Imperfection of Drug Therapy
|
|
- Joanna Sullivan
- 5 years ago
- Views:
Transcription
1 Dcrasd Nuclar Rcptor ctivity diats Downrgulation of Drug tabolizing s in Chronic Kidny Disas Through Epigntic Modulation Octobr 2, 214 Brad Urquhart, PhD ssistant Profssor Dpartmnt of Physiology and Pharmacology Dpartmnt of dicin (Nphrology, Clinical Pharmacology) Dpartmnt of Padiatrics Lawson Halth Rsarch Institut Dpartmnt of Physiology and Pharmacology Imprfction of Drug Thrapy Disas Gntics Environmnt Factors diating Drug Disposition bsorption Distribution tabolism Excrtion Yungt al. Kidny Intrnational (214) Chronic Kidny Disas (CKD) Prcnt of population Stag Dscription GFR (ml/min/1.72m 2 ) 1 Kidny damag with normal or GFR 2 Kidny damag with mild GFR Modrat GFR Svr GFR Kidny failur <15 or anuric Charactrizd by a progrssiv dclin in rnal function ovr tim. Major causs of CKD includ diabts and rnal vascular disas (including high blood prssur) CKD is stimatd to affct btwn 1.9 million and 2.3 million Canadians m J Kidny Dis. 211;57(3)(suppl 2):S32-S56 1
2 Drugs and CKD Patints with CKD tak 7-12 mdications concurrntly to control a varity of comorbiditis. Ths patints hav an incrasd incidnc of advrs drug vnts, oftn du to incrasd blood drug concntrations. Many drugs ar xcrtd by th kidny so GFR adjustd dosing in patints with CKD is common. Drug Elimination Dos CKD impact hpatic drug mtabolism? tabolism Rnal Bil Winkrs and Hath (25) Nat Rv Drug Discov. 4 (1) Cytochrom P45 diatd Drug tabolism 3 2D6 2C 2E1 1 Shimada t al. (1994) J. Pharmacol. Exp. Thr. 27 (1) Nuclar Rcptor and Epigntic Changs in 3 and 2C diatd tabolism in CKD. Hypothsis ltrd drug mtabolism in CKD is scondary to dcrasd nuclar rcptor binding to th 3 and 2C promotr which is associatd with histon modulation. Objctiv 1. To dtrmin nuclar rcptor binding in CKD. 2. To invstigat th pigntic modulation of hpatic drug mtabolizing nzyms in CKD. 3. To valuat urmic toxins that may downrgulat hpatic 3. 2
3 Nuclar Rcptors Gn On H4 Modifid from Huss t al ctivating Gn Off K4 R3 H4 XRE RN Pol II TT 3 Silncing K9 K27 2C * Srum Cratinin (µm) Control CKD Vlnosit al. (214) FSEB J 3
4 Vlnosit al. (214) FSEB J Vlnosit al. (214) FSEB J Vlnosit al. (214) FSEB J 4
5 Possibl chanism For Hpatic Drug tabolizing Down- rgulation in CKD. tabolomics CONTROL chanism? UREMI Hundrds of urmic toxins accumulat in kidny disas. Do any of thm accumulat in th livr? Snsitiv QTOF mass spctromtr: can quantify and idntify small molculs. pplication to drug toxicity : pharmacomtabolomics XEVO-G2-S Mass Spctromtr Control tabolomic Invstigation Homogniz in actonitril Scors Plot: Control vs. CKD 1 t[2]o CKD Control Chronic Kidny Disas -1 Homogniz in actonitril -2-3 UPLC-MS t[1]p EZinf o 2 - CKD ST-12 Rat Livr Ng Mod Control v s CKD (M2: OPLS-D) :3:1 (UTC-5) Hnnop, Vlnosi t al. unpublishd 5
6 EZinf o 2 - CKD ST-12 Rat Liv r Ng Mod Control vs CKD (M2: OPLS-D) :1:14 (UTC-5) 1/31/214 tabolomics of Livr Sampls in CKD Conclusions and Futur Dirctions p(corr)[1]p (Corrlation) S-Plot (Control = -1, CKD = 1) CONCLUSIONS PXR and HNF4α binding to 2C11 and 32 promotrs is dcrasd in CKD. Changs in histon actylation ar associatd with dcrasd 2C11 and 32 xprssion in CKD. FUTURE DIRECTIONS tabolomic invstigation to dtrmin which urmic toxins ar lvatd in th livr p[1]p (Loadings) cknowldgmnts Urquhart lab Dav Fr, MSc nzl Hnnop ndrw Kucy lvin Tiu Dr. Bn Thomson Tom Vlnosi ndrw Wong Collaborators Dr. Tom Nolin (Univrsity of Pittsburgh) Dr. ndrw Hous Linda shr, RN Tom Vlnosi, PhD Candidat David Fr, MSc Dr. Bn Thomson Rlativ Exprssion DMSO Indoxyl Sulfat * * Cocktail Vlnosi t al. unpublishd Cocktail: CMPF Cratinin P-Crsyl sulfat Indoxyl Sulfat Guanidinosuccinic acid Hippuric acid Indol-3-actic acid thylguanidin Ura 6
7 Possibl chanism For Hpatic Drug tabolizing Down- rgulation in CKD. Rlativ Exprssion (% Control) Normal Urmia * * Log [Indoxyl Sulfat] µm I CONTROL UREMI chanism? Indoxyl Sulfat? NO FBS dia FBS dia Vlnosi t al. unpublishd 7
Cerebrovascular disease Defined from diagnosis ICD10: I60-69, ICD8:
Supplmntary Tabl 1: ICD cods Diagnoss, surgical procdurs, and pharmacothrapy usd for dfining th study population, comorbidity, and outcoms Study population Myocardial Infarction ICD8: 430 ICD10: I21-22
More informationPHA Case Study III (Answers)
PHA 5128 as Study III (Answrs) 1. TL is a 25 yar old mal who was admittd for a soft tissu infction in his abdomn. H is 5'10", 175 Ibs, WB 19, and BUN/Sr 12/1.1. Wound culturs ar positiv for Klbsilla pnumonia.
