Product Datasheet. PMP70 Antibody (CL2524) NBP Unit Size: 0.1 ml

Transcription

1 Product Datasheet PMP70 Antibody (CL2524) NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 1 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 1/22/2019 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP PMP70 Antibody (CL2524) Product Information Unit Size Concentration Storage Clonality Clone Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Monoclonal CL % Sodium Azide IgG1 Protein A purified PBS (ph 7.2) and 40% Glycerol Page 1 of 5 v.20.1 Updated 1/22/2019 Product Description Host Mouse Gene ID 5825 Gene Symbol Species Specificity/Sensitivity Immunogen ABCD3 Human Specificity of human PMP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids:mvsqqekgiegvqviplipgageiiiadniikfdhvplatpngdvlirdlnfe VRSGANVLICGP Product Application Details Applications Recommended Dilutions Application Notes Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 For IHC-Paraffin, HIER ph 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Images [NBP ] - Staining in U251 cell line showing specific staining of

3 36770] - Staining in human liver and pancreas tissues. Corresponding ABCD3 RNA-seq data are presented for the same tissues. Page 2 of 5 v.20.1 Updated 1/22/2019 [NBP ] - Staining in HeLa cell line showing specific staining of [NBP ] - Staining of human cell line A431 showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody [NBP ] - Staining in MCF7 cell line showing specific staining of

4 [NBP ] - Staining in U2OS cell line showing specific staining of Page 3 of 5 v.20.1 Updated 1/22/ ] - Staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells ] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes ] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

5 36770] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells. Page 4 of 5 v.20.1 Updated 1/22/ ] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells ] - Staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells. Publications Schrul B, Kopito RR. Peroxin-dependent targeting of a lipid-droplet-destined membrane protein to ER subdomains. Nat. Cell Biol. Jul :00AM [PMID: ]

6 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP HAF007 NB720-B NBP H Q01-10ug Goat anti-mouse IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Rabbit anti-mouse IgG (H+L) Secondary Antibody [Biotin] Mouse IgG1 Isotype Control (MG1) Recombinant Human PMP70 Protein Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: