Génétique des DCP. Deciphering the molecular bases of ciliopathies. Estelle Escudier, INSERM U 681 Serge Amselem, INSERM U 654

Size: px
Start display at page:

Download "Génétique des DCP. Deciphering the molecular bases of ciliopathies. Estelle Escudier, INSERM U 681 Serge Amselem, INSERM U 654"

Transcription

1 Génétique des DCP Estelle Escudier, INSERM U 681 Serge Amselem, INSERM U 654 Deciphering the molecular bases of ciliopathies Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics

2 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics Candidate gene approach based on Chlamydomonas mutants Normal strains (adapted from Witman, 1992) Immotile strains 9 and 6 mutants (IC78, IC69)

3 Isolation of human sequences orthologous to IC78 and IC69 Primers Chlamydomonas IC78 See urchin IC2 conserved regions Template = total RNA from human adult tissues: testis and trachea RT-PCR / Cloning / Sequencing Tissue expression of and DNAI2 estomac thyroïde moelle épinière ganglion lymphatique trachée glande surrénale moelle osseuse rate thymus prostate testicule uterus intestin grèle colon leucocytes estomac thyroïde moelle épinière ganglion lymphatique trachée glande surrénale moelle osseuse rate thymus prostate testicule uterus intestin grèle colon leucocytes 2.5 kb 2.4 kb DNAI2 expression restricted to trachea eand testis Pennarun et al. Am J Hum Genet 1999

4 Chromosomal localization of and DNAI p p p p q q 25 q Chromosome 9 Chromosome exons 53 kb DNAI2 14 exons 39 kb Pennarun et al. Am J Hum Genet 1999 mutation spectrum in PCD/KS W568S 1 G515S 699 ATG nt 1 WD1 WD2 WD3 WD4 WD TGA nt insT insAATA (fsh118x) W436X del W568X G>A Pennarun et al. Am J Hum Genet 1999 Guichard et al. Am J Hum Genet 2001 Zariwala et al. Am J Respir Cell Mol Biol 2001

5 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics Involvement of DNH5 in PCD/KS (absence of ) Linkage analysis (Homozygosity mapping) 5p14-14 (null mutations) Patient Control Omran et al. Am J Respir Cell Mol Biol 2000 Chung et al. Nature Genet 2002

6 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics RPGR IFT Moore et al. J Med Genet 2006 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics R2852X F508 R2852X R2852X F DNAH11 Normal EM SI F508 Bartoloni et al. PNAS 2002 RPGR IFT

7 Thioredoxins and Nucleoside diphosphokinases NDK family Group I NDK Enzymatic activity + Group II NDK enzymatic activity? mainly expressed in the testis (except NME6) NDK domain of IC1 TRX TXNDC3 () TXNDC6 NDK TRX domain NDPK domain1 NDPK domain2 TXNDC TXNDC3 gene defects Duriez et al PNAS 2007

8 TXNDC3 gene defects and related products Duriez et al PNAS 2007 Expression of the TXNDC3fl and TXNDC3d7 isoforms Duriez et al PNAS 2007

9 Impact of the c c>t variant on splicing of TXNDC3 transcripts Duriez et al PNAS 2007 Conservation of TXNDC3 and TXNDC3 exon7 throughout evolution Human Chimpanzee Dog Cow Mouse Rat Chicken Frog Pufferfish Tetraodon Sea urchin Ciona Overall identity 100% 97% 67% 67% 63% 61% 46% 38% 40% 39% 38% 34% A Conservation of the human regions encoded by TXNDC3 exon 7 and TXNDC6 exon 5 TXNDC3 E7 NGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQ TXNDC6 E5 GGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKV B Phylogenetic conservation of the region encoded by TXNDC3 exon 7 Human NGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQ Chimpanzee NGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQ Dog NGKIIARINGANAPLVNKKITNLINEEKKIAAGEMVRPQ Cow NGTIVAKIQGANAPLVNQKIIALVNEERKIAAGEMVRPQ Mouse NGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQ Rat NGKIIAKIQGANAPLINRKVIALIDEEKKIAAGEMARPQ Chicken NGKIIAIVRGANAPLLSKKITELVQEEREILAGQKERPE Frog GGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHV Pufferfish GGELVGVLRGANAPLLQRMIVQKLGEEKMVLEKGVERKV Tetraodon GGELVGVLRGANAPLLQKMIVQKLSEEKMVLEKGGERKV Zebrafish GGELVSVLRGPNAPLLQKTIQEELSNEKNVLEHGGARRA Ciona GGELVAAVRGCNAPLVQETIQETLKNEHKILSGEMERKV Duriez et al PNAS 2007

10 Comparison of the binding of of TXNDC3fl and TXNDC3d7 to microtubules Duriez et al PNAS 2007 Molecular bases of PCD? Linkage analyses Candidate gene approaches Comparative genomics Chromosome abnormalities R2852X F508 R2852X R2852X F DNAH11 Normal EM F508 RPGR IFT TXNDC3 + SA

11 Ciliary defects in PCD n=273 10% 17% 29% 15% 8% 21% alone both DA IDA? IDA alone CC Kartagener with normal cilia Gene identification in PCD n=273 10% 10% 53% 17% 29% 15% 8% 21% alone both DA IDA? IDA alone CC Kartagener with normal cilia

12 Gene identification in PCD n=273 genes? alone both DA IDA? IDA alone CC Kartagener with normal cilia

Ciliary defects and genetics of primary ciliary dyskinesia.