More informationSan Raffaele Hospital and Emo Centro Cuore Columbus Milan- Italy
Stnt-basd Stabilization of Rupturd Carotid Plaqus: Clinical Lssons and Biomarkrs Pattrns from th SUBMARINE Study, and Rlvanc to th Coronary Condition Giuspp Sangiorgi, FESC, FSCAI San Raffal Hospital and
More informationCombined use of calcipotriol solution (SOp.g/ ml) and Polytar liquid in scalp psoriasis.
MCS9506INT 27 April1999 Pag 11 of 189 Summary This documnt has bn dov.;nloadd from \v\vw.lo-pharma.com subjct to th trms of us stat on th wbsit. It contains data and rsults rgarding approvd and non-approvd
More informationPHA Exam 1. Spring 2013
PHA 5128 Exam 1 Spring 2013 1 Antibiotics (5 points) 2 Body Wight/Pdiatrics (5 points) 3 Rnal Disas (10 points) 4 Aminoglycosids (5 points) 5 Amikacin (10 points) 6 Gntamicin (10 points) 7 Aminoglycosids
More informationGentamicin Therapy Induced Functional Type VII Collagen in RDEB Patients Harboring Nonsense Mutations. David T. Woodley and Mei Chen
Gntamicin Thrapy Inuc Functional Typ VII Collagn in RDEB Patints Harboring Nonsns Mutations Davi T. Wooly an Mi Chn Dpartmnt of Drmatology, Univrsity of Southrn California, Los Angls, CA EB2017 Mting,
More informationExercise and Physical Activity Resource Center. eparc.ucsd.edu
Exrcis and Physical Activity Rsourc Cntr parc.ucsd.du EPARC: Th Cutting Edg of Exrcis Scinc Th Exrcis and Physical Activity Rsourc Cntr (EPARC) at UCSD is a joint vntur btwn th Dpartmnt of Family and Prvntiv
More informationDecreased Glycaemia with Renal Failure in Diabetes Betides in Relation to the Change in Renal Glutamate Metabolism
Rsarch Articl imdpub Journals http://www.imdpub.com/ DOI: 10.21767/2472-5056.100055 Dcrasd Glycamia with Rnal Failur in Diabts Btids in Rlation to th Chang in Rnal Glutamat Mtabolism Susumu Ogawa 1,2*,
More informationP215 Cardiovascular System Blood Vessels Chapter 14 Introduction
P215 Cardiovascular Systm Blood Vssls Chaptr 14 Introduction vins tubs for blood flow lumn - for blood flow wall - Blood Flow Through Blood Vssls largst vins hart largst artris blood always containd by
More informationDifficult Heat Illness Problems; EAMC & Rhabdomyolysis
This This This Forms of Hat Illnss Difficult Hat Illnss Problms; EAMC & Rhabdomyolysis Jorg E. Gómz, M.D. Associat Profssor Txas Childrn s Hospital, Baylor Collg of Mdicin - Houston Hat syncop Exrcis Associatd
More informationDiminished 11β-Hydroxysteroid Dehydrogenase Type 2 Activity Is Associated With Decreased Weight and Weight Gain Across the First Year of Life
Diminishd β-hydroxystroid Dhydrognas Typ 2 Activity Is Associatd With Dcrasd Wight and Wight Gain Across th First Yar of Lif Samantha L. Rogrs, Bvrly A. Hughs, Christophr A. Jons, Laurn Frdman, Kathrin
More informationYOUR VIEWS ABOUT YOUR HIGH BLOOD PRESSURE
YOUR VIEWS ABOUT YOUR HIGH BLOOD PRESSURE W ar intrstd in your viws about your high blood prssur. Ths ar statmnts othr popl hav mad about thir high blood prssur. Plas show how much you or dis with ach
More informationREGRESSION ASSOCIATION VS. PREDICTION
BIOSTATISTICS WORKSHOP: REGRESSION ASSOCIATION VS. PREDICTION Sub-Saharan Africa CFAR mting July 18, 2016 Durban, South Africa Rgrssion what is it good for? Explor Associations Btwn outcoms and xposurs
More informationOriginal article Scand J Work Environ Health 1976;2(1):27-30 doi: /sjweh.2824
Downloadd from www.sjwh.fi on Novmbr 6, 212 Original articl Scand J Work Environ Halth 1976;2(1):27-3 doi:1.5271/sjwh.2824 Eight-yar follow-up of viscos rayon workrs xposd to carbon disulfid. by Hrnbrg
More informationDr She Lok, Dr David Greenberg, Barbara Gill, Andrew Murphy, Dr Linda McNamara
Dr Sh Lok, Dr David Grnbrg, Barbara Gill, Andrw Murphy, Dr Linda McNamara This is a joint working projct btwn Mount Vrnon Cancr ntwork and Roch Products Ltd. 1 Introduction Dscrib th work that Mount Vrnon
More informationGoing Below the Surface Level of a System This lesson plan is an overview of possible uses of the
Titl Acknowldgmnts Ovrviw Lngth Curriculum Contxt Lsson Objctiv(s) Assssmnt Systms Thinking Concpt(s) Instructional Considrations Matrials Going Blow th Surfac Lvl of a Systm This lsson plan is an ovrviw
More informationEXPERIMENTAL DRYING OF TOBACCO LEAVES
