Sarcoglycan Subcomplex Expression in Normal Human Smooth Muscle

Size: px
Start display at page:

Download "Sarcoglycan Subcomplex Expression in Normal Human Smooth Muscle"

Transcription

1 Volume 55(8): , 2007 Journal of Histochemistry & Cytochemistry ARTICLE Sarcoglycan Subcomplex Expression in Normal Human Smooth Muscle Giuseppe Anastasi, Giuseppina Cutroneo, Antonina Sidoti, Carmen Rinaldi, Daniele Bruschetta, Giuseppina Rizzo, Rosalia D Angelo, Guido Tarone, Aldo Amato, and Angelo Favaloro Department of Biomorphology and Biotechnologies, University of Messina, Messina, Italy (GA,GC,AS,CR,DB,GR,RD,AA,AF), and Departments of Genetics, Biology and Biochemistry, University of Torino, Torino, Italy (GT) SUMMARY The sarcoglycan complex (SGC) is a multimember transmembrane complex interacting with other members of the dystrophin glycoprotein complex (DGC) to provide a mechanosignaling connection from the cytoskeleton to the extracellular matrix. The SGC consists of four proteins (a, b, g, and y). A fifth sarcoglycan subunit, e-sarcoglycan, shows a wider tissue distribution. Recently, a novel sarcoglycan, the ~-sarcoglycan, has been identified. All reports about the structure of SGC showed a common assumption of a tetrameric arrangement of sarcoglycans. Addressing this issue, our immunofluorescence and molecular results showed, for the first time, that all sarcoglycans are always detectable in all observed samples. Therefore, one intriguing possibility is the existence of a pentameric or hexameric complex considering ~-sarcoglycan of SGC, which could present a higher or lower expression of a single sarcoglycan in conformity with muscle type skeletal, cardiac, or smooth or also in conformity with the origin of smooth muscle. (J Histochem Cytochem 55: , 2007) THE SARCOGLYCAN COMPLEX (SGC) is a multimember transmembrane complex interacting with other members of the dystrophin glycoprotein complex (DGC) to provide a mechanosignaling connection from the cytoskeleton to the extracellular matrix in myocytes (Campbell 1995; Liu and Engvall 1999; Blake et al. 2002). SGC plays a key role at the membrane and is crucial in maintaining sarcolemma viability in muscle fiber membrane (Liu and Engvall 1999). Moreover, sarcoglycans may be important in maintaining proper calcium ion balance or may support the development and maintenance of muscle cells through signaling functions (Wheeler and McNally 2003). The SGC consists of four transmembrane proteins: a-sarcoglycan, a type-i transmembrane protein with N terminus on the intracellular face of muscle cells specifically expressed in skeletal and cardiac muscle, even though low amounts are also detected in bladder, Correspondence to: Angelo Favaloro, Dipartimento di Biomorfologia e Biotecnologie, Policlinico Universitario, Torre Biologica, Università di Messina, Via Consolare Valeria, 1 IT-98125, Messina, Italy. angelo.favaloro@unime.it Received for publication November 9, 2006; accepted March 21, 2007 [DOI: /jhc.6A ]. KEY WORDS sarcoglycan smooth muscle immunohistochemistry RT-PCR gastroenteric tract vessels lung, and small intestine (Roberds et al. 1993,1994); b-sarcoglycan, a type-ii transmembrane protein most abundant in cardiac and skeletal muscle but also expressed in placenta, kidney, liver, and lung (Lim et al. 1995; Bönnemann et al. 1996); and g- and y-sarcoglycans, also type-ii glycosylated transmembrane proteins that are highly similar among themselves and similar to b- sarcoglycan (Yoshida et al. 1994; Jung et al. 1996). Whereas y-sarcoglycan is detected in all types of muscle, g-sarcoglycan is expressed exclusively in striated muscle (Noguchi et al. 1995). Attempts to immunolocalize g-sarcoglycan in smooth muscle have failed, and the question of whether g-sarcoglycan or a smooth muscle isoform existed was unanswered, although previous reports anticipated the presence of g-sarcoglycan in smooth muscle (Durbeej and Campbell 1999; Durbeej et al. 2000). The synthesis of all four sarcoglycans is required to ensure proper localization of the complex to the cell surface membrane (Holt and Campbell 1998); thus, mutations in the genes encoding individual sarcoglycans often lead to the concomitant loss or reduction of all sarcoglycans from the sarcolemma. This suggests that complex formation and localization of SGC require all four subunits (Straub and Campbell 1997) be- C The Histochemical Society, Inc /07/$