Ciliary defects and genetics of primary ciliary dyskinesia. Ciliary defects and genetics of primary ciliary dyskinesia. Estelle Escudier, Philippe Duquesnoy, Jean-François Papon, Serge Amselem To cite this version: Estelle Escudier, Philippe Duquesnoy, Jean-François

More information

Identification of predicted human outer dynein arm genes- candidates for primary ciliary dyskinesia genes

Identification of predicted human outer dynein arm genes- candidates for primary ciliary dyskinesia genes JMG Online First, published on June 3, 2005 as 10.1136/jmg.2005.033001 Identification of predicted human outer dynein arm genes- candidates for primary ciliary dyskinesia genes Gregory J. Pazour 1, Nathan

More information

A 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia

A 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia Eur Respir J 2010; 35: 1057 1063 DOI: 10.1183/09031936.00046209 CopyrightßERS Journals Ltd 2010 A 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia J.F. Papon*,#,",+,1,

More information

The coiled-coil domain containing protein CCDC40 is essential for motile cilia function and left-right axis formation

The coiled-coil domain containing protein CCDC40 is essential for motile cilia function and left-right axis formation The coiled-coil domain containing protein CCDC40 is essential for motile cilia function and left-right axis formation Anita Becker-Heck#, Irene Zohn#, Noriko Okabe#, Andrew Pollock#, Kari Baker Lenhart,

More information

Mislocalization of DNAH5 and DNAH9 in Respiratory Cells from Patients with Primary Ciliary Dyskinesia

Mislocalization of DNAH5 and DNAH9 in Respiratory Cells from Patients with Primary Ciliary Dyskinesia Mislocalization of DNAH5 and DNAH9 in Respiratory Cells from Patients with Primary Ciliary Dyskinesia Manfred Fliegauf, Heike Olbrich, Judit Horvath, Johannes H. Wildhaber, Maimoona A. Zariwala, Marcus

More information

Primary Ciliary Dyskinesia Pathogenesis, diagnosis and treatment DR CLAIRE HOGG DEPT. RESPIRATORY PAEDIATRICS ROYAL BROMPTON HOSPITAL LONDON.

Primary Ciliary Dyskinesia Pathogenesis, diagnosis and treatment DR CLAIRE HOGG DEPT. RESPIRATORY PAEDIATRICS ROYAL BROMPTON HOSPITAL LONDON. Primary Ciliary Dyskinesia Pathogenesis, diagnosis and treatment DR CLAIRE HOGG DEPT. RESPIRATORY PAEDIATRICS ROYAL BROMPTON HOSPITAL LONDON. Pathogenesis of PCD Autosomal recessive Heterogeneous Defect

More information

Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.

Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T

More information

ARTICLE DNAI2 Mutations Cause Primary Ciliary Dyskinesia with Defects in the Outer Dynein Arm

ARTICLE DNAI2 Mutations Cause Primary Ciliary Dyskinesia with Defects in the Outer Dynein Arm ARTICLE DNAI2 Mutations Cause Primary Ciliary Dyskinesia with Defects in the Outer Dynein Arm Niki Tomas Loges, 1,2 Heike Olbrich, 1 Lale Fenske, 1 Huda Mussaffi, 3 Judit Horvath, 4 Manfred Fliegauf, 1

More information

Homozygosity Mapping of a Gene Locus for Primary Ciliary Dyskinesia on Chromosome 5p and Identification of the Heavy Dynein Chain DNAH5

Homozygosity Mapping of a Gene Locus for Primary Ciliary Dyskinesia on Chromosome 5p and Identification of the Heavy Dynein Chain DNAH5 Homozygosity Mapping of a Gene Locus for Primary Ciliary Dyskinesia on Chromosome 5p and Identification of the Heavy Dynein Chain DNAH5 as a Candidate Gene Heymut Omran, Karsten Häffner, Alexander Völkel,

More information

Supplementary figure legends

Supplementary figure legends Supplementary figure legends SUPPLEMENTRY FIGURE S1. Lentiviral construct. Schematic representation of the PCR fragment encompassing the genomic locus of mir-33a that was introduced in the lentiviral construct.

More information

A 20-year experience of electron microscopy in the diagnosis of primary ciliary

A 20-year experience of electron microscopy in the diagnosis of primary ciliary ERJ Express. Published on October 19, 2009 as doi: 10.1183/09031936.00046209 A 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia Jean F Papon 1,2,3,4,5, Andre Coste

More information

Utilization of the MiSeq in a clinical lab. Tony Krentz, PhD PreventionGenetics

Utilization of the MiSeq in a clinical lab. Tony Krentz, PhD PreventionGenetics Utilization of the MiSeq in a clinical lab Tony Krentz, PhD PreventionGenetics PreventionGenetics Founded in 2004 in Marshfield, Wisconsin by James Weber ~90 employees Largest test menu in US Vision: Disease

More information

Sperm dysfunction and ciliopathy

Sperm dysfunction and ciliopathy Reprod Med Biol (2016) 15:77 94 DOI 10.1007/s12522-015-0225-5 REVIEW ARTICLE Sperm dysfunction and ciliopathy Kazuo Inaba 1 Katsutoshi Mizuno 1,2 Received: 30 July 2015 / Accepted: 26 September 2015 /