6 TH INTERNATIONAL MULTIDISCIPLINARY CONFERENCE EXPERIMENTAL DRYING OF TOBACCO LEAVES Bndk Krks and Tamás Antal Collg of Nyírgyháza, Faculty of Enginring and Agricultur, H-441 Nyírgyháza, Hungary, E-mail:
More informationSign up is easy no personal information needed. Reserve your spot today:
, fr v i t f us ma nt in r o J fo Ev in IV H a r o v cti. sp l r tab p t n to th r f t dif n a tm ing tra g in Br HIV on Sign up is asy no prsonal information ndd. Rsrv your spot today: 1-844-815-0537
More information7 C S 7 P S H. t u p P F G IB: HSP70 IB: HSC70
a b Human HSP7 Human HSC7 Human BIP Mus musculus Drosophila auraria S. Crvisia Ssa1 S. Pomb SPAC13G7.2c E.Coli DnaK IB: Panmthyl lysin IB: HSP7 t u p In P F G ALESYAFNMKSAVED-EGLKGKISEADKKKVLDKCQEVISML
More informationHepatic cholesterol metabolism in cholesterol gallstone disease
Hpatic cholstrol mtabolism in cholstrol gallston disas Eva RihnCr, Bo Anglin, Ingmar Bjorkhm, and Kurt Einarsson Dpartmnts of Surgry, Clinical Chmistry, and Mdicin, Mtabolism Unit, Karolinska Institutt
More informationAGE DETERMINATION FROM RADIOLOGICAL STUDY OF EPIPHYSIAL APPEARANCE AND FUSION AROUND ELBOW JOINT *Dr. S.S. Bhise, **Dr. S. D.
AGE DETERMINATION FROM RADIOLOGICAL STUDY OF EPIPHYSIAL APPEARANCE AND FUSION AROUND ELBOW JOINT *Dr. S.S. Bhis, **Dr. S. D. Nanandkar * Corrsponding author, Assistant profssor, Fornsic mdicin dpt., Grant
More informationCatriona Crossan Health Economics Research Group (HERG), Brunel University
MAPGuid: Modlling of clinical pathways to assss cost-ffctivnss in NICE guidlins: impact on stakholdr viws of th importanc of potntial updat topics Catriona Crossan Halth Economics Rsarch Group (HERG),
More informationLow density lipoprotein metabolism in the normal to moderately elevated range of plasma cholesterol: comparisons with familial hypercholesterolemia
Low dnsity lipoprotin mtabolism in th normal to modratly lvatd rang of plasma cholstrol: comparisons with familial hyprcholstrolmia Lon. Simons, Santhirasgaram Balasubramaniam, and John Holland Univrsity
More informationFESTSCHRIFT SECTION ' *, Familial polycythemia vera ROBIN L. MILLER, MD; JOSEPH D. PURVIS III, MD; JAMES K. WEICK, MD
FESTSCHRIFT SECTIN ' *, Familial polycythmia vra RBIN L. MILLER, MD; JSEPH D. PURVIS III, MD; JAMES K. WEICK, MD Th occurrnc of polycythmia vra in a fathr, mothr, and two sons is rportd. Thirtn kindrds
More informationEVALUATION OF DIAGNOSTIC PERFORMANCE USING PARTIAL AREA UNDER THE ROC CURVE. Hua Ma. B.S. Sichuan Normal University, Chengdu, China, 2007
EVALUATION OF DIAGNOSTIC PERFORMANCE USING PARTIAL AREA UNDER THE ROC CURVE by Hua Ma B.S. Sichuan Normal Univrsity, Chngdu, China, 2007 M.S. Xiamn Univrsity, Xiamn, China, 2010 Submittd to th Graduat
More informationList 3 ways these pictures are the same, and three ways they are different.
List 3 ways ths picturs ar th sam, and thr ways thy ar diffrnt. Human Nuron Comptition i i i i Follow dirctions on th sht in Bindr. 1. Mak Storyboard today and all plans to show nuron firing 2. Monday
More information1/28/18. DNA Replication. Watson and Crick. Double helix structure of DNA article in Nature
Rplication 2007-2008 Watson and Crick 19 articl in Natur Doubl hlix structur of It has not scapd our notic that th spcific pairing w hav postulatd immdiatly suggsts a possibl copying mchanism for th gntic
More informationPercentage of Non-Caucasians in Clinical Trials from 2000 to By Meghanadh Yerram E Special Project
Prcntag of Non-Caucasians in Clinical Trials from 2000 to 2009 By Mghanadh Yrram E01039061 Spcial Projct Submittd to th School of Halth Scincs Eastrn Michigan Univrsity In partial fulfillmnt of th rquirmnts
More informationA e C l /C d. S j X e. Z i
DESIGN MODIFICATIONS TO ACHIEVE LOW-BOOM AND LOW-DRAG SUPERSONIC CONCEPTUAL DESIGNS Danil. B. L Advisor: Prof. Jams C. McDanil Univrsity of Virginia, Charlottsvill, VA 94 NASA Mntor: Dr. Wu Li NASA Langly
More informationProbability, Genetics, and Games
" Probability, Gntics, and Gams Hav you vr hard of gns? (W don t man th kind you war!) What color ar your ys? Can you curl your tongu? Your birth parnts gav you a uniqu st of gns that dtrmin such things.
