Génétique des DCP. Deciphering the molecular bases of ciliopathies. Estelle Escudier, INSERM U 681 Serge Amselem, INSERM U 654
|
|
- Augustine Gaines
- 5 years ago
- Views:
Transcription
1 Génétique des DCP Estelle Escudier, INSERM U 681 Serge Amselem, INSERM U 654 Deciphering the molecular bases of ciliopathies Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics
2 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics Candidate gene approach based on Chlamydomonas mutants Normal strains (adapted from Witman, 1992) Immotile strains 9 and 6 mutants (IC78, IC69)
3 Isolation of human sequences orthologous to IC78 and IC69 Primers Chlamydomonas IC78 See urchin IC2 conserved regions Template = total RNA from human adult tissues: testis and trachea RT-PCR / Cloning / Sequencing Tissue expression of and DNAI2 estomac thyroïde moelle épinière ganglion lymphatique trachée glande surrénale moelle osseuse rate thymus prostate testicule uterus intestin grèle colon leucocytes estomac thyroïde moelle épinière ganglion lymphatique trachée glande surrénale moelle osseuse rate thymus prostate testicule uterus intestin grèle colon leucocytes 2.5 kb 2.4 kb DNAI2 expression restricted to trachea eand testis Pennarun et al. Am J Hum Genet 1999
4 Chromosomal localization of and DNAI p p p p q q 25 q Chromosome 9 Chromosome exons 53 kb DNAI2 14 exons 39 kb Pennarun et al. Am J Hum Genet 1999 mutation spectrum in PCD/KS W568S 1 G515S 699 ATG nt 1 WD1 WD2 WD3 WD4 WD TGA nt insT insAATA (fsh118x) W436X del W568X G>A Pennarun et al. Am J Hum Genet 1999 Guichard et al. Am J Hum Genet 2001 Zariwala et al. Am J Respir Cell Mol Biol 2001
5 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics Involvement of DNH5 in PCD/KS (absence of ) Linkage analysis (Homozygosity mapping) 5p14-14 (null mutations) Patient Control Omran et al. Am J Respir Cell Mol Biol 2000 Chung et al. Nature Genet 2002
6 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics RPGR IFT Moore et al. J Med Genet 2006 Molecular bases of PCD? Linkage analyses Candidate gene approaches Chromosome abnormalities Comparative genomics R2852X F508 R2852X R2852X F DNAH11 Normal EM SI F508 Bartoloni et al. PNAS 2002 RPGR IFT
7 Thioredoxins and Nucleoside diphosphokinases NDK family Group I NDK Enzymatic activity + Group II NDK enzymatic activity? mainly expressed in the testis (except NME6) NDK domain of IC1 TRX TXNDC3 () TXNDC6 NDK TRX domain NDPK domain1 NDPK domain2 TXNDC TXNDC3 gene defects Duriez et al PNAS 2007
8 TXNDC3 gene defects and related products Duriez et al PNAS 2007 Expression of the TXNDC3fl and TXNDC3d7 isoforms Duriez et al PNAS 2007
9 Impact of the c c>t variant on splicing of TXNDC3 transcripts Duriez et al PNAS 2007 Conservation of TXNDC3 and TXNDC3 exon7 throughout evolution Human Chimpanzee Dog Cow Mouse Rat Chicken Frog Pufferfish Tetraodon Sea urchin Ciona Overall identity 100% 97% 67% 67% 63% 61% 46% 38% 40% 39% 38% 34% A Conservation of the human regions encoded by TXNDC3 exon 7 and TXNDC6 exon 5 TXNDC3 E7 NGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQ TXNDC6 E5 GGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKV B Phylogenetic conservation of the region encoded by TXNDC3 exon 7 Human NGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQ Chimpanzee NGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQ Dog NGKIIARINGANAPLVNKKITNLINEEKKIAAGEMVRPQ Cow NGTIVAKIQGANAPLVNQKIIALVNEERKIAAGEMVRPQ Mouse NGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQ Rat NGKIIAKIQGANAPLINRKVIALIDEEKKIAAGEMARPQ Chicken NGKIIAIVRGANAPLLSKKITELVQEEREILAGQKERPE Frog GGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHV Pufferfish GGELVGVLRGANAPLLQRMIVQKLGEEKMVLEKGVERKV Tetraodon GGELVGVLRGANAPLLQKMIVQKLSEEKMVLEKGGERKV Zebrafish GGELVSVLRGPNAPLLQKTIQEELSNEKNVLEHGGARRA Ciona GGELVAAVRGCNAPLVQETIQETLKNEHKILSGEMERKV Duriez et al PNAS 2007
10 Comparison of the binding of of TXNDC3fl and TXNDC3d7 to microtubules Duriez et al PNAS 2007 Molecular bases of PCD? Linkage analyses Candidate gene approaches Comparative genomics Chromosome abnormalities R2852X F508 R2852X R2852X F DNAH11 Normal EM F508 RPGR IFT TXNDC3 + SA
11 Ciliary defects in PCD n=273 10% 17% 29% 15% 8% 21% alone both DA IDA? IDA alone CC Kartagener with normal cilia Gene identification in PCD n=273 10% 10% 53% 17% 29% 15% 8% 21% alone both DA IDA? IDA alone CC Kartagener with normal cilia
12 Gene identification in PCD n=273 genes? alone both DA IDA? IDA alone CC Kartagener with normal cilia
Ciliary defects and genetics of primary ciliary dyskinesia.