More information

University of Groningen

University of Groningen University of Groningen Ciliary Genes Are Down-Regulated in Bronchial Tissue of Primary Ciliary Dyskinesia Patients Geremek, Maciej; Zietkiewicz, Ewa; Bruinenberg, Marcel; Franke, Lude; Pogorzelski, Andrzej;

More information

Marta Puerto Plasencia. microrna sponges

Marta Puerto Plasencia. microrna sponges Marta Puerto Plasencia microrna sponges Introduction microrna CircularRNA Publications Conclusions The most well-studied regions in the human genome belong to proteincoding genes. Coding exons are 1.5%

More information

AMDCC Progress Report Duke/UNC/Stanford Unit. Program Director Thomas M. Coffman, MD

AMDCC Progress Report Duke/UNC/Stanford Unit. Program Director Thomas M. Coffman, MD AMDCC Progress Report Duke/UNC/Stanford Unit Program Director Thomas M. Coffman, MD Susceptibility Mutation Model Development + ApoE-/- +STZ Kidney Phenotype Screen Vascular & Kidney Phenotype Screen Generate

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 U1 inhibition causes a shift of RNA-seq reads from exons to introns. (a) Evidence for the high purity of 4-shU-labeled RNAs used for RNA-seq. HeLa cells transfected with control

More information

Primary Ciliary Dyskinesia Clinical Presentation and Diagnosis. Douglas Conrad California Thoracic Society January, 2018

Primary Ciliary Dyskinesia Clinical Presentation and Diagnosis. Douglas Conrad California Thoracic Society January, 2018 Primary Ciliary Dyskinesia Clinical Presentation and Diagnosis Douglas Conrad California Thoracic Society January, 2018 Disclosures Current Funding: NIH RO1 National CF Foundation Gilead Sciences Potential

More information

Diagnosis of primary ciliary dyskinesia: searching for a gold standard

Diagnosis of primary ciliary dyskinesia: searching for a gold standard EDITORIAL PRIMARY CILIARY DYSKINESIA Diagnosis of primary ciliary dyskinesia: searching for a gold standard Jane S. Lucas 1,2 and Margaret W. Leigh 3,4 Affiliations: 1 Primary Ciliary Dyskinesia Centre,

More information

Primary ciliary dyskinesia (PCD) is a rare disease of children. Review. Picking up speed: advances in the genetics of primary ciliary dyskinesia

Primary ciliary dyskinesia (PCD) is a rare disease of children. Review. Picking up speed: advances in the genetics of primary ciliary dyskinesia nature publishing group Picking up speed: advances in the genetics of primary ciliary dyskinesia Amjad Horani 1, Steven L. Brody 2 and Thomas W. Ferkol 1,3 Abnormal ciliary axonemal structure and function

More information

The Alternative Choice of Constitutive Exons throughout Evolution

The Alternative Choice of Constitutive Exons throughout Evolution The Alternative Choice of Constitutive Exons throughout Evolution Galit Lev-Maor 1[, Amir Goren 1[, Noa Sela 1[, Eddo Kim 1, Hadas Keren 1, Adi Doron-Faigenboim 2, Shelly Leibman-Barak 3, Tal Pupko 2,

More information

Clinical Genetics. Functional validation in a diagnostic context. Robert Hofstra. Leading the way in genetic issues

Clinical Genetics. Functional validation in a diagnostic context. Robert Hofstra. Leading the way in genetic issues Clinical Genetics Leading the way in genetic issues Functional validation in a diagnostic context Robert Hofstra Clinical Genetics Leading the way in genetic issues Future application of exome sequencing

More information

Supplemental Information For: The genetics of splicing in neuroblastoma

Supplemental Information For: The genetics of splicing in neuroblastoma Supplemental Information For: The genetics of splicing in neuroblastoma Justin Chen, Christopher S. Hackett, Shile Zhang, Young K. Song, Robert J.A. Bell, Annette M. Molinaro, David A. Quigley, Allan Balmain,

More information

The Complexity of Simple Genetics

The Complexity of Simple Genetics The Complexity of Simple Genetics? The ciliopathies: a journey into variable penetrance and expressivity Bardet-Biedl Syndrome Allelism at a single locus is insufficient to explain phenotypic variability

More information

Mutations in the DNAH11 (axonemal heavy chain dynein type 11) gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia

Mutations in the DNAH11 (axonemal heavy chain dynein type 11) gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia Mutations in the DNAH11 (axonemal heavy chain dynein type 11) gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia Lucia Bartoloni*, Jean-Louis Blouin*, Yanzhen Pan,

More information

Unique among ciliopathies: primary ciliary dyskinesia, a motile cilia disorder Kavita Praveen, Erica E. Davis, and Nicholas Katsanis*

Unique among ciliopathies: primary ciliary dyskinesia, a motile cilia disorder Kavita Praveen, Erica E. Davis, and Nicholas Katsanis* Published: 10 March 2015 2015 Faculty of 1000 Ltd Unique among ciliopathies: primary ciliary dyskinesia, a motile cilia disorder Kavita Praveen, Erica E. Davis, and Nicholas Katsanis* Address: Center for