More informationMonolysocardiolipin in cultured fibroblasts is a sensitive and specific marker for Barth Syndrome. 1 To whom correspondence should be addressed.
mthods Monolysocardiolipin in culturd fibroblasts is a snsitiv and spcific markr for Barth Syndrom Michil Adriaan van Wrkhovn,* David Ross Thorburn,*,, Agi Kyra Gdon,**, and Jams Jonathon Pitt 1, Murdoch
More informationAMIA 2009 Symposium Proceedings Page - 109
Th Contribution of Obsrvational Studis and Clinical Contxt Information for Guiding th Intgration of Infobuttons into Clinical Information Systms Jams J. Cimino, MD Laboratory for Informatics Dvlopmnt,
More informationPresentation to the Senate Committee on Health & Human Services June 16, The University of Texas Health Science Center at Houston (UTHealth)
Prsntation to th Snat Committ on Halth & Human Srvics Jun 16, 2016 Th Univrsity of Txas Halth Scinc Cntr at Houston (UTHalth) Stphn Glazir, MBA, FACHE Chif Oprating Officr, UTHalth HCPC 1 Th UTHalth Harris
More informationFood & Function Accepted Manuscript
Food & Function Accptd Manuscript This is an Accptd Manuscript, which has bn through th Royal Socity of Chmistry pr rviw procss and has bn accptd for publication. Accptd Manuscripts ar publishd onlin shortly
More informationAdolescent Medicine. Management and Referral Guidelines
Adolscnt Mdicin Providd by Adolscnt Mdicin Maria Mong, MD, FAAP Dian Rainosk, PPCNP-BC Pdiatric/Adolscnt Gyncology Roshi Mansouri Zinn, MD, FACOG 1 Eating Disordrs (F50.0-F50.8) and thir Mdical Complications
More informationAPPLYING THE MIXED RASCH MODEL TO THE FRACTION CONCEPT OF PUPILS
Intrnational Journal of Innovativ Managmnt, Information & Production ISME Intrnationalc200 ISSN 285-5439 Volum, Numbr, Dcmbr 200 PP. 90-96 APPLYING THE MIXED RASCH MODEL TO THE FRACTION CONCEPT OF PUPILS
More informationOxygen therapy. Something in the Air Hyperbarics Breathe Life. By Carolyn Heneghan
Oxygn thrapy Somthing in th Air Hyprbarics Brath Lif into TBI and PTSD Thrapy By Carolyn Hnghan Traumatic brain injury is on th ris in th U.S. Th CDC rportd that btwn 2001 and 2010, rats of TBI-rlatd mrgncy
More informationInfluence of Oral S-Adenosylmethionine on Plasma 5-Methyltetrahydrofolate, S-Adenosylhomocysteine, Homocysteine and Methionine in Healthy Humans 1
0022-3565/97/2822-0845$03.00/0 THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS Vol. 282, No. 2 Copyright 1997 by Th Amrican Socity for Pharmacology and Exprimntal Thraputics Printd in U.S.A.
More informationTUESDAY, JUNE 12, 2018
5 2 N JU 8 0 2 R A N I L G B S DU D L AN IR www.sgar.org an p o r u y Socit ointstinal tr of Gas ominal d and Ab gy o Radiol W I V R V O A r s at Cou u d a r g t Pos ing and t l nua th 2 9 An PROGR TUSDAY,
More informationOffice of Emergency Services (3055P)
Offic of Emrgncy Srvics (3055P) Dpartmnt: Shriff's Offic FY 2003 and 2004 Rcommndd Budgt Offic of Emrgncy Srvics (3055P) Program Outcom Statmnt Th Shriff s Offic of Emrgncy Srvics provids sarch and rscu;
More informationComparison of Efficacy of Rifaximin and Norfloxacin in Prevention of Spontaneous Bacterial Peritonitis.
