786 Lucerne Drive Sunnyvale,

More information

Histopathologic Approach to Interstitial Lung Disease

Histopathologic Approach to Interstitial Lung Disease Histopathologic Approach to Interstitial Lung Disease Kirk D. Jones, MD UCSF Dept of Pathology kirk.jones@ucsf.edu Disclosures I have nothing to disclose 1 Why? Much of interstitial lung disease biopsies

More information

This article is protected by copyright. All rights reserved.

This article is protected by copyright. All rights reserved. Coates edited INVITED COMMENTARY Fibroblast Growth Factors and Pulmonary Fibrosis: It s more complex than it sounds Running Title: Pleiotropic actions of FGFs in lung fibrosis Authors: Kevin K. Kim*, Thomas

More information

Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B)

Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) PCR identified expected hhb-egf band (left panel) and HA tag band (right) in kidneys of transgenic (TG) mice

More information

Supplemental Table 1. Primer sequences for transcript analysis

Supplemental Table 1. Primer sequences for transcript analysis Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC

More information

Tissue repair. (3&4 of 4)

Tissue repair. (3&4 of 4) Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid

More information

Histopathology: Vascular pathology

Histopathology: Vascular pathology Histopathology: Vascular pathology These presentations are to help you identify basic histopathological features. They do not contain the additional factual information that you need to learn about these

More information

Disclosures. Traditional Paradigm. Overview 4/17/2010. I have relationships with the following organizations and companies:

Disclosures. Traditional Paradigm. Overview 4/17/2010. I have relationships with the following organizations and companies: Disclosures Pharmacological Therapy for ILD What to Use and How to Use It Harold R Collard MD Interstitial Lung Disease Program University of California San Francisco (UCSF) I have relationships with the

More information

Supplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function

Supplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function Supplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function Guoying Yu 1*, Argyris Tzouvelekis 1,2*, Rong Wang 1,3, Jose D. Herazo-Maya

More information

Dynamic changes of found in inflammatory zone 1 protein and mrna expression in the lung with experimental pulmonary fibrosis of the rat

Dynamic changes of found in inflammatory zone 1 protein and mrna expression in the lung with experimental pulmonary fibrosis of the rat Acta Physiologica Sinica, August 25, 2005, 57 (4): 493-497 http://www.actaps.com.cn 493 FIZZ1 mrna 1 2, * 1 1 1 430022 2 430030 FIZZ1 (found in inflammatory zone 1) (5 mg/kg ) HE Masson FIZZ1 mrna (1)

More information

REVIEW ARTICLE. A review of current and novel therapies for idiopathic pulmonary fibrosis

REVIEW ARTICLE. A review of current and novel therapies for idiopathic pulmonary fibrosis REVIEW ARTICLE A review of current and novel therapies for idiopathic pulmonary fibrosis Rokhsara Rafii 1, Maya M. Juarez 2, Timothy E. Albertson 1, Andrew L. Chan 1 1 Division of Pulmonary, Critical Care,

More information

Bleomycin induces pleural and subpleural fibrosis in the presence of carbon particles

Bleomycin induces pleural and subpleural fibrosis in the presence of carbon particles Eur Respir J 21; 35: 176 185 DOI: 1.1183/931936.18188 CopyrightßERS Journals Ltd 21 Bleomycin induces pleural and subpleural fibrosis in the presence of carbon particles N. Decologne*,+, G. Wettstein*,+,

More information

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and

More information

Management of Idiopathic Pulmonary Fibrosis

Management of Idiopathic Pulmonary Fibrosis Management of Idiopathic Pulmonary Fibrosis Robert Hallowell, M.D. December 22, 2015 Disclosures No financial disclosures What causes IPF? +? VEGF-R Airspace lining TNFa Fibrocytes PDGF Fibroblasts IL-1

More information

Usual Interstitial pneumonia and Nonspecific Interstitial Pneumonia. Nitra and the Gangs.