2 832 Anastasi, Cutroneo, Sidoti, Rinaldi, Bruschetta, Rizzo, D Angelo, Tarone, Amato, Favaloro cause direct interaction among the sarcoglycans has been demonstrated biochemically by coimmunoprecipitation (Yoshida et al. 1994; Chan et al. 1998). A fifth sarcoglycan subunit, e-sarcoglycan, is more broadly expressed, showing a wider tissue distribution (Ettinger et al. 1997; McNally et al. 1998). The e-sarcoglycan, homologous to a-sarcoglycan, is a singlepass type-i transmembrane protein with a short cytoplasmic tail containing three putative protein kinase phosphorylation sites, whereas the extracellular domain contains one N-linked glycosylation site and five cysteine residues (Betto et al. 1999). In previous reports it has been demonstrated that e-sarcoglycan associates with b- and y-sarcoglycans in smooth muscle (Durbeej and Campbell 1999). Despite its homology to a-sarcoglycan and its presence in skeletal muscle, endogenous e-sarcoglycan is unable to rescue phenotypes associated with a-sarcoglycan loss (Duclos et al. 1998). e-sarcoglycan immunoreactivity, like b- and y-sarcoglycans, was also widely distributed in non-muscle tissues (Ettinger et al. 1997). Recent observations demonstrated that, in lung, this glycoprotein was associated with both alveoli and bronchioles and that the sections of urogenital and digestive tracts were e-sarcoglycan positive (Ettinger et al. 1997). Recently, a novel mammalian sarcoglycan, the ~-sarcoglycan, has been identified by an antibody specific to ~-sarcoglycan (Wheeler et al. 2002). This protein, encoded by a gene on human chromosome 8p22, is a protein highly related to g- and y-sarcoglycans and is reduced at membrane in muscular dystrophy, consistent with a role in mediating membrane stability. ~-Sarcoglycan was also found as a component of the vascular smooth muscle sarcoglycan complex and presented a costameric pattern (Wheeler et al. 2002). The key role of all sarcoglycans was demonstrated with a model for the assembly, processing, and membrane stability of SGC (Hack et al. 2000). In particular, y-sarcoglycan is critical for the initial stability of the sarcoglycan complex in the endoplasmic reticulum, with the b-sarcoglycan. After formation of the b/y sarcoglycan core, the presence of g-sarcoglycan is required later for efficient complex assembly and maturation. Finally, an interaction with dystrophin late in the secretory pathway is required for the sarcoglycan subcomplex to insert in the cell surface (Hack et al. 2000). Previous investigations have demonstrated that in skeletal and cardiac muscle, SGC is a heterotetrameric unit constituted by the a-, b-, g-, and y-sarcoglycans (Holt and Campbell 1998). Other authors confirmed that expression of a-sarcoglycan is restricted to striated muscle cells (Roberds et al. 1993), whereas e-sarcoglycan is also expressed in several other tissues (Ettinger et al. 1997; McNally et al. 1998). On this basis, it was hypothesized that, in skeletal muscle, e-sarcoglycan interacts with b-, g-, and y-sarcoglycans, constituting a second SGC that coexists with the conventional subcomplex (Liu and Engvall 1999), whereas in smooth muscle vascular and visceral it associates with b- and y-sarcoglycans and sarcospan (Durbeej and Campbell 1999; Straub et al. 1999). Moreover, further analysis showed the presence of another sarcoglycan subcomplex in vascular and visceral smooth muscle consisting of e-, b-, g-, and y-sarcoglycans and is associated with sarcospan (Barresi et al. 2000). Therefore, it is hypothesized that e-sarcoglycan might replace the a-sarcoglycan in smooth muscle to form a unique SGC (Straub et al. 1999). Successive reports suggest that two sarcoglycan subcomplexes exist. One containing a-, b-, g-, and y-sarcoglycans, characteristic of skeletal and cardiac muscle, and the other consisting of b-, y-, ~-, and e-sarcoglycans, characteristic of vascular smooth muscle (Straub et al. 1999; Wheeler et al. 2002). The starting point of our study was the recent evidence that these disagreeing hypotheses about the composition of SGC present only a common assumption of a tetrameric arrangement of sarcoglycans (Liu and Engvall 1999). On this basis, in our recent immunohistochemical and molecular investigations carried out on surgical biopsies of human adult visceral smooth muscle, we showed that these sarcoglycans all coexist in the same fiber. Based on these findings, we hypothesized the presence of a pentameric structure of SGC and not a conventional heterotetrameric unit (Anastasi et al. 2005). Addressing this issue, in this work we extend our previous studies, performing immunofluorescence and molecular investigations to better verify whether this tetrameric structure also exists in all other regions that contain smooth muscle fibers. In particular, we performed an immunofluorescence and molecular analysis using samples of normal human smooth muscle obtained from the gastrointestinal, urogenital, vascular, and respiratory tracts. Materials and Methods Samples of normal human smooth muscle were obtained from 10 male patients who underwent surgery but who were not affected by any neuromuscular pathology. Patients were between 30 and 60 years of age. We obtained biopsies from all regions of the gastrointestinal tract (stomach, duodenum, jejunum, ileum and cecum), urogenital tract (bladder, ureter, and uterus), bronchioles, and saphena. All patients gave informed consent and all procedures followed were in accordance with the Helsinki Declaration of Collected biopsies were treated for analysis by immunofluorescence and RT-PCR techniques, respectively. Immunohistochemistry Biopsies were fixed in 3% paraformaldehyde in a 0.2 M phosphate buffer, ph 7.4, for 2 hr. After numerous rinses in

3 Sarcoglycan in Normal Human Smooth Muscle M phosphate buffer and PBS, the biopsies were infiltrated with saccharose at 12% and 18% to obtain a gradual substitution of saline solution with glucosate solution and then to avoid disruption of cellular membranes during successive phases. Finally, sections were frozen in liquid nitrogen. Twenty-mm-thick sections were cut on a cryostat and collected on glass slides coated with 0.5% gelatin and 0.005% chromium potassium sulfate. To block nonspecific sites and to render the membranes permeable, sections were preincubated with 1% BSA and 0.3% Triton X-100 in PBS at room temperature for 15 min. Finally, sections were incubated with primary antibodies for 2 hr. The following primary antibodies obtained from Novocastra Laboratories (Newcastle upon Tyne, UK) were used: mouse monoclonal anti-a-sarcoglycan (diluted 1:100), mouse monoclonal anti-b-sarcoglycan (diluted 1:200), mouse monoclonal anti-g-sarcoglycan (diluted 1:100), mouse monoclonal anti-y-sarcoglycan (diluted 1:50), and mouse monoclonal anti-e-sarcoglycan (diluted 1:100). In all reactions, TRITC-conjugated IgG anti-mouse in goat was used as the first fluorochrome (1:100 dilution; Jackson ImmunoResearch Laboratories, West Grove, Pa) and applied for 1 hr after incubation with the primary antibody. For double-localization reactions, after many rinses with PBS and incubation with a biotinylated IgG in goat to obtain saturation of residual free binding sites, sections were incubated with a second antibody conjugated with FITCconjugated secondary IgG as second fluorochrome (1:100 dilution; Jackson ImmunoResearch Laboratories). Slides were finally washed in PBS and sealed with mounting medium. Sections were then observed and photographed using a Zeiss LSM 510 confocal microscope (Carl Zeiss; Jena, Germany), equipped with an argon laser (458, 488 l) and two HeNe lasers (543 and 633 l). All images were digitalized at a resolution of 8 bits into an array of pixels. Optical sections of fluorescence specimens were obtained using HeNe laser (543 nm) and argon laser (458 nm) at a 1-min, 2-sec scanning speed with up to eight averages;1.50-mm-thick sections were obtained using a pinhole of 250. For each reaction, at least 100 fibers were observed to obtain a statistical analysis. Contrast and brightness were established by examining the most brightly labeled pixels and choosing settings that allowed clear visualization of structural details while keeping the highest pixel intensities close to 200. The same settings were used for all images obtained from the other samples that had been processed in parallel. The function called display profile allowed us to show the intensity profile across the image along a freely selectable line. Intensity curves are shown in a graph below the scanned image. Digital images were cropped and figure montages prepared using Adobe Photoshop 5.0 (Adobe Systems; Palo Alto, CA). RT-PCR In the present study we collected tissue samples of human smooth muscle of saphena, bladder, ureter, uterus, bronchioles, and gastrointestinal tract. We evaluated the expression of a-, b-, g-, y-, e-, and ~-sarcoglycans in each of them by RT-PCR. Total RNA Isolation Fifty to 100 mg of each tissue sample was homogenized using a power homogenizer (Ultra Turrax; IKA Werke GmbH, Staufen, Germany). Total RNA was isolated by procedures based on monophasic solutions of phenol and guanidine isothiocyanate upon single-step RNA isolation (TRIzol Reagents; Invitrogen, Carlsbad, CA) (Chomczynski and Sacchi 1987). RT-PCR Analysis RT-PCR procedure was carried out using the two-step protocol (GeneAmp Gold RNA PCR Reagent Core Kit; Applied Biosystems, Foster City, CA) in a thermal cycler (GeneAmp PCR System 9600 PE; Applied Biosystems). In the first step, an initial reverse transcription reaction (RT) was carried out in a 20-ml volume containing 3 mg of total RNA, 10 U RNase inhibitor, DTT 10 mm, 15 U Multiscribe Reverse Transcriptase and oligod(t) mm under the following thermal cycler conditions: hold 10 min at 25C and 12 min at 42C. In the second step, a further independent PCR was carried out in a 50-ml volume containing 5 ml of cdna of the first step (RT) as template, 2.5 U AmplTaq Gold DNA Polymerase, and 0.2 mm of each primer designed by us on mrna sequences (Table 1). DNA amplification was performed conventionally; each sample together with an internal control was subjected to 30 cycles of amplification (exponential phase of amplification) consisting of 30 sec of denaturation, 30 sec of annealing, and 40 sec of extension. The final extension step at 72C was extended to 7 min. The annealing temperature was optimized for each primer set. For each component of the SGC, human GAPDH cdna as internal control was used. The sequence of sarcoglycans was later confirmed by nucleotide sequencing analysis. Table 1 Oligonucleotide primer sequences used for genotyping Primers Forward Reverse Length (bp) Exons Nucleotides Accession NCBI SGCA 5 -ACTTCTGTCTTGCTACGAC-3 5 -TCACCTGTGTGCACATTG NM SGCB 5 -GTGAGAAGGCTGTTGAGA-3 5 -ATAGTCTGTGCTGAATAAG NM SGCG 5 -CCTGTCTGTGGCCGGTGTGA-3 5 -GCGTTTACTTCCCATCCACGCTGC NM SGCD1 5 -AGTGGTAGTAGGAGCTGA-3 5 -TCGCAGCATCTAACTTAAT NM SGCD2 5 -AGTGGTAGTAGGAGCTGA-3 5 -CTGTTGAAGCTGTAGCTCT NM SGCE 5 -ACATTCTTGCTGACAGTGT-3 5 -TGGATATATCGAAGCCAT NM SGCZ 5 -ATGCAGAGACAATCAAGCT-3 5 -TGCTACTGGACTGACAAG NM GAPDH 5 -AACCTGCCAAATATGATGAC-3 5 -ACTGAGTGTGGCAGGGACTC NM