DOI: 10.21276/aimdr.2018..2.ME9 Original Articl ISSN (O):2395-2822; ISSN ():2395-281 Comparison of Efficacy of Rifaximin and Norfloxacin in rvntion of Spontanous Bactrial ritonitis. Sushil Narang 1, Nilsh
More informationEnzymatic Reaction Steps E + S ES ES* EP E + P
Enzymatic Raction Stps stp I stp II stp III stp IV E + S ES ES* EP E + P stp I stp II stp III stp IV binding of substrat (usually fast) formation of transition stat convrsion of transition stat to product
More informationInternational Journal of Basic and Applied Physiology
Origin Artic Intrnation Journ of Basic and Appid Physioogy TO EVALUATE CARDIOVASCULAR RISK BY ASSESSING ATHEROGENIC INDEX OF PLASA IN PREHYPERTENSIVES AND HYPERTENSIVES Pooja sharma*, Rajprabha**, Bk Binawara**,
More informationShort notes on Vitamins and Minerals required by healthy body
Short nots on Vitamins and Minrals rquird by halthy body 1. Essntial nutrints for your body Ky Points Vitamins and minrals ar ssntial nutrints bcaus thy prform hundrds of rols in th body. Thr is a fin
More informationOptimize Neural Network Controller Design Using Genetic Algorithm
Procdings of th 7th World Congrss on Intllignt Control and Automation Jun 25-27, 28, Chongqing, China Optimiz Nural Ntwork Controllr Dsign Using Gntic Algorithm Aril Kopl, Xiao-Hua Yu Dpartmnt of Elctrical
More informationSupplementary Online Content
Supplmntary Onlin Contnt Luk C, Jons S, Thomas C, t al. Diagnosi spora Crutzfldt-Jakob disas by th dtction of abnormal prion protin in patint urin. JAMA Nurol. Publishd onlin Octobr 3, 2016. doi:10.1001/jamanurol.2016.3733
More informationOrthopedics Update. «Die Kinderhüfte» 24. November The importance of bony. reconstruction in dislocated hip in patients with cerebral palsy
Th importanc of bony Orthopdics Updat rconstruction in dislocatd hip in patints with crbral palsy «Di Kindrhüft» 24. Novmbr 2011 Stfan Diraur Goal in patints with crbral palsy prvntion of p o rth O U s
More informationClinical Testing for Healthcare Cost Reduction
Clinical Tsting for Halthcar Cost Rduction 10401 Town Park Driv, Houston, Txas 77072 800.227.5227 www.spctracll.com 2012 SpctraCll Laboratoris, Inc. All rights rsrvd. Doc 239 11.12 SpctraCll was stablishd
More informationOver the last decade, several studies have demonstrated. Surgical considerations for tremor and dystonia ABSTRACT
SCOTT COOPER, MD, PhD Cntr for Nurological Rstoration, Clvland Clinic, Clvland, O MARK BOWES, PhD Scinc Writr Portland, OR Surgical considrations for trmor and dystonia ABSTRACT Dp rain stimulation (DBS)
More informationHow Asset Maintenance Strategy Selection Affects Defect Elimination, Failure Prevention and Equipment Reliability
Availability P +61 (0) 402 731 563 F +61 (8) 9457 8642 E info@liftim-rliability.com How Asst aintnanc Stratgy Slction Affcts Dfct Elimination, Failur Prvntion and Equipmnt Rliability ABSTRACT: Th 20 th
More informationMagnetic Field Exposure Assessment of Lineman Brain Model during Live Line Maintenance
Procdings of th 14 th Intrnational Middl ast Powr Systms Confrnc (MPCON 10), Cairo Univrsity, gypt, Dcmbr 19-1, 010, Papr ID 109 Magntic Fild xposur Assssmnt of Linman rain Modl during Liv Lin Maintnanc
More information8,000. Cytokine concentration 6,000. (pg ml 1 ) 4,000 2,000. c Colon histological score. Isotype. Anti-IL-17. Isotype
Vol 9 April 1 doi:1.13/natur99 Innat lymphoid clls driv intrlukin-3-dpndnt innat intstinal pathology Sofia Buonocor 1, Philip P. Ahrn 1, Holm H. Uhlig 3, Ivaylo I. Ivanov, Dan R. Littman, Kvin J. Maloy
More informationEvaluation of Accuracy of U.S. DOT Rail-Highway Grade Crossing Accident Prediction Models
166 TRANSPORTATION RESEARCH RECORD 1495 Evaluation of Accuracy of U.S. DOT Rail-Highway Grad Crossing Accidnt Prdiction Modls M.I. MUTABAZI AND W.D. BERG Svral vrsions of th U.S. Dpartmnt of Transportation
More informationL46. SPATIAL NAVIGATION. Rattus norvegicus. BioNB424
BioNB424 Nov. 16, 2011 L46. SPATIAL NAVIGATION Rattus norvgicus What do w know about th cology of rats? Cosmopolitan Rattus norvgicus Human sttlmnts Nocturnal CA1 nuron Dit L = W= Origin 1 2 Rattus blongs
More informationDifference in Characteristics of Self-Directed Learning Readiness in Students Participating in Learning Communities
Advancd Scinc and Tchnology Lttrs, pp.135-14 http://dx.doi.org/1.14257/astl.215.92.28 Diffrnc in Charactristics of Slf-Dirctd Larning Radinss in Studnts Participating in Larning Communitis Hur, Young Ju
More informationThe CASC15 Long Intergenic Noncoding RNA Locus Is Involved in Melanoma Progression and Phenotype Switching
ORIGINAL ARTICLE Th CASC15 Long Intrgnic Noncoding RNA Locus Is Involvd in Mlanoma Progrssion and Phnotyp Switching Laurnt Lssard 1, Michll Liu 1, Digo M. Marzs 1, Hongwi Wang, Klly Chong 1, Nal Kawas
More informationContext-dependent and invariant associations between lipids, lipoproteins, and apolipoproteins and apolipoprotein E genotype
Contxt-dpndnt and invariant associations btwn lipids, lipoprotins, and apolipoprotins and apolipoprotin E gnotyp Ruth Frikk-Schmidt,*, Børg G. Nordstgaard,*,, ** Birgit Agrholm-Larsn,* Ptr Schnohr,** and
More informationFusarium vs. Soybean
Fusarium vs. Soyban Gnsata, a company which proucs soyban s for commrcial sal in Nbraska, is rsponing to th migration of Sun Dath Synrom (SDS) into Nbraska soyban fils. An infstation of SDS is far which
More informationO H S Obesity Hypoventilation Syndrome
O H S Obsity Hypovntilation Syndrom Nichol Ganoung, MHS, PA-C nichol.ganoung@haysmd.com Pulmonary/Critical Car/Slp Mdicin Objctivs 1. Undrstand th dfinition of OHS. 2. Rviw th patho of vntilation control
More informationDiabete s & hy p e r te n sio n
4 Dabt s & hy p r t n so n I was not awar of how hgh blood prssur can affct th kdnys. I was talkng othr popl who had attndd (th scrnng) and th commnts wr vry postv. Svral told m thy dd not know thy had
More informationContents. Primal Body
b Contnts xnnnnnnnnnnnn Primal Body, Primal Mind Byond th Palo Dit for Total Halth and a Longr Lif By Nora T. Gdgaudas, CNS, CNT ISBN 978-1-59477-413-3 $19.95 Quality Paprback Jun 2011 384 pags; 6 9 28
More informationEconometric Analysis of Malnutrition Severity Among Under Five Children in Bangladesh
Dhaka Univ. J. Sci. 62(1): 1-6, 2014 (January) Economtric Analysis of Malnutrition Svrity Among Undr Fiv Childrn in Bangladsh *Author for Corrspondnc. -mail: mostafastat@yahoo.com Khnd. Md. Mostafa Kamal
More informationLipoprotein lipase in plasma after an oral fat load: relation to free fatty acids
Lipoprotin lipas in plasma aftr an oral fat load: rlation to fr fatty acids Frdrik Karp,l.* Thomas Olivcrona,t Goran Walldius? and Andrs Hamstn* King Gustav V Rsarch Institut and Dpartmnt of Mdicin,' Karolinska
More informationVaccines 2013, 1, ; doi: /vaccines Article. Deanna Kruszon-Moran 1, *, R. Monina Klevens 2 and Geraldine M.