Usual Interstitial pneumonia and Nonspecific Interstitial Pneumonia. Nitra and the Gangs. Usual Interstitial pneumonia and Nonspecific Interstitial Pneumonia Nitra and the Gangs. บทน ำและบทท ๓, ๑๐, ๑๒, ๑๓, ๑๔, ๑๕, ๑๗ Usual Interstitial Pneumonia (UIP) Most common & basic pathologic pattern

More information

VICORE PHARMA AB. A Rare Disease Company with a Focus on Patients with Fibrotic Lung Disease

VICORE PHARMA AB. A Rare Disease Company with a Focus on Patients with Fibrotic Lung Disease VICORE PHARMA AB A Rare Disease Company with a Focus on Patients with Fibrotic Lung Disease 1 FORWARD LOOKING STATEMENT This presentation may contain certain forward-looking statements and forecasts based

More information

Lysyl oxidase promotes bleomycin-induced lung fibrosis through modulating inflammation

Lysyl oxidase promotes bleomycin-induced lung fibrosis through modulating inflammation 506 Journal of Molecular Cell Biology (2014), 6(6), 506 515 doi:10.1093/jmcb/mju039 Published online October 26, 2014 Article Lysyl oxidase promotes bleomycin-induced lung fibrosis through modulating inflammation

More information

Pathology Seminar Series April 24, 2012 Stephanie Schutte, MD

Pathology Seminar Series April 24, 2012 Stephanie Schutte, MD Pathology Seminar Series April 24, 2012 Stephanie Schutte, MD Etiology and Pathogenesis Epidemiology Clinical features Risk factors Radiologic features Radiologic progression IPF Acute exacerbation Gross

More information

FoxO3 an important player in fibrogenesis and therapeutic target for idiopathic pulmonary fibrosis

FoxO3 an important player in fibrogenesis and therapeutic target for idiopathic pulmonary fibrosis Research Article FoxO3 an important player in fibrogenesis and therapeutic target for idiopathic pulmonary fibrosis Hamza M Al-Tamari 1, Swati Dabral 1,, Anja Schmall 1,, Pouya Sarvari 1, Clemens Ruppert

More information

PNEUMOLOGIA 2018 Milano, giugno 2018 INTERSTIZIOPATIE E MALATTIE RARE. Il futuro dell IPF: dove stiamo andando. Carlo Albera

PNEUMOLOGIA 2018 Milano, giugno 2018 INTERSTIZIOPATIE E MALATTIE RARE. Il futuro dell IPF: dove stiamo andando. Carlo Albera PNEUMOLOGIA 2018 Milano, 14 16 giugno 2018 INTERSTIZIOPATIE E MALATTIE RARE Il futuro dell : dove stiamo andando Carlo Albera Università di Torino, Scuola di Medicina Dipartimento di Scienze Cliniche e

More information

NINTEDANIB MEDIA BACKGROUNDER

NINTEDANIB MEDIA BACKGROUNDER NINTEDANIB MEDIA BACKGROUNDER 1. What is nintedanib? 2. How does nintedanib work? 3. Data overview 4. International treatment guidelines for IPF 1. What is nintedanib? Nintedanib (OFEV a ) is a small molecule

More information

Lymphoid System: cells of the immune system. Answer Sheet

Lymphoid System: cells of the immune system. Answer Sheet Lymphoid System: cells of the immune system Answer Sheet Q1 Which areas of the lymph node have most CD3 staining? A1 Most CD3 staining is present in the paracortex (T cell areas). This is towards the outside

More information

The Preventive Effect of Atorvastatin on Paraquat-Induced Pulmonary Fibrosis in the Rats

The Preventive Effect of Atorvastatin on Paraquat-Induced Pulmonary Fibrosis in the Rats Advanced Pharmaceutical Bulletin Adv Pharm Bull, 2014, 4(x), x-x doi: 10.5681/apb.2014.050 http://apb.tbzmed.ac.ir Research Article The Preventive Effect of Atorvastatin on Paraquat-Induced Pulmonary Fibrosis

More information

Inflammation in heart failure: biomarker, bystander or mediator

Inflammation in heart failure: biomarker, bystander or mediator Inflammation in heart failure: biomarker, bystander or mediator Novel matricellular proteins to target Javier Díez, MD, PhD. Centre of Applied Medical Research and University Clinic School of Medicine,

More information

Fibrocytes in pulmonary fibrosis: a brief synopsis

Fibrocytes in pulmonary fibrosis: a brief synopsis MINI-REVIEW PULMONARY FIBROSIS Fibrocytes in pulmonary fibrosis: a brief synopsis Shyam Maharaj 1, Chiko Shimbori 1,2 and Martin Kolb 1 Affiliations: 1 Firestone Institute for Respiratory Health, Depts

More information

The Use of RNA Interference to Mitigate Pulmonary Fibrosis in Response to Asbestos Exposure

The Use of RNA Interference to Mitigate Pulmonary Fibrosis in Response to Asbestos Exposure University of Montana ScholarWorks at University of Montana Undergraduate Theses and Professional Papers 2015 The Use of RNA Interference to Mitigate Pulmonary Fibrosis in Response to Asbestos Exposure

More information

Case 4 History. 58 yo man presented with prox IP joint swelling 2 months later pain and swelling in multiple joints Chest radiograph: bi-basilar

Case 4 History. 58 yo man presented with prox IP joint swelling 2 months later pain and swelling in multiple joints Chest radiograph: bi-basilar Case 4 History 58 yo man presented with prox IP joint swelling 2 months later pain and swelling in multiple joints Chest radiograph: bi-basilar basilar infiltrates suggestive of pulmonary fibrosis Open

More information

Tissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science

Tissue renewal and Repair. Nisamanee Charoenchon, PhD   Department of Pathobiology, Faculty of Science Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration

More information

GANI ORUQAJ INAUGURAL DISSERTATION

GANI ORUQAJ INAUGURAL DISSERTATION ROLE OF PEROXISOMES IN IDIOP. PULMONARY FIBROSIS VVB VVB LAUFERSWEILER VERLAG STAUFENBERGRING 15 D-35396 GIESSEN Tel: 0641-5599888 Fax: -5599890 redaktion@doktorverlag.de www.doktorverlag.de ISBN: 978-3-8359-6349-8

More information

UNIVERSITY OF CALGARY. The Role of Neutrophil MMP-9 in the Development of Fibrosis in Hypersensitivity Pneumonitis. Abrar Mohammad Alansary A THESIS

UNIVERSITY OF CALGARY. The Role of Neutrophil MMP-9 in the Development of Fibrosis in Hypersensitivity Pneumonitis. Abrar Mohammad Alansary A THESIS UNIVERSITY OF CALGARY The Role of Neutrophil MMP-9 in the Development of Fibrosis in Hypersensitivity Pneumonitis by Abrar Mohammad Alansary A THESIS SUBMITED TO THE FACULTY OF GRADUATE STUDIES IN PARTICULAR

More information

Mass Histology Service

Mass Histology Service Mass Histology Service A complete anatomical pathology laboratory www.masshistology.com Telephone: (877) 286-6004 Report on Pathology A Time Course Study of the Local Effects of Intramuscular XXXXXXX Injection

More information

DNA Microarray Analysis of the Epithelial Mesenchymal Transition of Mesothelial Cells in a Rat Model of Peritoneal Dialysis

DNA Microarray Analysis of the Epithelial Mesenchymal Transition of Mesothelial Cells in a Rat Model of Peritoneal Dialysis Advances in Peritoneal Dialysis, Vol. 27, 2011 Toshimi Imai, Ichiro Hirahara, Yoshiyuki Morishita, Akira Onishi, Makoto Inoue, Shigeaki Muto, Eiji Kusano DNA Microarray Analysis of the Epithelial Mesenchymal

More information

HYPERSENSITIVITY PNEUMONITIS

HYPERSENSITIVITY PNEUMONITIS HYPERSENSITIVITY PNEUMONITIS A preventable fibrosis MOSAVIR ANSARIE MB., FCCP INTERSTITIAL LUNG DISEASES A heterogeneous group of non infectious, non malignant diffuse parenchymal disorders of the lower

More information

Biomarkers in ILDs Are they useful?

Biomarkers in ILDs Are they useful? Biomarkers in ILDs Are they useful? Bruno Crestani Hôpital Bichat, Université Paris Diderot, Paris, France www.dhufire.org Conflicts of interest Research Boehringer Ingelheim CARDIF Intermune, Inc LVL

More information

PATHOPHYSIOLOGY. DEFINED Involves the study of function that results from disease processes.

PATHOPHYSIOLOGY. DEFINED Involves the study of function that results from disease processes. DEFINED Involves the study of function that results from disease processes. What is pathology? Pathology is the branch of medical sciences that treats the essential nature of disease, especially the changes

More information

Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals

Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Stem cells move to injured area, differentiate into neighboring cells, and replace the damaged cells Cell Eons Stem cells

More information

Dioscin Exerts Protective Effects Against Crystalline Silica-induced Pulmonary Fibrosis in Mice

Dioscin Exerts Protective Effects Against Crystalline Silica-induced Pulmonary Fibrosis in Mice Ivyspring International Publisher 4255 Theranostics Research Paper 2017; 7(17): 4255-4275. doi: 10.7150/thno.20270 Dioscin Exerts Protective Effects Against Crystalline Silica-induced Pulmonary Fibrosis

More information

NONE OVERVIEW FINANCIAL DISCLOSURES UPDATE ON IDIOPATHIC PULMONARY FIBROSIS/IPF (UIP) FOR PATHOLOGISTS. IPF = Idiopathic UIP Radiologic UIP Path UIP

NONE OVERVIEW FINANCIAL DISCLOSURES UPDATE ON IDIOPATHIC PULMONARY FIBROSIS/IPF (UIP) FOR PATHOLOGISTS. IPF = Idiopathic UIP Radiologic UIP Path UIP UPDATE ON IDIOPATHIC PULMONARY FIBROSIS/IPF () FOR PATHOLOGISTS Thomas V. Colby, M.D. Professor of Pathology (Emeritus) Mayo Clinic Arizona FINANCIAL DISCLOSURES NONE OVERVIEW IPF Radiologic Dx Pathologic

More information

Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model

Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model Averi Leahy, Andrea Foote, Tomoya Uchimura, Li Zeng, PhD. Tufts University, Boston, MA, USA. Disclosures: A. Leahy: None.

More information

Translating New Immune Pathways into Meaningful Medicines

Translating New Immune Pathways into Meaningful Medicines Translating New Immune Pathways into Meaningful Medicines Cantor Fitzgerald 2018 Global Healthcare Conference Sanjay S. Shukla, M.D., M.S., President & CEO October 2, 2018 Forward-Looking Statements The

More information

Role of Inflammation in Pulmonary Hypertension

Role of Inflammation in Pulmonary Hypertension Role of Inflammation in Pulmonary Hypertension K. R. Stenmark University of Colorado Denver, USA Prominent Fibroproliferative Changes are Observed in the Lung Vasculature of Infants With Pulmonary Arterial

More information

Sosei Group Corporation

Sosei Group Corporation Sosei Group Corporation Shinichi Tamura President and CEO www.sosei.com Sosei History - Background Incorporated in Japan in 1990 and traded initially as a technology transfer company In 1999 switched to

More information

Attenuation of lung fibrosis in mice with a clinically relevant inhibitor of glutathione-stransferase