4 834 Anastasi, Cutroneo, Sidoti, Rinaldi, Bruschetta, Rizzo, D Angelo, Tarone, Amato, Favaloro Nucleotide Sequencing Analysis Amplified DNA was purified using a commercially available kit (GFX PCR DNA and Gel Band Purification Kit; Amersham Biosciences, Piscataway, NJ). The fragments extracted were directly sequenced with the primers used for the RT-PCR assay and labeled with the ABI PRISM Big Dye Terminator Cycle Sequencing Method, according to manufacturer s instructions, on 377 ABI PRISM Sequencer Analyzer (Applied Biosystems). ABI Sequencing Analysis was used to process the raw sequence data and ABI Sequencing Navigator to align sequence data. Results A common feature of all sarcoglycans, including e-sarcoglycan, is their sarcolemmal expression. Their differential distribution in muscle and non-muscle cells is well known. To design a targeting model to better define the real structure of the SGC, we analyzed the immunofluorescence and expression of all sarcoglycans in normal adult smooth muscle obtained from all regions of the human body. In particular, we studied the gastrointestinal, urogenital, vascular, and respiratory tracts using the semiquantitative analysis by confocal laser scanning microscopy and the molecular analysis by RT-PCR. Immunohistochemistry Through confocal laser scanning microscopic observations, we studied the immunostaining patterns of a-, b-, g-, y-, and e-sarcoglycans using specific antibodies. To give a membrane control, we performed a single reaction using dystrophin antibody on a stomach sample (Figure 1A). Dystrophin staining showed a normal sarcolemmal distribution. We also performed a negative control on a stomach sample, using the secondary antibody only (Figure 1B). In Figure 1C, we showed the corresponding transmitted light of Figure 1B. Indirect immunofluorescence applied in smooth muscle fibers of the gastrointestinal tract (Figure 2 and Figure 3) revealed a relatively normal pattern of all five tested sarcoglycans. Figure 1 Longitudinal section of human smooth muscle immunolabeled with dystrophin antibody (A), with negative control with the secondary antibody only (B), and with corresponding transmitted light (C).

5 Sarcoglycan in Normal Human Smooth Muscle 835 Figure 2 Compound panel of immunohistochemical findings in human smooth muscle of some gastrointestinal tracts. Tested proteins are indicated at the top, and the gastrointestinal tracts are indicated along the left of the figure. In the stomach (A E), duodenum (F J), and ileum (K O), a-sarcoglycan staining appeared reduced but clearly detectable; other tested protein stainings were clearly detectable. In particular, three-dimensional reconstructions using a stack of 16 sections of 0.8 mm from the scan step showed that there was a reduced but clearly detectable staining for a-sarcoglycan in smooth muscle of stomach (Figure 2A), duodenum (Figure 2F), and ileum (Figure 2K). In the observations of other sarcoglycan stainings we showed that b-, g-, y-, and e-sarcoglycans had a normal pattern whether in stomach (Figures 2B 2E), duodenum (Figures 2G 2J), or ileum (Figures 2L 2O). In immunofluorescence analysis of other regions of the gastrointestinal tract (jejunum and cecum) we observed a contrary behavior of sarcoglycans. In detail, our Figure 3 Compound panel of immunohistochemical findings in human smooth muscle of jejunum and cecum. In these images we illustrated that a-, b-, g-, and y-sarcoglycan staining showed a normal pattern either in jejunum (A D) or in the cecum (F I), whereas in these tracts, e-sarcoglycan staining appeared minimally reduced (E,J).

6 836 Anastasi, Cutroneo, Sidoti, Rinaldi, Bruschetta, Rizzo, D Angelo, Tarone, Amato, Favaloro data revealed a normal staining pattern of a-, b-, g-, and y-sarcoglycans, clearly visible in jejunum (Figures 3A 3D) and in cecum (Figures 3F 3I), whereas observations of e-sarcoglycan showed a minimally reduced staining pattern of this glycoprotein, whether in jejunum (Figure 3E) or in cecum (Figure 3J). To investigate the immunofluorescence of sarcoglycans in smooth muscle fibers of the urogenital tract, we applied the single localization reactions in smooth muscle fibers obtained from bladder, ureter, and uterus. In all observations we always detected the immunofluorescence for all sarcoglycans. In detail, in bladder we showed a normal staining pattern of a- (Figure 4A), b- (Figure 4B), g- (Figure 4C), and y-sarcoglycans (Figure 4D), whereas the e-sarcoglycan staining was normal even if minimally reduced (Figure 4E). On the contrary, in the ureter and uterus, immunofluorescence analysis showed that a-sarcoglycan staining was reduced, even if minimally (Figures 4F and 4K). The b-, g-, y-, and e-sarcoglycans staining appeared normal whether in ureter (Figures 4G 4J) or in uterus (Figures 4L 4O). Applying the single localization reactions at smooth muscle fibers of bronchioles, we observed that all sarcoglycans showed a normal immunofluorescence staining (Figures 5A 5E). With regard to smooth muscle fibers of saphena, our data showed a reduced, but always detectable, staining pattern of e-sarcoglycan (Figure 5J), whereas a- (Figure 5F), b- (Figure 5G), g- (Figure 5H), and y-sarcoglycans (Figure 5I) showed a clearly visible and normal immunofluorescence pattern. In addition, to better investigate the real values of all tested protein stainings, we applied the software function of display profile to some reactions. With this further analysis it is possible to show the intensity profile across the image along a freely selectable line converting, in this way, the immunofluorescence in a graphic. Thus, applying the display profile software to reactions in Figures 2A and 2E, we confirmed that the a-sarcoglycan fluorescence intensity in smooth muscle of stomach was detectable, even if reduced, as demonstrated by graphics that showed an intensity not overstepping limits of 50 values (Figure 6A); the display profile of e-sarcoglycan in smooth muscle of stomach revealed a normal immunofluorescence of these proteins showing intensity values included between 80 and 150 (Figure 6B). The display profile applied to reactions in Figures 4A and 4E confirmed that, in the bladder, the a-sarcoglycan staining pattern was normal by intensity values that reached 200 (Figure 6C). With regard to e-sarcoglycan immunofluorescence, the display profile showed a clear staining pattern, even if the intensity values rarely reached 100 (Figure 6D). Figure 4 Compound panel of immunohistochemical findings in human smooth muscle of the urogenital tract. In the bladder, e-sarcoglycan staining (E) appeared reduced but clearly detectable; other tested protein stainings were clearly detectable (A D). In the ureter and uterus it is possible to denote the contrary situation. In fact, a-sarcoglycan showed a reduced staining pattern (F,K), whereas other sarcoglycans including e-sarcoglycan showed a normal detection either in ureter (G J) or in uterus (L O).