Ciliary defects and genetics of primary ciliary dyskinesia. Estelle Escudier, Philippe Duquesnoy, Jean-François Papon, Serge Amselem To cite this version: Estelle Escudier, Philippe Duquesnoy, Jean-François
More informationIdentification of predicted human outer dynein arm genes- candidates for primary ciliary dyskinesia genes
JMG Online First, published on June 3, 2005 as 10.1136/jmg.2005.033001 Identification of predicted human outer dynein arm genes- candidates for primary ciliary dyskinesia genes Gregory J. Pazour 1, Nathan
More informationA 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia
Eur Respir J 2010; 35: 1057 1063 DOI: 10.1183/09031936.00046209 CopyrightßERS Journals Ltd 2010 A 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia J.F. Papon*,#,",+,1,
More informationThe coiled-coil domain containing protein CCDC40 is essential for motile cilia function and left-right axis formation
The coiled-coil domain containing protein CCDC40 is essential for motile cilia function and left-right axis formation Anita Becker-Heck#, Irene Zohn#, Noriko Okabe#, Andrew Pollock#, Kari Baker Lenhart,
More informationMislocalization of DNAH5 and DNAH9 in Respiratory Cells from Patients with Primary Ciliary Dyskinesia
Mislocalization of DNAH5 and DNAH9 in Respiratory Cells from Patients with Primary Ciliary Dyskinesia Manfred Fliegauf, Heike Olbrich, Judit Horvath, Johannes H. Wildhaber, Maimoona A. Zariwala, Marcus
More informationPrimary Ciliary Dyskinesia Pathogenesis, diagnosis and treatment DR CLAIRE HOGG DEPT. RESPIRATORY PAEDIATRICS ROYAL BROMPTON HOSPITAL LONDON.
Primary Ciliary Dyskinesia Pathogenesis, diagnosis and treatment DR CLAIRE HOGG DEPT. RESPIRATORY PAEDIATRICS ROYAL BROMPTON HOSPITAL LONDON. Pathogenesis of PCD Autosomal recessive Heterogeneous Defect
More informationSupplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T
More informationARTICLE DNAI2 Mutations Cause Primary Ciliary Dyskinesia with Defects in the Outer Dynein Arm
ARTICLE DNAI2 Mutations Cause Primary Ciliary Dyskinesia with Defects in the Outer Dynein Arm Niki Tomas Loges, 1,2 Heike Olbrich, 1 Lale Fenske, 1 Huda Mussaffi, 3 Judit Horvath, 4 Manfred Fliegauf, 1
More informationHomozygosity Mapping of a Gene Locus for Primary Ciliary Dyskinesia on Chromosome 5p and Identification of the Heavy Dynein Chain DNAH5
Homozygosity Mapping of a Gene Locus for Primary Ciliary Dyskinesia on Chromosome 5p and Identification of the Heavy Dynein Chain DNAH5 as a Candidate Gene Heymut Omran, Karsten Häffner, Alexander Völkel,
More informationSupplementary figure legends
Supplementary figure legends SUPPLEMENTRY FIGURE S1. Lentiviral construct. Schematic representation of the PCR fragment encompassing the genomic locus of mir-33a that was introduced in the lentiviral construct.
More informationA 20-year experience of electron microscopy in the diagnosis of primary ciliary
ERJ Express. Published on October 19, 2009 as doi: 10.1183/09031936.00046209 A 20-year experience of electron microscopy in the diagnosis of primary ciliary dyskinesia Jean F Papon 1,2,3,4,5, Andre Coste
More informationUtilization of the MiSeq in a clinical lab. Tony Krentz, PhD PreventionGenetics
Utilization of the MiSeq in a clinical lab Tony Krentz, PhD PreventionGenetics PreventionGenetics Founded in 2004 in Marshfield, Wisconsin by James Weber ~90 employees Largest test menu in US Vision: Disease
More informationSperm dysfunction and ciliopathy
Reprod Med Biol (2016) 15:77 94 DOI 10.1007/s12522-015-0225-5 REVIEW ARTICLE Sperm dysfunction and ciliopathy Kazuo Inaba 1 Katsutoshi Mizuno 1,2 Received: 30 July 2015 / Accepted: 26 September 2015 /
More informationUniversity of Groningen
University of Groningen Ciliary Genes Are Down-Regulated in Bronchial Tissue of Primary Ciliary Dyskinesia Patients Geremek, Maciej; Zietkiewicz, Ewa; Bruinenberg, Marcel; Franke, Lude; Pogorzelski, Andrzej;
More informationMarta Puerto Plasencia. microrna sponges
Marta Puerto Plasencia microrna sponges Introduction microrna CircularRNA Publications Conclusions The most well-studied regions in the human genome belong to proteincoding genes. Coding exons are 1.5%
More informationAMDCC Progress Report Duke/UNC/Stanford Unit. Program Director Thomas M. Coffman, MD
AMDCC Progress Report Duke/UNC/Stanford Unit Program Director Thomas M. Coffman, MD Susceptibility Mutation Model Development + ApoE-/- +STZ Kidney Phenotype Screen Vascular & Kidney Phenotype Screen Generate
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 U1 inhibition causes a shift of RNA-seq reads from exons to introns. (a) Evidence for the high purity of 4-shU-labeled RNAs used for RNA-seq. HeLa cells transfected with control
More informationPrimary Ciliary Dyskinesia Clinical Presentation and Diagnosis. Douglas Conrad California Thoracic Society January, 2018
Primary Ciliary Dyskinesia Clinical Presentation and Diagnosis Douglas Conrad California Thoracic Society January, 2018 Disclosures Current Funding: NIH RO1 National CF Foundation Gilead Sciences Potential
More informationDiagnosis of primary ciliary dyskinesia: searching for a gold standard
EDITORIAL PRIMARY CILIARY DYSKINESIA Diagnosis of primary ciliary dyskinesia: searching for a gold standard Jane S. Lucas 1,2 and Margaret W. Leigh 3,4 Affiliations: 1 Primary Ciliary Dyskinesia Centre,
More informationPrimary ciliary dyskinesia (PCD) is a rare disease of children. Review. Picking up speed: advances in the genetics of primary ciliary dyskinesia
nature publishing group Picking up speed: advances in the genetics of primary ciliary dyskinesia Amjad Horani 1, Steven L. Brody 2 and Thomas W. Ferkol 1,3 Abnormal ciliary axonemal structure and function
More informationThe Alternative Choice of Constitutive Exons throughout Evolution
The Alternative Choice of Constitutive Exons throughout Evolution Galit Lev-Maor 1[, Amir Goren 1[, Noa Sela 1[, Eddo Kim 1, Hadas Keren 1, Adi Doron-Faigenboim 2, Shelly Leibman-Barak 3, Tal Pupko 2,
More informationClinical Genetics. Functional validation in a diagnostic context. Robert Hofstra. Leading the way in genetic issues
Clinical Genetics Leading the way in genetic issues Functional validation in a diagnostic context Robert Hofstra Clinical Genetics Leading the way in genetic issues Future application of exome sequencing
More informationSupplemental Information For: The genetics of splicing in neuroblastoma
Supplemental Information For: The genetics of splicing in neuroblastoma Justin Chen, Christopher S. Hackett, Shile Zhang, Young K. Song, Robert J.A. Bell, Annette M. Molinaro, David A. Quigley, Allan Balmain,
More informationThe Complexity of Simple Genetics
The Complexity of Simple Genetics? The ciliopathies: a journey into variable penetrance and expressivity Bardet-Biedl Syndrome Allelism at a single locus is insufficient to explain phenotypic variability