Attenuation of lung fibrosis in mice with a clinically relevant inhibitor of glutathione-stransferase University of Dundee Attenuation of lung fibrosis in mice with a clinically relevant inhibitor of glutathione-stransferase McMillan, David H.; van der Velden, Jos L. J.; Lahue, Karolyn G.; Quan, Xi; Schneider,

More information

Supplemental Data. Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in. Hermansky-Pudlak Syndrome

Supplemental Data. Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in. Hermansky-Pudlak Syndrome Page 1 Supplemental Data Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in Hermansky-Pudlak Syndrome Lisa R. Young, Peter M. Gulleman, Chelsi W. Short, Harikrishna Tanjore,

More information

TITLE: Genes Associated with Food Allergy and Eosinophilic Esophagitis

TITLE: Genes Associated with Food Allergy and Eosinophilic Esophagitis AD Award Number: W81XWH-1-1-75 TITLE: Genes Associated with Food Allergy and Eosinophilic Esophagitis PRINCIPAL INVESTIGATOR: Dr. David Broide CONTRACTING ORGANIZATION: University of California, San Diego

More information

SESSION IV: MECHANISMS OF HUMAN DISEASE: LABORATORY SESSIONS PULMONARY PATHOLOGY I. December 5, 2012

SESSION IV: MECHANISMS OF HUMAN DISEASE: LABORATORY SESSIONS PULMONARY PATHOLOGY I. December 5, 2012 SESSION IV: MECHANISMS OF HUMAN DISEASE: LABORATORY SESSIONS PULMONARY PATHOLOGY I December 5, 2012 FACULTY COPY GOAL: Describe the basic morphologic and pathophysiologic changes in various conditions

More information

11/10/2014. Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective. Radiology

11/10/2014. Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective. Radiology Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective Radiology Pathology Clinical 1 Role of HRCT Diagnosis Fibrosis vs. inflammation Next step in management Response to treatment

More information

c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.

c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p. a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8

More information

DISEASES OF THE RESPIRATORY SYSTEM LECTURE 5 DR HEYAM AWAD FRCPATH

DISEASES OF THE RESPIRATORY SYSTEM LECTURE 5 DR HEYAM AWAD FRCPATH DISEASES OF THE RESPIRATORY SYSTEM LECTURE 5 DR HEYAM AWAD FRCPATH RESTRICTIVE, INTERSTITIAL LUNG DISESAES. FIROSING DISESES. GRANULOMATOUS DISEASES. EOSINOPHILIC. SMOKING RELATED. FIBROSING DISEASES

More information

Research Article The Protective Effect of Naringin against Bleomycin-Induced Pulmonary Fibrosis in Wistar Rats

Research Article The Protective Effect of Naringin against Bleomycin-Induced Pulmonary Fibrosis in Wistar Rats Pulmonary Medicine Volume 2016, Article ID 7601393, 12 pages http://dx.doi.org/10.1155/2016/7601393 Research Article The Protective Effect of Naringin against Bleomycin-Induced Pulmonary Fibrosis in Wistar

More information

vi Preface Table 2 Association of Fibrosis With Types of Injury: Representative Examples

vi Preface Table 2 Association of Fibrosis With Types of Injury: Representative Examples Fibrosis or scar, defined pathologically as inappropriate repair by connective tissue, is increasingly recognized as an important feature of many chronic diseases (Table 1), and as such, represents an

More information

Evaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel

Evaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel 12th symposium of the Association of Korean Dermatologists (2009) 1 Evaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel Un-Cheol.Yeo, M.D. S&U Dermatologic Clinic,

More information

Hypoxia-preconditioned mesenchymal stem cells attenuate bleomycin-induced pulmonary fibrosis

Hypoxia-preconditioned mesenchymal stem cells attenuate bleomycin-induced pulmonary fibrosis Lan et al. Stem Cell Research & Therapy (2015) 6:97 DOI 10.1186/s13287-015-0081-6 RESEARCH Open Access Hypoxia-preconditioned mesenchymal stem cells attenuate bleomycin-induced pulmonary fibrosis Ying-Wei

More information

Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis

Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis Hong Xia,, Peter B. Bitterman, Craig A. Henke J Clin Invest. 2017;127(7):2586-2597. https://doi.org/10.1172/jci90832.

More information

Pirfenidone attenuates bleomycin-induced pulmonary fibrosis in mice by regulating Nrf2/Bach1 equilibrium

Pirfenidone attenuates bleomycin-induced pulmonary fibrosis in mice by regulating Nrf2/Bach1 equilibrium Liu et al. BMC Pulmonary Medicine (2017) 17:63 DOI 10.1186/s12890-017-0405-7 RESEARCH ARTICLE Open Access Pirfenidone attenuates bleomycin-induced pulmonary fibrosis in mice by regulating Nrf2/Bach1 equilibrium

More information

Prof. Sandrine Florquin Department of Pathology Academic Medical Center University of Amsterdam Amsterdam, The Netherlands. Slide 1.

Prof. Sandrine Florquin Department of Pathology Academic Medical Center University of Amsterdam Amsterdam, The Netherlands. Slide 1. Interleukin 17 in renal biopsies as risk factor for progression Sandrine Florquin, Amsterdam, The Netherlands Chairs: Mohamed R. Daha, Leiden, The Netherlands Pierre Ronco, Paris, France Prof. Sandrine

More information

Potential novel targets: Protease-activated receptors in idiopathic pulmonary fibrosis Lin, Cong

Potential novel targets: Protease-activated receptors in idiopathic pulmonary fibrosis Lin, Cong UvA-DARE (Digital Academic Repository) Potential novel targets: Protease-activated receptors in idiopathic pulmonary fibrosis Lin, Cong Link to publication Citation for published version (APA): Lin, C.

More information

Cardiac myosin-th17 responses promote heart failure in human myocarditis

Cardiac myosin-th17 responses promote heart failure in human myocarditis Cardiac myosin-th17 responses promote heart failure in human myocarditis Jennifer M. Myers,, Carol J. Cox, Madeleine W. Cunningham JCI Insight. 2016;1(9):e85851. https://doi.org/10.1172/jci.insight.85851.

More information

Limitations of Corticosteroids and Cytotoxic Agents in Treating Idiopathic Pulmonary Fibrosis

Limitations of Corticosteroids and Cytotoxic Agents in Treating Idiopathic Pulmonary Fibrosis Idiopathic Pulmonary Fibrosis Limitations of Corticosteroids and Cytotoxic Agents in Treating Idiopathic Pulmonary Fibrosis JMAJ 46(11): 475 482, 2003 Kingo CHIDA Associate Professor, Second Division,

More information

Fasudil, a Rho-Kinase Inhibitor, Attenuates Bleomycin-Induced Pulmonary Fibrosis in Mice

Fasudil, a Rho-Kinase Inhibitor, Attenuates Bleomycin-Induced Pulmonary Fibrosis in Mice Int. J. Mol. Sci. 2012, 13, 8293-8307; doi:10.3390/ijms13078293 Article OPEN ACCESS International Journal of Molecular Sciences ISSN 1422-0067 www.mdpi.com/journal/ijms Fasudil, a Rho-Kinase Inhibitor,

More information

Perspectives ILD Diagnosis and Treatment in 5-10 years

Perspectives ILD Diagnosis and Treatment in 5-10 years Perspectives ILD Diagnosis and Treatment in 5-10 years Brett Ley, MD Department of Medicine The (Near) Future of ILD Diagnosis and Treatment 1. Combination therapy for Idiopathic Pulmonary Fibrosis 2.

More information

Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress

Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress 3/1/212 Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies K.R. Stenmark University of Colorado Denver, CO 845 Prominent Fibroproliferative

More information