Vaccins 2013, 1, 105-119; doi:10.3390/vaccins1020105 Articl OPEN ACCESS vaccins ISSN 2076-393X www.mdpi.com/journal/vaccins Chang in Hpatitis A Sroprvalnc among U.S. Childrn and Adolscnts: Rsults from
More informationMATH 1300: Finite Mathematics EXAM 2 15 March 2017
MATH 1300: Finit Mathmatics EXAM 2 15 March 2017 NAME:... SECTION:... INSTRUCTOR:... SCORE MC:(A) /12 * 7 = LA: /16 = Total: /100 = % INSTRUCTIONS 1. DO NOT OPEN THIS EXAM UNTIL INSTRUCTED TO BY YOUR ROOM
More informationAnal Cancer Incidence in the United States, : Distinct Patterns by Histology and Behavior
Publishd OnlinFirst July 29, 205; DOI:.58/55-9965.EPI-5-0044 Rsarch Articl Anal Cancr Incidnc in th Unitd Stats, 977 20: Distinct Pattrns by Histology and Bhavior Mrdith S. Shils, Aim R. Krimr, Anna E.
More informationBreast-cancer-secreted mir-122 reprograms glucose metabolism in premetastatic niche to promote metastasis
A RT I C L E Brast-cancr-scrtd mir- rprograms glucos mtabolism in prmtastatic nich to promot mtastasis iranda Y. Fong, Wiying Zhou, Liang Liu,, Ailn Y. Alontaga 3, anasa Chandra,, Jonathan Ashby 5, Amy
More informationImportance of prostate volume and urinary flow rate in prediction of bladder outlet obstruction in men with symptomatic benign prostatic hyperplasia
BPH Importanc of prostat volum and urinary flow rat in prdiction of bladdr outlt obstruction in mn with symptomatic bnign prostatic hyprplasia Darius Trumbckas 1, Daimantas Milonas 1, Mindaugas Jivaltas
More informationTWO REFERENCE japollo LUNAR PARKING - ORBITS / T. P. TIMER. (NASA CR OR rmx OR AD NUMBER) OCTOBER 1965 GODDARD SPACE FLIGHT CENTER
x-543-55-399 * 1 TWO REFERENCE japollo LUNAR PARKING - ORBITS / I - -. -! BY T. P. TIMER,< CFSTI PRICE(S) $ c 4 (PAGES1 (NASA CR OR rmx OR AD NUMBER) 277 I (CATEGORY) ff 653 July 65 OCTOBER 1965,r ; I
More informationEvaluation of the use and re-use of cotton fabrics as medical and hospital articles wraps in steam sterilization method.
Evaluation of th us and r-us of cotton fabrics as mdical and hospital articls wraps in stam strilization mthod. Edna Rodrigus 1 ; Kazuko Uchikawa Graziano 2* 1 Phd, RN. Hospital Infction Control Committ.