More informationMutations in the DNAH11 (axonemal heavy chain dynein type 11) gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia
Mutations in the DNAH11 (axonemal heavy chain dynein type 11) gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia Lucia Bartoloni*, Jean-Louis Blouin*, Yanzhen Pan,
More informationUnique among ciliopathies: primary ciliary dyskinesia, a motile cilia disorder Kavita Praveen, Erica E. Davis, and Nicholas Katsanis*
Published: 10 March 2015 2015 Faculty of 1000 Ltd Unique among ciliopathies: primary ciliary dyskinesia, a motile cilia disorder Kavita Praveen, Erica E. Davis, and Nicholas Katsanis* Address: Center for
More informationOriginal Article. C18orf1 located on chromosome 18p11.2 may confer susceptibility to schizophrenia
J Med Dent Sci 2003; 50: 225 229 Original Article C18orf1 located on chromosome 18p11.2 may confer susceptibility to schizophrenia Mika Kikuchi 1,2, Kazuo Yamada 1, Tomoko Toyota 1,2 and Takeo Yoshikawa
More informationAxonemal Dynein Intermediate-Chain Gene (DNAI1) Mutations Result in Situs Inversus and Primary Ciliary Dyskinesia (Kartagener Syndrome)
Am. J. Hum. Genet. 68:1030 1035, 2001 Report Axonemal Dynein Intermediate-Chain Gene (DNAI1) Mutations Result in Situs Inversus and Primary Ciliary Dyskinesia (Kartagener Syndrome) Cécile Guichard, 1 Marie-Cécile
More informationDIAGNOSIS OF PRIMARY CILIARY DYSKINESIA
DIAGNOSIS OF PRIMARY CILIARY DYSKINESIA Kris De Boeck, MD PHD Pediatric Pulmonology, University of Leuven, Belgium Introduction Cause Congenital dysfunction of motile cilia Absence/dysfunction of one of
More informationCS 6824: Tissue-Based Map of the Human Proteome
CS 6824: Tissue-Based Map of the Human Proteome T. M. Murali November 17, 2016 Human Protein Atlas Measure protein and gene expression using tissue microarrays and deep sequencing, respectively. Alternative
More informationAmbient temperature regulated flowering time
Ambient temperature regulated flowering time Applications of RNAseq RNA- seq course: The power of RNA-seq June 7 th, 2013; Richard Immink Overview Introduction: Biological research question/hypothesis
More informationDiscovery of Schizophrenia Drug Targets from DISC1 Mechanisms Atsushi Kamiya M.D., Ph.D.
Discovery of Schizophrenia Drug Targets 1 Assistant Professor Department of Psychiatry and Behavioral Sciences Johns Hopkins University School of Medicine akamiya1@jhmi.edu How does neurobiology offer
More informationvariant led to a premature stop codon p.k316* which resulted in nonsense-mediated mrna decay. Although the exact function of the C19L1 is still
157 Neurological disorders primarily affect and impair the functioning of the brain and/or neurological system. Structural, electrical or metabolic abnormalities in the brain or neurological system can
More informationARTICLE. Recessive HYDIN Mutations Cause Primary Ciliary Dyskinesia without Randomization of Left-Right Body Asymmetry
Recessive HYDIN Mutations Cause Primary Ciliary Dyskinesia without Randomization of Left-Right Body Asymmetry ARTICLE Heike Olbrich, 1,13 Miriam Schmidts, 2,13 Claudius Werner, 1,13 Alexandros Onoufriadis,
More informationSupporting Information
upporting Information Hartford et al. 10.1073/pnas.1113524108 I Results tructure of the Mcm9 Locus. Based on available ET and genomic sequence data, Yoshida (1) characterized mouse Mcm9 as encoding a protein
More informationMutations in the Caenorhabditis elegans U2AF Large Subunit UAF-1 Al= of a 3' Splice Site In Vivo
Mutations in the Caenorhabditis elegans U2AF Large Subunit UAF-1 Al= of a 3' Splice Site In Vivo The MIT Faculty has made this article openly available. Please share how this access benefits you. Your
More informationBIOL2005 WORKSHEET 2008
BIOL2005 WORKSHEET 2008 Answer all 6 questions in the space provided using additional sheets where necessary. Hand your completed answers in to the Biology office by 3 p.m. Friday 8th February. 1. Your
More informationTranscriptional repression of Xi
Transcriptional repression of Xi Xist Transcription of Xist Xist RNA Spreading of Xist Recruitment of repression factors. Stable repression Translocated Xic cannot efficiently silence autosome regions.
More informationCilia and flagella play important roles in many physiological
An intronic insertion in KPL2 results in aberrant splicing and causes the immotile short-tail sperm defect in the pig Anu Sironen*, Bo Thomsen, Magnus Andersson, Virpi Ahola, and Johanna Vilkki* *MTT Agrifood
More informationA Comprehensive Study of TP53 Mutations in Chronic Lymphocytic Leukemia: Analysis of 1,287 Diagnostic CLL Samples
A Comprehensive Study of TP53 Mutations in Chronic Lymphocytic Leukemia: Analysis of 1,287 Diagnostic CLL Samples Sona Pekova, MD., PhD. Chambon Ltd., Laboratory for molecular diagnostics, Prague, Czech
More informationSUPPLEMENTARY INFORMATION
doi: 1.138/nature8645 Physical coverage (x haploid genomes) 11 6.4 4.9 6.9 6.7 4.4 5.9 9.1 7.6 125 Neither end mapped One end mapped Chimaeras Correct Reads (million ns) 1 75 5 25 HCC1187 HCC1395 HCC1599
More informationStudying Alternative Splicing
Studying Alternative Splicing Meelis Kull PhD student in the University of Tartu supervisor: Jaak Vilo CS Theory Days Rõuge 27 Overview Alternative splicing Its biological function Studying splicing Technology
More informationNUMB is a break of WNT - Notch signaling cycle
INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 18: 517-521, 2006 517 NUMB is a break of WNT - Notch signaling cycle MASUKO KATOH 1 and MASARU KATOH 2 1 M&M Medical BioInformatics, Hongo 113-0033; 2 Genetics
More informationSupplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A.
Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Upper part, three-primer PCR strategy at the Mcm3 locus yielding
More informationBio 111 Study Guide Chapter 17 From Gene to Protein
Bio 111 Study Guide Chapter 17 From Gene to Protein BEFORE CLASS: Reading: Read the introduction on p. 333, skip the beginning of Concept 17.1 from p. 334 to the bottom of the first column on p. 336, and
More informationIMPC phenotyping SOPs in JMC
IMPC phenotyping SOPs in JMC Tissue Embedding and Block Banking IMPC_BLK_001 Purpose Collect and fix a standard list of tissues from the complete necropsy (see IMPC Gross Pathology & Tissue Collection
More informationSupplementary Figure 1. Linkage analysis of Family 7. Red arrow, position of SRRM2 gene in chromosome16.
A germline mutation in SRRM2, a splicing factor gene, is implicated in papillary thyroid carcinoma predisposition Jerneja Tomsic 1, Huiling He 1, Keiko Akagi 1, Sandya Liyanarachchi 1, Qun Pan 2, Blake
More informationREPORT Splice-Site Mutations in the Axonemal Outer Dynein Arm Docking Complex Gene CCDC114 Cause Primary Ciliary Dyskinesia
REPORT Splice-Site Mutations in the Axonemal Outer Dynein Arm Docking Complex Gene CCDC114 Cause Primary Ciliary Dyskinesia Alexandros Onoufriadis, 1,10 Tamara Paff, 2,3,4,10 Dinu Antony, 1 Amelia Shoemark,
More informationAnnotation of Chimp Chunk 2-10 Jerome M Molleston 5/4/2009
Annotation of Chimp Chunk 2-10 Jerome M Molleston 5/4/2009 1 Abstract A stretch of chimpanzee DNA was annotated using tools including BLAST, BLAT, and Genscan. Analysis of Genscan predicted genes revealed
More informationDifferentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell
Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Wenxin Li Department of Biological Sciences Fordham University Abstract MEFV is a human gene that codes for an
More informationThe classical genetic and genomic approach to the pathogenesis of primary ciliary dyskinesia Geremek, Maciej
University of Groningen The classical genetic and genomic approach to the pathogenesis of primary ciliary dyskinesia Geremek, Maciej IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's
More informationREPORT ARMC4 Mutations Cause Primary Ciliary Dyskinesia with Randomization of Left/Right Body Asymmetry
REPORT ARMC4 Mutations Cause Primary Ciliary Dyskinesia with Randomization of Left/Right Body Asymmetry Rim Hjeij, 1 Anna Lindstrand, 2 Richard Francis, 3 Maimoona A. Zariwala, 4 Xiaoqin Liu, 3 You Li,
More informationRECAP (1)! In eukaryotes, large primary transcripts are processed to smaller, mature mrnas.! What was first evidence for this precursorproduct
RECAP (1) In eukaryotes, large primary transcripts are processed to smaller, mature mrnas. What was first evidence for this precursorproduct relationship? DNA Observation: Nuclear RNA pool consists of
More informationLong non-coding RNAs
Long non-coding RNAs Dominic Rose Bioinformatics Group, University of Freiburg Bled, Feb. 2011 Outline De novo prediction of long non-coding RNAs (lncrnas) Genome-wide RNA gene-finding Intrinsic properties
More informationTransport of the outer dynein arm complex to cilia requires a cytoplasmic protein Lrrc6
Genes to Cells Transport of the outer dynein arm complex to cilia requires a cytoplasmic protein Lrrc6 Yasuko Inaba 1, Kyosuke Shinohara 1a, Yanick Botilde 1, Ryo Nabeshima 1, Katsuyoshi Takaoka 1, Rieko
More informationAnalyse de données de séquençage haut débit
Analyse de données de séquençage haut débit Vincent Lacroix Laboratoire de Biométrie et Biologie Évolutive INRIA ERABLE 9ème journée ITS 21 & 22 novembre 2017 Lyon https://its.aviesan.fr Sequencing is
More informationNicholas Katsanis, Ph.D.