More information

Original Article. C18orf1 located on chromosome 18p11.2 may confer susceptibility to schizophrenia

Original Article. C18orf1 located on chromosome 18p11.2 may confer susceptibility to schizophrenia J Med Dent Sci 2003; 50: 225 229 Original Article C18orf1 located on chromosome 18p11.2 may confer susceptibility to schizophrenia Mika Kikuchi 1,2, Kazuo Yamada 1, Tomoko Toyota 1,2 and Takeo Yoshikawa

More information

Axonemal Dynein Intermediate-Chain Gene (DNAI1) Mutations Result in Situs Inversus and Primary Ciliary Dyskinesia (Kartagener Syndrome)

Axonemal Dynein Intermediate-Chain Gene (DNAI1) Mutations Result in Situs Inversus and Primary Ciliary Dyskinesia (Kartagener Syndrome) Am. J. Hum. Genet. 68:1030 1035, 2001 Report Axonemal Dynein Intermediate-Chain Gene (DNAI1) Mutations Result in Situs Inversus and Primary Ciliary Dyskinesia (Kartagener Syndrome) Cécile Guichard, 1 Marie-Cécile

More information

DIAGNOSIS OF PRIMARY CILIARY DYSKINESIA

DIAGNOSIS OF PRIMARY CILIARY DYSKINESIA DIAGNOSIS OF PRIMARY CILIARY DYSKINESIA Kris De Boeck, MD PHD Pediatric Pulmonology, University of Leuven, Belgium Introduction Cause Congenital dysfunction of motile cilia Absence/dysfunction of one of

More information

CS 6824: Tissue-Based Map of the Human Proteome

CS 6824: Tissue-Based Map of the Human Proteome CS 6824: Tissue-Based Map of the Human Proteome T. M. Murali November 17, 2016 Human Protein Atlas Measure protein and gene expression using tissue microarrays and deep sequencing, respectively. Alternative

More information

Ambient temperature regulated flowering time

Ambient temperature regulated flowering time Ambient temperature regulated flowering time Applications of RNAseq RNA- seq course: The power of RNA-seq June 7 th, 2013; Richard Immink Overview Introduction: Biological research question/hypothesis

More information

Discovery of Schizophrenia Drug Targets from DISC1 Mechanisms Atsushi Kamiya M.D., Ph.D.

Discovery of Schizophrenia Drug Targets from DISC1 Mechanisms Atsushi Kamiya M.D., Ph.D. Discovery of Schizophrenia Drug Targets 1 Assistant Professor Department of Psychiatry and Behavioral Sciences Johns Hopkins University School of Medicine akamiya1@jhmi.edu How does neurobiology offer

More information

variant led to a premature stop codon p.k316* which resulted in nonsense-mediated mrna decay. Although the exact function of the C19L1 is still

variant led to a premature stop codon p.k316* which resulted in nonsense-mediated mrna decay. Although the exact function of the C19L1 is still 157 Neurological disorders primarily affect and impair the functioning of the brain and/or neurological system. Structural, electrical or metabolic abnormalities in the brain or neurological system can

More information

ARTICLE. Recessive HYDIN Mutations Cause Primary Ciliary Dyskinesia without Randomization of Left-Right Body Asymmetry

ARTICLE. Recessive HYDIN Mutations Cause Primary Ciliary Dyskinesia without Randomization of Left-Right Body Asymmetry Recessive HYDIN Mutations Cause Primary Ciliary Dyskinesia without Randomization of Left-Right Body Asymmetry ARTICLE Heike Olbrich, 1,13 Miriam Schmidts, 2,13 Claudius Werner, 1,13 Alexandros Onoufriadis,

More information

Supporting Information

Supporting Information upporting Information Hartford et al. 10.1073/pnas.1113524108 I Results tructure of the Mcm9 Locus. Based on available ET and genomic sequence data, Yoshida (1) characterized mouse Mcm9 as encoding a protein

More information

Mutations in the Caenorhabditis elegans U2AF Large Subunit UAF-1 Al= of a 3' Splice Site In Vivo

Mutations in the Caenorhabditis elegans U2AF Large Subunit UAF-1 Al= of a 3' Splice Site In Vivo Mutations in the Caenorhabditis elegans U2AF Large Subunit UAF-1 Al= of a 3' Splice Site In Vivo The MIT Faculty has made this article openly available. Please share how this access benefits you. Your

More information

BIOL2005 WORKSHEET 2008

BIOL2005 WORKSHEET 2008 BIOL2005 WORKSHEET 2008 Answer all 6 questions in the space provided using additional sheets where necessary. Hand your completed answers in to the Biology office by 3 p.m. Friday 8th February. 1. Your

More information

Transcriptional repression of Xi

Transcriptional repression of Xi Transcriptional repression of Xi Xist Transcription of Xist Xist RNA Spreading of Xist Recruitment of repression factors. Stable repression Translocated Xic cannot efficiently silence autosome regions.

More information

Cilia and flagella play important roles in many physiological

Cilia and flagella play important roles in many physiological An intronic insertion in KPL2 results in aberrant splicing and causes the immotile short-tail sperm defect in the pig Anu Sironen*, Bo Thomsen, Magnus Andersson, Virpi Ahola, and Johanna Vilkki* *MTT Agrifood

More information

A Comprehensive Study of TP53 Mutations in Chronic Lymphocytic Leukemia: Analysis of 1,287 Diagnostic CLL Samples

A Comprehensive Study of TP53 Mutations in Chronic Lymphocytic Leukemia: Analysis of 1,287 Diagnostic CLL Samples A Comprehensive Study of TP53 Mutations in Chronic Lymphocytic Leukemia: Analysis of 1,287 Diagnostic CLL Samples Sona Pekova, MD., PhD. Chambon Ltd., Laboratory for molecular diagnostics, Prague, Czech

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nature8645 Physical coverage (x haploid genomes) 11 6.4 4.9 6.9 6.7 4.4 5.9 9.1 7.6 125 Neither end mapped One end mapped Chimaeras Correct Reads (million ns) 1 75 5 25 HCC1187 HCC1395 HCC1599

More information

Studying Alternative Splicing

Studying Alternative Splicing Studying Alternative Splicing Meelis Kull PhD student in the University of Tartu supervisor: Jaak Vilo CS Theory Days Rõuge 27 Overview Alternative splicing Its biological function Studying splicing Technology

More information

NUMB is a break of WNT - Notch signaling cycle

NUMB is a break of WNT - Notch signaling cycle INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 18: 517-521, 2006 517 NUMB is a break of WNT - Notch signaling cycle MASUKO KATOH 1 and MASARU KATOH 2 1 M&M Medical BioInformatics, Hongo 113-0033; 2 Genetics

More information

Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A.

Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Upper part, three-primer PCR strategy at the Mcm3 locus yielding

More information

Bio 111 Study Guide Chapter 17 From Gene to Protein

Bio 111 Study Guide Chapter 17 From Gene to Protein Bio 111 Study Guide Chapter 17 From Gene to Protein BEFORE CLASS: Reading: Read the introduction on p. 333, skip the beginning of Concept 17.1 from p. 334 to the bottom of the first column on p. 336, and

More information

IMPC phenotyping SOPs in JMC

IMPC phenotyping SOPs in JMC IMPC phenotyping SOPs in JMC Tissue Embedding and Block Banking IMPC_BLK_001 Purpose Collect and fix a standard list of tissues from the complete necropsy (see IMPC Gross Pathology & Tissue Collection

More information

Supplementary Figure 1. Linkage analysis of Family 7. Red arrow, position of SRRM2 gene in chromosome16.

Supplementary Figure 1. Linkage analysis of Family 7. Red arrow, position of SRRM2 gene in chromosome16. A germline mutation in SRRM2, a splicing factor gene, is implicated in papillary thyroid carcinoma predisposition Jerneja Tomsic 1, Huiling He 1, Keiko Akagi 1, Sandya Liyanarachchi 1, Qun Pan 2, Blake

More information

REPORT Splice-Site Mutations in the Axonemal Outer Dynein Arm Docking Complex Gene CCDC114 Cause Primary Ciliary Dyskinesia

REPORT Splice-Site Mutations in the Axonemal Outer Dynein Arm Docking Complex Gene CCDC114 Cause Primary Ciliary Dyskinesia REPORT Splice-Site Mutations in the Axonemal Outer Dynein Arm Docking Complex Gene CCDC114 Cause Primary Ciliary Dyskinesia Alexandros Onoufriadis, 1,10 Tamara Paff, 2,3,4,10 Dinu Antony, 1 Amelia Shoemark,

More information

Annotation of Chimp Chunk 2-10 Jerome M Molleston 5/4/2009

Annotation of Chimp Chunk 2-10 Jerome M Molleston 5/4/2009 Annotation of Chimp Chunk 2-10 Jerome M Molleston 5/4/2009 1 Abstract A stretch of chimpanzee DNA was annotated using tools including BLAST, BLAT, and Genscan. Analysis of Genscan predicted genes revealed

More information

Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell

Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Wenxin Li Department of Biological Sciences Fordham University Abstract MEFV is a human gene that codes for an

More information

The classical genetic and genomic approach to the pathogenesis of primary ciliary dyskinesia Geremek, Maciej

The classical genetic and genomic approach to the pathogenesis of primary ciliary dyskinesia Geremek, Maciej University of Groningen The classical genetic and genomic approach to the pathogenesis of primary ciliary dyskinesia Geremek, Maciej IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's

More information

REPORT ARMC4 Mutations Cause Primary Ciliary Dyskinesia with Randomization of Left/Right Body Asymmetry

REPORT ARMC4 Mutations Cause Primary Ciliary Dyskinesia with Randomization of Left/Right Body Asymmetry REPORT ARMC4 Mutations Cause Primary Ciliary Dyskinesia with Randomization of Left/Right Body Asymmetry Rim Hjeij, 1 Anna Lindstrand, 2 Richard Francis, 3 Maimoona A. Zariwala, 4 Xiaoqin Liu, 3 You Li,

More information

RECAP (1)! In eukaryotes, large primary transcripts are processed to smaller, mature mrnas.! What was first evidence for this precursorproduct

RECAP (1)! In eukaryotes, large primary transcripts are processed to smaller, mature mrnas.! What was first evidence for this precursorproduct RECAP (1) In eukaryotes, large primary transcripts are processed to smaller, mature mrnas. What was first evidence for this precursorproduct relationship? DNA Observation: Nuclear RNA pool consists of