7 Sarcoglycan in Normal Human Smooth Muscle 837 Figure 5 Compound panel of immunohistochemical findings in human smooth muscle of bronchioles (A E) and saphena (F J). All tested proteins in both smooth muscle regions were clearly detectable. Finally, the same condition was visible applying the display profile software to reactions in Figures 5F and 5J. In particular, the immunostaining patterns of a- and e-sarcoglycans in smooth muscle of saphena was confirmed by the values included between 80 and 220 intensity around a-sarcoglycan (Figure 6E) and by values that did not overstep limits of 140 intensity (Figure 6F). To better test the contemporary presence of all sarcoglycans and to evidence the same localization of all sarcoglycans, we performed a stock of double-localization reactions, matching antibodies to all sarcoglycans with themselves. In our observations on smooth muscle of saphena, each sarcoglycan constantly colocalizes with others. In detail, the results constantly showed a yellow fluorescence due to an overlapping of the red fluorescence of the primary channel with the green fluorescence of the secondary channel (Figure 7), indicating that sarcoglycans colocalize with each other. The same results were obtained in all other tested regions (data not shown). RT-PCR Using RT-PCR and nucleotide sequencing analysis with specific primers, we confirmed the presence of a-, b-, g-, y-, e-, and ~-sarcoglycans in each sample of human smooth muscle: saphena, bladder, ureter, uterus, bronchioles, and gastrointestinal tract. Results obtained in this work confirmed the presence of six sarcoglycans (Figure 8 and Figure 9) in all smooth muscle samples. We have already demonstrated the presence of a-sarcoglycan in samples of human smooth muscle of several gastrointestinal tracts (Anastasi et al. 2005), and in this study we also confirmed the presence of a-sarcoglycan in human saphena, bladder, ureter, uterus, bronchioles, and gastrointestinal tract. Discussion We carried out a semiquantitative and molecular study on SGC using normal human samples of smooth muscle fibers. In this regard, we found the simultaneous expression of six sarcoglycans (a, b, g, y, e, and ~), hypothesizing an exameric arrangement of SGC. Initially, the sarcoglycans were considered as a complex of four transmembrane proteins (a, b, g, and y) primarily expressed in skeletal muscle (Roberds et al. 1993; Yoshida et al. 1994; Bönnemann et al. 1995) and closely associated with dystrophin and the dystroglycans in the muscle membrane (Suzuki et al. 1992; Cox et al. 1994; Greenberg et al. 1994). Notoriously, the mutations in any sarcoglycan cause limb-girdle muscular dystrophy (Campbell 1995; Bönnemann et al. 1996). Interestingly, dysphagia, vomiting, chronic constipation, and acute digestive dilatations, all due to malfunctions of digestive smooth muscle, have been reported in patients with progressive muscular dystrophy (Barohn et al. 1988; Jaffe et al. 1990). Thus, clinical observations raise the possibility that the sarcoglycans play a key role in smooth muscle. After these investigations, the SGC was mainly studied because the integrity of this subcomplex seems to be essential for the viability of muscle cells (Roberds et al. 1994; Tinsley et al. 1994; Campbell 1995; Lim et al. 1995; Noguchi et al. 1995). In fact, it was shown that anti-a-sarcoglycan coprecipitated integrin a5b1 and other focal adhesion-associated proteins. On this ground, a bidirectional signaling was demonstrated between sarcoglycans and integrins (Yoshida et al. 1998; Anastasi et al. 2003a,b,2004a), also utilizing human skeletal muscle affected by sarcoglycanopathy (Anastasi et al. 2004b). Sarcoglycans thus seem to be functionally and pathologically as important as dystrophin (Yoshida et al. 1998).

8 838 Anastasi, Cutroneo, Sidoti, Rinaldi, Bruschetta, Rizzo, D Angelo, Tarone, Amato, Favaloro

9 Sarcoglycan in Normal Human Smooth Muscle 839 Figure 7 Compound panel of double-immunohistochemical reactions in human smooth muscle samples of saphena immunolabeled with a- and b-sarcoglycans (A), a- andg-sarcogly- cans (B), a- and y-sarcoglycans (C), a- and e-sarcoglycans (D), b- and g- sarcoglycans (E), b- and y-sarcoglycans (F), b- ande-sarcoglycans (G), g- andysarcoglycans (H), g- and e-sarcoglycans (I), and y-ande-sarcoglycans (J). In all reactions a yellow fluorescence is shown due to an overlapping of the red fluorescence on green fluorescence. These results indicated that each sarcoglycan constantly colocalizes with others. Two additional sarcoglycan molecules were more recently described: e-sarcoglycan, a transmembrane glycoprotein showing 43% amino acid identity with a-sarcoglycan (Ettinger et al. 1997; McNally et al. 1998), and ~-sarcoglycan, a protein highly related to y-sarcoglycan and g-sarcoglycan (Wheeler et al. 2002). It is presently well known that the sarcoglycans include six transmembrane glycoproteins associated in Figure 6 Display profiles of a- and e-sarcoglycans of stomach, bladder, and saphena. This further analysis shows the intensity profile across the image along a freely selectable line (arrow) of longitudinal sections of stomach, bladder, and saphena smooth muscle. In the stomach smooth muscle, a-sarcoglycan fluorescence intensity (A) was reduced in comparison with e-sarcoglycan fluorescence intensity (B). In the bladder and saphena, a-sarcoglycan fluorescence peaks (C,E) were normal, whereas the values related to e-sarcoglycan (D,F) were reduced.