Ciliopathies and Oligogenic Phenomena Prof. Center for Human Disease Modeling Duke University 1 Some key questions in human genetics What variants cause disease? What variants are associated with disease
More informationIntroduction to Cancer Biology
Introduction to Cancer Biology Robin Hesketh Multiple choice questions (choose the one correct answer from the five choices) Which ONE of the following is a tumour suppressor? a. AKT b. APC c. BCL2 d.
More informationSupplementary Figure 1 Transcription assay of nine ABA-responsive PP2C. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated
Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C genes. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated from 7 day-old seedlings treated with or without
More informationSALSA MLPA probemix P169-C2 HIRSCHSPRUNG-1 Lot C As compared to version C1 (lot C1-0612), the length of one probe has been adjusted.
mix P169-C2 HIRSCHSPRUNG-1 Lot C2-0915. As compared to version C1 (lot C1-0612), the length of one has been adjusted. Hirschsprung disease (HSCR), or aganglionic megacolon, is a congenital disorder characterised
More informationIdentification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4)
Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4) Vahagn Stepanyan Department of Biological Sciences, Fordham University Abstract: Alternative splicing is an
More informationMRC-Holland MLPA. Description version 18; 09 September 2015
SALSA MLPA probemix P090-A4 BRCA2 Lot A4-0715, A4-0714, A4-0314, A4-0813, A4-0712: Compared to lot A3-0710, the 88 and 96 nt control fragments have been replaced (QDX2). This product is identical to the
More informationSALSA MLPA probemix P185-C2 Intersex Lot C2-1015: As compared to the previous version C1 (lot C1-0611), the lengths of four probes have been adjusted.
mix P185-C2 Intersex Lot C2-1015: As compared to the previous version C1 (lot C1-0611), the lengths of four s have been adjusted. The sex-determining region on chromosome Y (SRY) is the most important
More informationAxonemal Beta Heavy Chain Dynein DNAH9: cdna Sequence, Genomic Structure, and Investigation of Its Role in Primary Ciliary Dyskinesia
Axonemal Beta Heavy Chain Dynein DNAH9: cdna Sequence, Genomic Structure, and Investigation of Its Role in Primary Ciliary Dyskinesia Lucia Bartoloni a, Jean- Louis Blouin a, Amit K. Maiti a, Amanda Sainsbury
More informationNature Genetics: doi: /ng Supplementary Figure 1. Assessment of sample purity and quality.