More information

Long non-coding RNAs

Long non-coding RNAs Long non-coding RNAs Dominic Rose Bioinformatics Group, University of Freiburg Bled, Feb. 2011 Outline De novo prediction of long non-coding RNAs (lncrnas) Genome-wide RNA gene-finding Intrinsic properties

More information

Transport of the outer dynein arm complex to cilia requires a cytoplasmic protein Lrrc6

Transport of the outer dynein arm complex to cilia requires a cytoplasmic protein Lrrc6 Genes to Cells Transport of the outer dynein arm complex to cilia requires a cytoplasmic protein Lrrc6 Yasuko Inaba 1, Kyosuke Shinohara 1a, Yanick Botilde 1, Ryo Nabeshima 1, Katsuyoshi Takaoka 1, Rieko

More information

Analyse de données de séquençage haut débit

Analyse de données de séquençage haut débit Analyse de données de séquençage haut débit Vincent Lacroix Laboratoire de Biométrie et Biologie Évolutive INRIA ERABLE 9ème journée ITS 21 & 22 novembre 2017 Lyon https://its.aviesan.fr Sequencing is

More information

Nicholas Katsanis, Ph.D.

Nicholas Katsanis, Ph.D. Ciliopathies and Oligogenic Phenomena Prof. Center for Human Disease Modeling Duke University 1 Some key questions in human genetics What variants cause disease? What variants are associated with disease

More information

Introduction to Cancer Biology

Introduction to Cancer Biology Introduction to Cancer Biology Robin Hesketh Multiple choice questions (choose the one correct answer from the five choices) Which ONE of the following is a tumour suppressor? a. AKT b. APC c. BCL2 d.

More information

Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated

Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C genes. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated from 7 day-old seedlings treated with or without

More information

SALSA MLPA probemix P169-C2 HIRSCHSPRUNG-1 Lot C As compared to version C1 (lot C1-0612), the length of one probe has been adjusted.

SALSA MLPA probemix P169-C2 HIRSCHSPRUNG-1 Lot C As compared to version C1 (lot C1-0612), the length of one probe has been adjusted. mix P169-C2 HIRSCHSPRUNG-1 Lot C2-0915. As compared to version C1 (lot C1-0612), the length of one has been adjusted. Hirschsprung disease (HSCR), or aganglionic megacolon, is a congenital disorder characterised

More information

Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4)

Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4) Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4) Vahagn Stepanyan Department of Biological Sciences, Fordham University Abstract: Alternative splicing is an

More information

MRC-Holland MLPA. Description version 18; 09 September 2015

MRC-Holland MLPA. Description version 18; 09 September 2015 SALSA MLPA probemix P090-A4 BRCA2 Lot A4-0715, A4-0714, A4-0314, A4-0813, A4-0712: Compared to lot A3-0710, the 88 and 96 nt control fragments have been replaced (QDX2). This product is identical to the

More information

SALSA MLPA probemix P185-C2 Intersex Lot C2-1015: As compared to the previous version C1 (lot C1-0611), the lengths of four probes have been adjusted.

SALSA MLPA probemix P185-C2 Intersex Lot C2-1015: As compared to the previous version C1 (lot C1-0611), the lengths of four probes have been adjusted. mix P185-C2 Intersex Lot C2-1015: As compared to the previous version C1 (lot C1-0611), the lengths of four s have been adjusted. The sex-determining region on chromosome Y (SRY) is the most important

More information

Axonemal Beta Heavy Chain Dynein DNAH9: cdna Sequence, Genomic Structure, and Investigation of Its Role in Primary Ciliary Dyskinesia

Axonemal Beta Heavy Chain Dynein DNAH9: cdna Sequence, Genomic Structure, and Investigation of Its Role in Primary Ciliary Dyskinesia Axonemal Beta Heavy Chain Dynein DNAH9: cdna Sequence, Genomic Structure, and Investigation of Its Role in Primary Ciliary Dyskinesia Lucia Bartoloni a, Jean- Louis Blouin a, Amit K. Maiti a, Amanda Sainsbury

More information

Nature Genetics: doi: /ng Supplementary Figure 1. Assessment of sample purity and quality.

Nature Genetics: doi: /ng Supplementary Figure 1. Assessment of sample purity and quality. Supplementary Figure 1 Assessment of sample purity and quality. (a) Hematoxylin and eosin staining of formaldehyde-fixed, paraffin-embedded sections from a human testis biopsy collected concurrently with

More information

Recent advances in primary ciliary dyskinesia genetics

Recent advances in primary ciliary dyskinesia genetics JMG Online First, published on October 28, 2014 as 10.1136/jmedgenet-2014-102755 Review Recent advances in primary ciliary dyskinesia genetics Małgorzata Kurkowiak, 1,2 Ewa Ziętkiewicz, 1 Michał Witt 1,2

More information

In vitro culturing of ciliary respiratory cells a model for studies of genetic diseases

In vitro culturing of ciliary respiratory cells a model for studies of genetic diseases J Appl Genetics (2011) 52:39 51 DOI 10.1007/s13353-010-0005-1 HUMAN GENETICS REVIEW In vitro culturing of ciliary respiratory cells a model for studies of genetic diseases Zuzanna Bukowy & Ewa Ziętkiewicz