10 840 Anastasi, Cutroneo, Sidoti, Rinaldi, Bruschetta, Rizzo, D Angelo, Tarone, Amato, Favaloro Figure 8 2% Agarose gel electropherogram of RT-PCR products amplified using human RNA as template, primer pairs of a-, b-, and g-sarcoglycans, and primer pairs of GAPDH (internal control). (A) a-sarcoglycan gel electropherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and a-sarcoglycan coamplified RT-PCR product of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1) and negative (C2) controls for a-sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. (B) b-sarcoglycan gel electropherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and b-sarcoglycan coamplified RT-PCR products of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1) and negative (C2) controls for b-sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. (C) g-sarcoglycan gel electropherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and g-sarcoglycan coamplified RT-PCR products of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1) and negative (C2) controls for g-sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. different heterotetrameric units in skeletal, cardiac, and smooth muscle. In fact, it was hypothesized that e-sarcoglycan replaces a-sarcoglycan in smooth muscle to form a unique SGC formed by e-, b-, g-, and y-subunits (Straub et al. 1999). Further reports showed that the SGC of smooth muscle is characterized by b-, y-, e-, and ~-sarcoglycans (Wheeler and McNally 2003). A critical question is whether the SGC exists as a tetrameric or higher order structure in smooth muscle. This point was partially clarified in our previous immunohistochemical and molecular investigation, carried out on only human adult smooth muscle of gastrointestinal tract, in which we demonstrated the presence of a pentameric arrangement around the SGC (Anastasi et al. 2005). To further investigate this question, we carried out an immunofluorescence study on a-, b-, g- and y- and e-subunits of sarcoglycans, paralleled by a molecular analysis of all six sarcoglycans including ~-sarcoglycan. The analysis was extended to the gastrointestinal tract as well as to smooth muscle fibers of the urogenital, vascular, and respiratory tracts. Our results showed for the first time that in all observed samples of human smooth muscle in a single localization, a-sarcoglycan is also always detectable, although its staining pattern is slightly lower than e-sarcoglycan, both with immunofluorescence observations and with molecular techniques. a-sarcoglycan fluorescence was sometimes normally detected, whereas e-sarcoglycan staining pattern was reduced but clearly expressed. However, a- and e-sarcoglycans always coexist in all observed fibers. Finally, g-sarcoglycan staining pattern, as well as b- and y-sarcoglycans, is always normally detectable in all analyzed samples. Previous reports anticipated the presence of g-sarcoglycan in smooth muscle (Durbeej and Campbell 1999; Barresi et al. 2000; Durbeej et al. 2000), in contrast with data of other reports showing that this protein was not a member of the smooth muscle complex because g-sarcoglycan was found to be expressed in striated muscle (Yamamoto et al. 1994; Barresi et al. 2000; Wheeler and McNally 2003). In particular, with the discovery of ~-sarcoglycan, it is hypothesized that ~-sarcoglycan, and not g-sarcoglycan, is the fourth member of the SGC in smooth muscle, including the coronary arterial bed (Wheeler et al. 2002; Wheeler and McNally 2003). In our opinion, these hypotheses may have validity because these results were obtained using smooth muscle of mice with sarcoglycan deficiency (Wheeler and McNally 2003). Nevertheless, our results are not comparable with those of Wheeler et al. (2002) and Wheeler and McNally (2003) because we obtained our information using normal human smooth muscle. In addition, it is possible that the SGC of mice has some differences in comparison with SGC of human smooth muscle because, in the extracellular domain of sarco-