Supplementary Figure 1 Assessment of sample purity and quality. (a) Hematoxylin and eosin staining of formaldehyde-fixed, paraffin-embedded sections from a human testis biopsy collected concurrently with
More informationRecent advances in primary ciliary dyskinesia genetics
JMG Online First, published on October 28, 2014 as 10.1136/jmedgenet-2014-102755 Review Recent advances in primary ciliary dyskinesia genetics Małgorzata Kurkowiak, 1,2 Ewa Ziętkiewicz, 1 Michał Witt 1,2
More informationIn vitro culturing of ciliary respiratory cells a model for studies of genetic diseases
J Appl Genetics (2011) 52:39 51 DOI 10.1007/s13353-010-0005-1 HUMAN GENETICS REVIEW In vitro culturing of ciliary respiratory cells a model for studies of genetic diseases Zuzanna Bukowy & Ewa Ziętkiewicz
More informationDeep-Sequencing of HIV-1
Deep-Sequencing of HIV-1 The quest for true variants Alexander Thielen, Martin Däumer 09.05.2015 Limitations of drug resistance testing by standard-sequencing Blood plasma RNA extraction RNA Reverse Transcription/
More informationMuscular Dystrophy. Biol 405 Molecular Medicine
Muscular Dystrophy Biol 405 Molecular Medicine Duchenne muscular dystrophy Duchenne muscular dystrophy is a neuromuscular disease that occurs in ~ 1/3,500 male births. The disease causes developmental
More informationHands-On Ten The BRCA1 Gene and Protein
Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such
More informationMRC-Holland MLPA. Description version 14; 28 September 2016
SALSA MLPA probemix P279-B3 CACNA1A Lot B3-0816. As compared to version B2 (lot B2-1012), one reference probe has been replaced and the length of several probes has been adjusted. Voltage-dependent calcium
More informationHHS Public Access Author manuscript Nature. Author manuscript; available in PMC 2012 February 15.
Ktu/PF13 is required for cytoplasmic pre-assembly of axonemal dyneins Heymut Omran 1,*, Daisuke Kobayashi 2,*, Heike Olbrich 1,*, Tatsuya Tsukahara 3,*, Niki Tomas Loges 1, Haruo Hagiwara 4, Qi Zhang 5,
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationTranscriptome maps of Populus tomentosa: Characteristics and its applications
Transcriptome maps of Populus tomentosa: Characteristics and its applications PhD. Li bo & Pro.Zhang Zhiyi 2008.10.29 Discrete traits and quantitative traits Discrete trait: color, gender, et al Quantitative
More informationInference of Isoforms from Short Sequence Reads
Inference of Isoforms from Short Sequence Reads Tao Jiang Department of Computer Science and Engineering University of California, Riverside Tsinghua University Joint work with Jianxing Feng and Wei Li
More informationSupplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.
More informationWnt signaling. Ramray Bhat.
Wnt signaling Ramray Bhat ramray@mrdg.iisc.ernet.in Starting with animal biology and viral infections The discovery of certain laboratory murine strains that were highly susceptible to mammary gland cancer.
More informationSupplementary Figure S1: Alignment of CD28H. (a) Alignment of human CD28H with other known B7 receptors. (b) Alignment of CD28H orthologs.
Supplementary Figure S1: Alignment of CD28H. (a) Alignment of human CD28H with other known B7 receptors. (b) Alignment of CD28H orthologs. Predicted CD28H protein sequences from human, chimpanzee (pan
More informationMRC-Holland MLPA. Description version 08; 07 May 2015
mix P185-C1 Intersex Lot C1-0611: As compared to the previous version B2 (lot B2-0311), s for CYP21A2 have been removed and s for the CXorf21 gene as well as additional s for NR0B1, NR5A1 and the Y chromosome
More informationSex Determination and Gonadal Sex Differentiation in Fish
Sex Determination and Gonadal Sex Differentiation in Fish Yoshitaka Nagahama Okazaki National Research Institutes, Japan This first slide shows the processes of gonadal sex differentiation and gametogenesis
More informationImmune system 1. Please sit in row K or forward
Immune system 1 Please sit in row K or forward Random biological fact of the day (RBFD): cholera toxin and human signaling pathways Stomach Large intestine Small intestine Leodotia Pope, Department of
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Yatsenko AN, Georgiadis AP, Röpke A, et al. X-linked TEX11
More informationCASE REPORT. 1. Assistant Professor. Department of Paediatrics, Vinayaka Missions Medical College, Karaikal
A CASE OF KARTAGENER SYNDROME Pagadpally Srinivas 1. Assistant Professor. Department of Paediatrics, Vinayaka Missions Medical College, Karaikal CORRESPONDING AUTHOR: Pagadpally Srinivas, 72, Vellai Pillaiyar
More informationBioinformation by Biomedical Informatics Publishing Group
Predicted RNA secondary structures for the conserved regions in dengue virus Pallavi Somvanshi*, Prahlad Kishore Seth Bioinformatics Centre, Biotech Park, Sector G, Jankipuram, Lucknow 226021, Uttar Pradesh,
More informationCharacterizing intra-host influenza virus populations to predict emergence
Characterizing intra-host influenza virus populations to predict emergence June 12, 2012 Forum on Microbial Threats Washington, DC Elodie Ghedin Center for Vaccine Research Dept. Computational & Systems
More informationSALSA MLPA probemix P241-D2 MODY mix 1 Lot D As compared to version D1 (lot D1-0911), one reference probe has been replaced.