More informationResearch into the effect of the treatment of the carpal tunnel syndrome with the Phystrac traction device
Rsarch into th ffct of th tratmnt of th carpal tunnl syndrom with th Phystrac traction dvic Rsarch carrid out in commission of: Fysiothrapi Cntrum Zuidwold By: Irn Kloostrman MA Octobr 2006 Forword This
More informationA pathogenic role for JNK signaling in experimental anti-gbm glomerulonephritis
http://www.kidny-intrnational.org & 7 Intrnational Socity of Nphrology A pathognic rol for JNK signaling in xprimntal anti-gbm glomrulonphritis RS Flanc,,FYMa, GH Tsch,, Y Han,, RC Atkins,, BL Bnntt, GC
More informationComparison of lower-hybrid (LH) frequency spectra between at the high-field side (HFS) and low-field side (LFS) in Alcator C-Mod
Comparison of lowr-hybrid (LH) frquncy spctra btwn at th high-fild sid (HFS) and low-fild sid (LFS) in Alcator C-Mod S. G. Bak, R. R. Parkr, S. Shiraiwa, G. M. Wallac, P. T. Bonoli, D. Brunnr, I. Faust,
More informationEffects of Renal Disease on Pharmacokinetics October 8, 2015 Juan J. L. Lertora, M.D., Ph.D. Director Clinical Pharmacology Program
Effects of Renal Disease on Pharmacokinetics October 8, 2015 Juan J. L. Lertora, M.D., Ph.D. Director Clinical Pharmacology Program `Office of Clinical Research Training and Medical Education National
More informationPlasma pyridoxal 5 -phosphate in the US population: the National Health and Nutrition Examination Survey,
Plasma pyridoxal 5 -phosphat in th US population: th National Halth and Nutrition Examination Survy, 2003 2004 1 4 Martha Savaria Morris, Mary Francs Picciano, Paul F Jacqus, and Jacob Slhub ABSTRACT Background:
More informationClinical and Electro-Diagnostic Quantification of the Severity of Carpal Tunnel Syndrome
Clinical and Elctro-Diagnostic Quantification of th Svrity of Carpal Tunnl Syndrom Original Articl Zafar Ali Adnan Khan Syd Muhammad Anwar Shah Aysha Zafar Objctivs: To quantify th svrity of carpal tunnl
More informationFaculty of Medicine Research Conference Wednesday 12 June 2013 Lecture Theatre 1, South Academic Block Southampton General Hospital PROGRAMME
Faculty of Mdicin Rsarch Confrnc Wdnsday 12 Jun 2013 Lctur Thatr 1, South Acadmic Block Southampton Gnral Hospital PROGRAMME 08:30-09:00 Coff and Rgistration, Lctur thatr foyr Lvl B, South Acadmic Block
More informationInternational Journal of Scientific & Engineering Research, Volume 8, Issue 11, November-2017 ISSN ,742
Intrnational Journal of Scintific & Enginring Rsarch, Volum 8, Issu 11, Novmbr-2017 ISSN 2229-5518 1,742 Prvalnc of hpatitis B & C virus among blood donors in Taif City, KSA Albugami,A.N, Alghamdi A.M,
More informatione/m apparatus (two similar, but non-identical ones, from different manufacturers; we call them A and B ) meter stick black cloth
Stony Brook Physics Laboratory Manuals Lab 6 - / of th lctron Th purpos of this laboratory is th asurnt of th charg ovr ass ratio / for th lctron and to study qualitativly th otion of chargd particls in
More informationThe Dynamics of Health Disparities; U.S. Mortality Disparities by Education, Richard Miech, Fred Pampel, Jinyoung Kim, and Rick Rogers
Th Dynamics of Halth Disparitis; U.S. Mortality Disparitis by Education, 1989-25. Richard Mich, Frd Pampl, Jinyoung Kim, and Rick Rogrs Inquality is a major caus of dath in th Unitd Stats. Around 13, fwr
More informationImpact of literacy status on Participation of Tribal Women in Panchayati Raj A case study of Nilgiri ITDA Block of Balasore district in Odisha.
IOSR Journal Of Humanitis And Social Scinc (IOSR-JHSS) Volum 22, Issu 6, Vr.10 (Jun. 2017) PP 14-2 -ISSN: 2279-087, p-issn: 2279-0845. www.iosrjournals.org Impact of litracy status on Participation of
More informationA STUDY OF STRESS MANAGEMENT AMONG THE EMPLOYEES OF OZONE HOSPITAL HYDERABAD
A STUDY OF STRESS MANAGEMENT AMONG THE EMPLOYEES OF OZONE HOSPITAL HYDERABAD Prti Sarda 1 1 MBA, M. C. Gupta Collg of Businss Managmnt, Hydrabad Abstract - Th prsnt study has bn carrid out to find out
More informationSupplementary Figures (1-6) Deletion of ADAM-9 in HGF/CDK4 mice impairs melanoma development and metastasis
Supplmntary Figurs (1-6) Dltion of ADAM-9 in HGF/CDK4 mic impairs mlanoma vlopmnt an mtastasis Nivs Giblr 1, Alxanr Schönfuß 1, Jnnifr Lansbrg #, Thomas Tüting, Cornlia Mauch an Paola Zigrino* A 25 * ADAM-9
More informationINTERNATIONAL JOURNAL OF PHARMACY & LIFE SCIENCES (Int. J. of Pharm. Life Sci.) Pharmacovigilance Study on Anti-diabetic Drugs
Rsarch Articl Dwivdi t. al., 8(12): Dc., 2017:5671-5678] INTERNATIONAL JOURNAL OF PHARACY & LIFE SCIENCES (Int. J. of Pharm. Lif Sci.) Pharmacovigilanc Study on Anti-diabtic Drugs Dpika Jaiswal, Sumt Dwivdi*
More informationAmyotrophic lateral sclerosis is a neurodegenerative disorder
https://doi.org/.8/s9-8-- Modling sporadic ALS in ipsc-drivd motor nurons idntifis a potntial thraputic agnt Koki Fujimori, Mitsuru Ishikawa, Asako Otomo,,, Naoki Atsuta, Ryoichi Nakamura, Ttsuya Akiyama
More informationFertility Situation in Bangladesh: Application of Revised Bongaarts Model
Scinc and Tchnology 2015, 5(2): 33-38 DOI: 10.5923/j.scit.20150502.03 Frtility Situation in Bangladsh: Application of Rvisd Bongaarts Modl Md. Rashdul Islam 1,*, Md. Nurul Islam 1, Md. Monsur Rahman 1,
More informationImproving the Surgical Ward Round.