11 Sarcoglycan in Normal Human Smooth Muscle 841 Figure 9 2% Agarose gel electropherogram of RT-PCR products amplified using human RNA as template, primer pairs of y 1 -, y 2, e-, and ~-sarcoglycans, and primer pairs of GAPDH (internal control). (A) y 1 -Sarcoglycan gel electropherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and y 1 -sarcoglycan coamplified RT-PCR products of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1) and negative (C2) controls for y 1 -sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. (B) y 2 -Sarcoglycan gel electopherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and y 2 -sarcoglycan coamplified RT-PCR products of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1)and negative (C2) controls for y 2 -sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. (C) e-sarcoglycan gel electropherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and e-sarcoglycan coamplified RT-PCR products of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1) and negative (C2) controls for e-sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. (D) ~-Sarcoglycan gel electropherogram. Lanes 1 10: In each lane we ran an aliquot of internal control and ~-sarcoglycan coamplified RT-PCR products of smooth muscle in different areas of the gastroenteric tract (stomach, duodenum, ileum, jejunum, cecum), bladder, ureter, uterus, bronchioles, and saphena. Lanes 11 and 12: In each lane we ran, respectively, positive (C1) and negative (C2) controls for ~-sarcoglycan presence: the striated muscle was used as the positive (C1) and water as the negative (C2). Lane 13: 100-bp ladder. glycans, substantial differences in amino acid sequences exist among different species (Betto et al. 1999). Moreover, Wheeler and McNally (2003) showed, in mice lacking g-sarcoglycan, a focal degenerative cardiomyopathy but not a disruption of the smooth muscle SGC. Interestingly, in our opinion, these results could confirm our hypothesis of exameric structure because the function of g-sarcoglycan in the context of SGC could be reinforced by ~-sarcoglycan, which works together with all sarcoglycans. Thus, our intention was to verify the interaction of g-sarcoglycan with the other SGC components. To this end, we performed a stock of double reactions, with each sarcoglycan against all others. These data showed that all sarcoglycans colocalized with each other, confirming our pentameric or exameric hypothesis. Our results, showing coexistence of a- and e-sarcoglycans in a single SGC, are in disagreement with previous studies indicating that the expressions of a- and e-sarcoglycans were mutually exclusive and hypothesizing that e-sarcoglycan serves a function similar to that of a-sarcoglycan (Liu and Engvall 1999). In particular, it is hypothesized that a- and e-sarcoglycans form separate complexes with b-, g-, and y-sarcoglycans, on wild-type and a-sarcoglycan-deficient mice and mouse C2C12 myocytes (Liu and Engvall 1999). This arrangement of two subcomplexes is valid only considering the embryological condition and origin of tested muscles. Because myoblasts are undifferentiated cells, it is possible that these two subcomplexes change their arrangement in adult muscle condition and that all five or six sarcoglycans work together to better develop their signaling functions. Interestingly, the formation and expression of the SGC on the cell membrane begins after myotube formation (Ozawa et al. 2005). In addition, mouse a- and e-sarcoglycans have some homologies with human a- and e-sarcoglycans, but they have dif-

12 842 Anastasi, Cutroneo, Sidoti, Rinaldi, Bruschetta, Rizzo, D Angelo, Tarone, Amato, Favaloro ferences in?10% of amino acid sequences (Ettinger et al. 1997). These differences could determine the different behavior in two types of muscles. Finally, mouse a- and e-sarcoglycans are 44% identical at the amino acid level. The intracellular domain of e-sarcoglycan (98 aa) is thus larger than that of a-sarcoglycan (76 aa). Homology extends over the whole length of the molecules, with conserved regions both in the extracellular and transmembrane domains. The potential site for N-glycosylation in e-sarcoglycan corresponds to one of two such sites in a-sarcoglycan (Ettinger et al. 1997). The two sarcoglycans are similar but not identical and can thus play distinct roles in the context of the plasma membrane. In this regard, it is demonstrated that there is a pseudo-e-sarcoglycan gene located at 2q21. In regard to a- and e-sarcoglycans, genes appear to have originated from a common ancestor by gene duplication (Ozawa et al. 2005), but the proteins have different roles. In our opinion, this hypothesis could be confirmed by our results carried out on human adult muscle, showing a contemporary presence of all sarcoglycans both with single and with double localizations and with RT-PCR method, in comparison with other results obtained on muscle of mdx mice (Straub et al. 1999) or on mouse C2C12 cells (Liu and Engvall 1999). Thus, our data clearly show that a- and e-sarcoglycans are coexpressed in different smooth muscle tissues and suggest that the two sarcoglycans could occupy two different sites in the same SGC. Because most studies indicate the presence of four sarcoglycans as a requirement for the functionality and viability of the complex, Barresi et al. (2000) hypothesized the expectance of a yet unidentified sarcoglycan, a homolog of g-sarcoglycan, in smooth muscle SGC. In our opinion, this unidentified sarcoglycan can be e- or ~-sarcoglycan, singularly or contemporaneously. In fact, e-sarcoglycan is widely expressed in parts of most tissues and physically associated with other DGC components (Ettinger et al. 1997), and ~-sarcoglycan has a high degree of similarity and homology with g-sarcoglycan (Wheeler et al. 2002). On this basis, our results provide the first suggestion that sarcoglycan subcomplex in smooth muscle and, potentially, also in skeletal and cardiac muscle, can consist of five or six distinct sarcoglycan subunits. Therefore, one intriguing possibility is the existence of a pentameric or, also considering ~-sarcoglycan detected by RT-PCR, hexameric model of SGC. This hypothetical new complex formed by all sarcoglycans could present a higher or lower expression of a single sarcoglycan in conformity with muscle type skeletal, cardiac, or smooth or also in conformity with the origin of smooth muscle, gastrointestinal, urogenital, or respiratory tract. The involvement of the hexameric structure of the sarcoglycan subcomplex is an intriguing possibility that may offer new approaches for the exact structural and signaling role of sarcoglycans and, consequently, for treatment of the sarcoglycanopathies. Literature Cited Anastasi G, Amato A, Tarone G, Vita G, Monici MC, Magaudda L, Brancaccio M, et al. (2003b) Distribution and localization of vinculin-talin-integrin system and dystrophin-glycoprotein complex in human skeletal muscle. Cells Tissues Organs 175: Anastasi G, Cutroneo G, Rizzo G, Arco A, Santoro G, Bramanti P, Vitetta AG, et al. (2004a) Sarcoglycan and integrin localization in normal human skeletal muscle: a CLSM (confocal laser scanning microscope) study. Eur J Histochem 48: Anastasi G, Cutroneo G, Sidoti A, Santoro G, D Angelo R, Rizzo G, Rinaldi C, et al. (2005) Sarcoglycan subcomplex in normal human smooth muscle: an immunohistochemical and molecular study. Int J Mol Med 16: Anastasi G, Cutroneo G, Trimarchi F, Rizzo G, Bramanti P, Bruschetta D, Fugazzotto D, et al. (2003a) Sarcoglycan in human skeletal muscle and human cardiac muscle: a confocal laser scanning microscope study. Cells Tissues Organs 173:54 63 Anastasi G, Cutroneo G, Trimarchi F, Santoro G, Bruschetta D, Bramanti P, Pisani A, et al. (2004b) Evaluation of sarcoglycans, vinculin-talin-integrin system and filamin2 in alpha- and gammasarcoglycanopathy: an immunohistochemical study. Int J Mol Med 14: Barohn RJ, Levine EJ, Olson JO, Mendell JR (1988) Gastric hypomotility in Duchenne s muscular dystrophy. N Engl J Med 319: Barresi R, Moore SA, Stolle CA, Mendell JR, Campbell KP (2000) Expression of g-sarcoglycan in smooth muscle and its interaction with the smooth muscle sarcoglycan-sarcospan complex. J Biol Chem 275: Betto R, Biral D, Sandonà D (1999) Functional roles of dystrophin and associated proteins: new insights for the sarcoglycans. Ital J Neurol Sci 20: Blake DJ, Weir A, Newey SE, Davies KE (2002) Function and genetics of dystrophin and dystrophin-related proteins in muscle. Physiol Rev 82: Bönnemann CG, Modi R, Noguchi S, Mizuno Y, Yoshida M, Gussoni E, McNally EM, et al. (1995) b-sarcoglycan (A3b) mutations cause autosomal recessive muscular dystrophy with loss of the sarcoglycan complex. Nat Genet 11: Bönnemann CG, Passos-Bueno MR, McNally EM, Vainzof M, Moreira ES, Marie SK, Pavanello RCM, et al. (1996) Genomic screening for b-sarcoglycan gene mutations: missense mutations may cause severe limb-girdle muscular dystrophy type 2E (LGMD 2E). Hum Mol Genet 5: Campbell KP (1995) Three muscular dystrophies: loss of cytoskeleton-extracellular matrix linkage. Cell 80: Chan Y, Bönnemann CG, Lidov HGW, Kunkel LM (1998) Molecular organization of sarcoglycan complex in mouse myotubes in culture. J Cell Biol 143: Chomczynski P, Sacchi N (1987) Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction. Anal Biochem 162: Cox GA, Sunada Y, Campbell KP, Chamberlain JS (1994) Dp71 can restore the dystrophin-associated glycoprotein complex in muscle but fails to prevent dystrophy. Nat Genet 8: Duclos F, Straub V, Moore SA, Venzke DP, Hrstka RF, Crosbie RH, Durbeej M, et al. (1998) Progressive muscular dystrophy in a-sarcoglycan-deficient mice. J Cell Biol 142: Durbeej M, Campbell KP (1999) Biochemical characterization of the epithelial dystroglycan complex. J Biol Chem 274: Durbeej M, Cohn RD, Hrstka RF, Moore SA, Allamand V, Davidson BL, Williamson RA, et al. (2000) Disruption of the b-sarcoglycan gene reveals pathogenetic complexity of limb-girdle muscular dystrophy type 2E. Mol Cell 5: Ettinger AJ, Feng G, Sanes JR (1997) e-sarcoglycan, a broadly