mix P241-D2 MODY mix 1 Lot D2-0413. As compared to version D1 (lot D1-0911), one reference has been replaced. Maturity-Onset Diabetes of the Young (MODY) is a distinct form of non insulin-dependent diabetes
More informationLecture 3-4. Identification of Positive Regulators downstream of SA
Lecture 3-4 Identification of Positive Regulators downstream of SA Positive regulators between SA and resistance/pr Systemic resistance PR gene expression? SA Local infection Necrosis SA What could they
More informationProcessing of RNA II Biochemistry 302. February 14, 2005 Bob Kelm
Processing of RNA II Biochemistry 302 February 14, 2005 Bob Kelm What s an intron? Transcribed sequence removed during the process of mrna maturation (non proteincoding sequence) Discovered by P. Sharp
More informationPRIMARY CILIARY DYSKINESIA
PRIMARY CILIARY DYSKINESIA 485 Ikezoe J, Johkoh T, Kohno N, et al. (1996) High-resolution CT findings of lung disease in patients with polymyositis and dermatomyositis. Journal of Thoracic Imaging 11:
More informationA suppressor locus for MODY3-diabetes
A suppressor locus for MODY3-diabetes Miguel A. Garcia-Gonzalez 1,2, Claire Carette 1,3, Alessia Bagattin 1, Magali Chiral 1, Munevver Parla Makinistoglu 1, Serge Garbay 1, Géraldine Prévost 4, Cécile
More informationThe functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein
THESIS BOOK The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein Orsolya Buzás-Bereczki Supervisors: Dr. Éva Bálint Dr. Imre Miklós Boros University of
More informationSUPPLEMENTARY INFORMATION
Supplementary Information included with Nature MS 2008-02-01484B by Colantonio et al., entitled The dynein regulatory complex is required for ciliary motility and otolith biogenesis in the inner ear. This
More informationBST227 Introduction to Statistical Genetics. Lecture 4: Introduction to linkage and association analysis
BST227 Introduction to Statistical Genetics Lecture 4: Introduction to linkage and association analysis 1 Housekeeping Homework #1 due today Homework #2 posted (due Monday) Lab at 5:30PM today (FXB G13)
More informationBWA alignment to reference transcriptome and genome. Convert transcriptome mappings back to genome space
Whole genome sequencing Whole exome sequencing BWA alignment to reference transcriptome and genome Convert transcriptome mappings back to genome space genomes Filter on MQ, distance, Cigar string Annotate
More informationThe Emergence of Alternative 39 and 59 Splice Site Exons from Constitutive Exons
The Emergence of Alternative 39 and 59 Splice Site Exons from Constitutive Exons Eli Koren, Galit Lev-Maor, Gil Ast * Department of Human Molecular Genetics, Sackler Faculty of Medicine, Tel Aviv University,
More informationAccessing and Using ENCODE Data Dr. Peggy J. Farnham
1 William M Keck Professor of Biochemistry Keck School of Medicine University of Southern California How many human genes are encoded in our 3x10 9 bp? C. elegans (worm) 959 cells and 1x10 8 bp 20,000
More informationMRC-Holland MLPA. Description version 08; 18 November 2016
SALSA MLPA probemix P122-D1 NF1 AREA Lot D1-1016. As compared to lot C2-0312, four probes in the NF1 area and one reference probe have been removed, four reference probes have been replaced and several
More informationRNA-seq Introduction
RNA-seq Introduction DNA is the same in all cells but which RNAs that is present is different in all cells There is a wide variety of different functional RNAs Which RNAs (and sometimes then translated
More informationThis is an Open Access document downloaded from ORCA, Cardiff University's institutional repository:
This is an Open Access document downloaded from ORCA, Cardiff University's institutional repository: http://orca.cf.ac.uk/102603/ This is the author s version of a work that was submitted to / accepted
More informationGenome 371, Autumn 2018 Quiz Section 9: Genetics of Cancer Worksheet
Genome 371, Autumn 2018 Quiz Section 9: Genetics of Cancer Worksheet All cancer is due to genetic mutations. However, in cancer that clusters in families (familial cancer) at least one of these mutations
More information