Postr Sssion HRT1317 Innovation Awards Novmbr 2013 Brisban Improving th Surgical Ward Round. Prsntr(s):J. Lin, G. Thompson, M. Pitchr, S.Chan KEY PROBLEM -Ward Round Issus 1. Tim constraints 2. Staff changs
More informationTABLE 6. Overall S_ry llesults of Unadjusted and Adjusted Group Contrast Analyses of Neurological Variables
TABLE 6 Ovrall S_ry llsults of Unadjustd and Adjustd Group Contrast Analyss of Nurological Variabls Variabl, " -,'., '~-" "'.,".-.... Unadjustd Adjustd Dirction of llsults Oustionnair Inflammatory Disas
More informationInheritance of mutations in the V2 receptor gene in thirteen families with nephrogenic diabetes insipidus
Kidny Intrnational, Vol. 4 (1994), pp. 170 17 Inhritanc of mutations in th V rcptor gn in thirtn familis with nphrognic diabts insipidus NIN V.A.M. KNORS, ANS M.W. VAN DN OUWLAND, MARIAN VRDIJK, LO A.H.
More informationEXPERIMENT 4 DETERMINATION OF ACCELERATION DUE TO GRAVITY AND NEWTON S SECOND LAW
EXPERIMENT 4 DETERMINATION OF ACCELERATION DUE TO GRAVITY AND NEWTON S SECOND LAW I. Introduction. Thr ar two objctivs in this laboratory xrcis. Th first objctiv, (A), is th study of th bhavior of a body
More informationLEAKAGE REDUCTIONS FOR LARGE BUILDING AIR SEALING AND HVAC SYSTEM PRESSURE EFFECTS
LEAKAGE REDUCTIONS FOR LARGE BUILDING AIR SEALING AND HVAC SYSTEM PRESSURE EFFECTS David Bohac *, Martha Hwtt, Jams Fitzgrald, Joshua Novachck, and Andrw Lutz Cntr for Enrgy and Environmnt 212 Third Avnu
More informationEffects of dietary carbohydrate and fat on plasma lipoproteins and apolipoproteins C-ll and C-Ill in healthy men
Effcts of ditary carbohydrat and fat on plasa lipoprotins and apolipoprotins Cll and Cll in halthy n M. L. Kashyap, R. L. Barnhart, L. S. Srivastava, G. Prisutti, P. Vink, C. Alln, E. Hogg, D. Brady, C.
More informationThe Preference and Environmental Perception of Building Contour Control of Mountain-landscape City
6th Intrnational Confrnc on Innovation in Civil, Architctur, Environmnt and Matrials Enginring (CAEME-17) Oct. 5-6, 2017 Paris (Franc) Th Prfrnc and Environmntal Prcption of Building Contour Control of
More informationTargeting focal adhesion kinase renders pancreatic cancers responsive to checkpoint immunotherapy
a r t i c l s Targting focal adhsion kinas rndrs pancratic cancrs rsponsiv to chckpoint immunothrapy Hong Jiang 1,2, Samarth Hgd 1,2, Brtt L Knolhoff 1,2, Yu Zhu 1,2, John M Hrndon 1,2, Mlissa A Myr 1,2,
More informationCHANGES IN THE LIPID AND FLAVOR OF ''KATSUOBUSHI'' FLESH THROUGH THE SMOKING PROCESS OF THE TRADITIONAL MANUFACTURING METHOD
CHANGES IN THE LIPID AND FLAVOR OF ''KATSUOBUSHI'' FLESH THROUGH THE SMOKING PROCESS OF THE TRADITIONAL MANUFACTURING METHOD Mori,Y 1, Tandokoro,S 1, Gotoh,N 1, Wada,S 1 1 Tokyo Univrsity of Marin Scinc
More informationCAUSES FOR INSTITUTIONALIZATION OF CHILDREN IN KARNATAKA
CAUSES FOR INSTITUTIONALIZATION OF CHILDREN IN KARNATAKA Inushkara G V 1, Dr. Parashurama K G 2 1 Rsarch Scholar, 2 Profssor & Chairman, Dpartmnt of Stuis & Rsarch in Social Work, Tumkur Univrsity, Tumkur,
More informationThe Neurosequential Model
Th Nurosquntial Modl Introduction & Rsarch Updats Wickd Problms 11.8.2017 Erin P. Hambrick, PhD Assistant Profssor, Dpartmnt of Psychology Univrsity of Missouri Kansas City Dirctor of Rsarch, Th ChildTrauma
More informationDegeneration and impaired regeneration of gray matter oligodendrocytes in amyotrophic lateral sclerosis
Dgnration and impaird rgnration of gray mattr oligodndrocyts in amyotrophic latral sclrosis Shin H Kang 1,6,7, Ying Li 2,7, Masahiro Fukaya 3, Ilana Lornzini 1,4, Don W Clvland 5, Lyl W Ostrow 2,4, Jffry
More informationCapillary gas-liquid chromatographic-mass spectrometric measurement of very long chain. of plasma
Capillary gas-liquid chromatographic-mass spctromtric masurmnt of vry long chain (C22 to C,) fatty acids in microlitr sampls of plasma Patrick ubourg, * Pirr Francis Rocchiccioli F. Bougngrs, ** and Srvic
More informationA Practical System for Measuring Film Thickness. Means of Laser Interference with Laminar-Like Laser
A Practical Systm for Masuring Film Thicknss by Mans of Lasr Intrfrnc with Laminar-Lik Lasr Fng ZHU, Kazuhiko ISHIKAWA, Toru IBE, Katsuhiko ASADA,' and Masahiro UEDA4 Dpartmnt of Information Scinc, Faculty
More information