More information

Deep-Sequencing of HIV-1

Deep-Sequencing of HIV-1 Deep-Sequencing of HIV-1 The quest for true variants Alexander Thielen, Martin Däumer 09.05.2015 Limitations of drug resistance testing by standard-sequencing Blood plasma RNA extraction RNA Reverse Transcription/

More information

Muscular Dystrophy. Biol 405 Molecular Medicine

Muscular Dystrophy. Biol 405 Molecular Medicine Muscular Dystrophy Biol 405 Molecular Medicine Duchenne muscular dystrophy Duchenne muscular dystrophy is a neuromuscular disease that occurs in ~ 1/3,500 male births. The disease causes developmental

More information

Hands-On Ten The BRCA1 Gene and Protein

Hands-On Ten The BRCA1 Gene and Protein Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such

More information

MRC-Holland MLPA. Description version 14; 28 September 2016

MRC-Holland MLPA. Description version 14; 28 September 2016 SALSA MLPA probemix P279-B3 CACNA1A Lot B3-0816. As compared to version B2 (lot B2-1012), one reference probe has been replaced and the length of several probes has been adjusted. Voltage-dependent calcium

More information

HHS Public Access Author manuscript Nature. Author manuscript; available in PMC 2012 February 15.

HHS Public Access Author manuscript Nature. Author manuscript; available in PMC 2012 February 15. Ktu/PF13 is required for cytoplasmic pre-assembly of axonemal dyneins Heymut Omran 1,*, Daisuke Kobayashi 2,*, Heike Olbrich 1,*, Tatsuya Tsukahara 3,*, Niki Tomas Loges 1, Haruo Hagiwara 4, Qi Zhang 5,

More information

Supporting Information

Supporting Information Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween

More information

Transcriptome maps of Populus tomentosa: Characteristics and its applications

Transcriptome maps of Populus tomentosa: Characteristics and its applications Transcriptome maps of Populus tomentosa: Characteristics and its applications PhD. Li bo & Pro.Zhang Zhiyi 2008.10.29 Discrete traits and quantitative traits Discrete trait: color, gender, et al Quantitative

More information

Inference of Isoforms from Short Sequence Reads

Inference of Isoforms from Short Sequence Reads Inference of Isoforms from Short Sequence Reads Tao Jiang Department of Computer Science and Engineering University of California, Riverside Tsinghua University Joint work with Jianxing Feng and Wei Li

More information

Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein

Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.

More information

Wnt signaling. Ramray Bhat.

Wnt signaling. Ramray Bhat. Wnt signaling Ramray Bhat ramray@mrdg.iisc.ernet.in Starting with animal biology and viral infections The discovery of certain laboratory murine strains that were highly susceptible to mammary gland cancer.

More information

Supplementary Figure S1: Alignment of CD28H. (a) Alignment of human CD28H with other known B7 receptors. (b) Alignment of CD28H orthologs.

Supplementary Figure S1: Alignment of CD28H. (a) Alignment of human CD28H with other known B7 receptors. (b) Alignment of CD28H orthologs. Supplementary Figure S1: Alignment of CD28H. (a) Alignment of human CD28H with other known B7 receptors. (b) Alignment of CD28H orthologs. Predicted CD28H protein sequences from human, chimpanzee (pan

More information

MRC-Holland MLPA. Description version 08; 07 May 2015

MRC-Holland MLPA. Description version 08; 07 May 2015 mix P185-C1 Intersex Lot C1-0611: As compared to the previous version B2 (lot B2-0311), s for CYP21A2 have been removed and s for the CXorf21 gene as well as additional s for NR0B1, NR5A1 and the Y chromosome

More information

Sex Determination and Gonadal Sex Differentiation in Fish

Sex Determination and Gonadal Sex Differentiation in Fish Sex Determination and Gonadal Sex Differentiation in Fish Yoshitaka Nagahama Okazaki National Research Institutes, Japan This first slide shows the processes of gonadal sex differentiation and gametogenesis

More information

Immune system 1. Please sit in row K or forward

Immune system 1. Please sit in row K or forward Immune system 1 Please sit in row K or forward Random biological fact of the day (RBFD): cholera toxin and human signaling pathways Stomach Large intestine Small intestine Leodotia Pope, Department of

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Yatsenko AN, Georgiadis AP, Röpke A, et al. X-linked TEX11

More information

CASE REPORT. 1. Assistant Professor. Department of Paediatrics, Vinayaka Missions Medical College, Karaikal

CASE REPORT. 1. Assistant Professor. Department of Paediatrics, Vinayaka Missions Medical College, Karaikal A CASE OF KARTAGENER SYNDROME Pagadpally Srinivas 1. Assistant Professor. Department of Paediatrics, Vinayaka Missions Medical College, Karaikal CORRESPONDING AUTHOR: Pagadpally Srinivas, 72, Vellai Pillaiyar

More information

Bioinformation by Biomedical Informatics Publishing Group

Bioinformation by Biomedical Informatics Publishing Group Predicted RNA secondary structures for the conserved regions in dengue virus Pallavi Somvanshi*, Prahlad Kishore Seth Bioinformatics Centre, Biotech Park, Sector G, Jankipuram, Lucknow 226021, Uttar Pradesh,

More information

Characterizing intra-host influenza virus populations to predict emergence

Characterizing intra-host influenza virus populations to predict emergence Characterizing intra-host influenza virus populations to predict emergence June 12, 2012 Forum on Microbial Threats Washington, DC Elodie Ghedin Center for Vaccine Research Dept. Computational & Systems

More information

SALSA MLPA probemix P241-D2 MODY mix 1 Lot D As compared to version D1 (lot D1-0911), one reference probe has been replaced.

SALSA MLPA probemix P241-D2 MODY mix 1 Lot D As compared to version D1 (lot D1-0911), one reference probe has been replaced. mix P241-D2 MODY mix 1 Lot D2-0413. As compared to version D1 (lot D1-0911), one reference has been replaced. Maturity-Onset Diabetes of the Young (MODY) is a distinct form of non insulin-dependent diabetes

More information

Lecture 3-4. Identification of Positive Regulators downstream of SA

Lecture 3-4. Identification of Positive Regulators downstream of SA Lecture 3-4 Identification of Positive Regulators downstream of SA Positive regulators between SA and resistance/pr Systemic resistance PR gene expression? SA Local infection Necrosis SA What could they

More information

Processing of RNA II Biochemistry 302. February 14, 2005 Bob Kelm

Processing of RNA II Biochemistry 302. February 14, 2005 Bob Kelm Processing of RNA II Biochemistry 302 February 14, 2005 Bob Kelm What s an intron? Transcribed sequence removed during the process of mrna maturation (non proteincoding sequence) Discovered by P. Sharp

More information

PRIMARY CILIARY DYSKINESIA

PRIMARY CILIARY DYSKINESIA PRIMARY CILIARY DYSKINESIA 485 Ikezoe J, Johkoh T, Kohno N, et al. (1996) High-resolution CT findings of lung disease in patients with polymyositis and dermatomyositis. Journal of Thoracic Imaging 11:

More information

A suppressor locus for MODY3-diabetes

A suppressor locus for MODY3-diabetes A suppressor locus for MODY3-diabetes Miguel A. Garcia-Gonzalez 1,2, Claire Carette 1,3, Alessia Bagattin 1, Magali Chiral 1, Munevver Parla Makinistoglu 1, Serge Garbay 1, Géraldine Prévost 4, Cécile

More information

The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein

The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein THESIS BOOK The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein Orsolya Buzás-Bereczki Supervisors: Dr. Éva Bálint Dr. Imre Miklós Boros University of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Information included with Nature MS 2008-02-01484B by Colantonio et al., entitled The dynein regulatory complex is required for ciliary motility and otolith biogenesis in the inner ear. This

More information

BST227 Introduction to Statistical Genetics. Lecture 4: Introduction to linkage and association analysis

BST227 Introduction to Statistical Genetics. Lecture 4: Introduction to linkage and association analysis BST227 Introduction to Statistical Genetics Lecture 4: Introduction to linkage and association analysis 1 Housekeeping Homework #1 due today Homework #2 posted (due Monday) Lab at 5:30PM today (FXB G13)

More information

BWA alignment to reference transcriptome and genome. Convert transcriptome mappings back to genome space

BWA alignment to reference transcriptome and genome. Convert transcriptome mappings back to genome space Whole genome sequencing Whole exome sequencing BWA alignment to reference transcriptome and genome Convert transcriptome mappings back to genome space genomes Filter on MQ, distance, Cigar string Annotate

More information

The Emergence of Alternative 39 and 59 Splice Site Exons from Constitutive Exons

The Emergence of Alternative 39 and 59 Splice Site Exons from Constitutive Exons The Emergence of Alternative 39 and 59 Splice Site Exons from Constitutive Exons Eli Koren, Galit Lev-Maor, Gil Ast * Department of Human Molecular Genetics, Sackler Faculty of Medicine, Tel Aviv University,

More information

Accessing and Using ENCODE Data Dr. Peggy J. Farnham

Accessing and Using ENCODE Data Dr. Peggy J. Farnham 1 William M Keck Professor of Biochemistry Keck School of Medicine University of Southern California How many human genes are encoded in our 3x10 9 bp? C. elegans (worm) 959 cells and 1x10 8 bp 20,000

More information

MRC-Holland MLPA. Description version 08; 18 November 2016

MRC-Holland MLPA. Description version 08; 18 November 2016 SALSA MLPA probemix P122-D1 NF1 AREA Lot D1-1016. As compared to lot C2-0312, four probes in the NF1 area and one reference probe have been removed, four reference probes have been replaced and several

More information

RNA-seq Introduction

RNA-seq Introduction RNA-seq Introduction DNA is the same in all cells but which RNAs that is present is different in all cells There is a wide variety of different functional RNAs Which RNAs (and sometimes then translated

More information

This is an Open Access document downloaded from ORCA, Cardiff University's institutional repository:

This is an Open Access document downloaded from ORCA, Cardiff University's institutional repository: This is an Open Access document downloaded from ORCA, Cardiff University's institutional repository: http://orca.cf.ac.uk/102603/ This is the author s version of a work that was submitted to / accepted

More information

Genome 371, Autumn 2018 Quiz Section 9: Genetics of Cancer Worksheet

Genome 371, Autumn 2018 Quiz Section 9: Genetics of Cancer Worksheet Genome 371, Autumn 2018 Quiz Section 9: Genetics of Cancer Worksheet All cancer is due to genetic mutations. However, in cancer that clusters in families (familial cancer) at least one of these mutations

More information