13 Sarcoglycan in Normal Human Smooth Muscle 843 expressed homologue of the gene mutated in limb-girdle muscular dystrophy 2D. J Biol Chem 272: Greenberg DS, Sunada Y, Campbell KP, Yaffe D, Nudel U (1994) Exogenous Dp71 restores the levels of dystrophin associated proteins but does not alleviate muscle damage in mdx mice. Nat Genet 84: Hack AA, Groh ME, McNally EM (2000) Sarcoglycans in muscular dystrophy. Microsc Res Tech 48: Holt KH, Campbell KP (1998) Assembly of the sarcoglycan complex. Insights for muscular dystrophy. J Biol Chem 273: Jaffe KM, McDonald CM, Ingman E, Haas J (1990) Symptoms of upper gastrointestinal dysfunction in Duchenne muscular dystrophy: case-control study. Arch Phys Med Rehabil 71: Jung D, Leturcq F, Sunada Y, Duclos F, Tome FMS, Moomaw C, Merlini L, et al. (1996) Absence of g-sarcoglycan (35 DAG) in autosomal recessive muscular dystrophy linked to chromosome 13q12. FEBS Lett 381:15 20 Lim LE, Duclos F, Broux O, Bourg N, Sunada Y, Allamand J, Meyer I, et al. (1995) b-sarcoglycan: characterization and role in limbgirdle muscular dystrophy linked to 4q12. Nat Genet 11: Liu LA, Engvall E (1999) Sarcoglycan isoforms in skeletal muscle. J Biol Chem 274: McNally EM, Ly CT, Kunkel LM (1998) Human e-sarcoglycan is highly related to a-sarcoglycan (adhalin), the limb girdle muscular dystrophy 2D gene. FEBS Lett 422:27 32 Noguchi S, McNally EM, Ben Othmane K, Hagiwara Y, Mizuno Y, Yoshida M, Yamamoto H, et al. (1995) Mutations in the dystrophin-associated protein g-sarcoglycan in chromosome 13 muscular dystrophy. Science 270: Ozawa E, Mizuno Y, Hagiwara Y, Sasaoka T, Yoshida M (2005) Molecular and cell biology of the sarcoglycan complex. Muscle Nerve 32: Roberds SL, Anderson RD, Ibraghimov-Beskrovnaya O, Campbell KP (1993) Primary structure and muscle-specific expression of the 50-kDa dystrophin-associated glycoprotein (adhalin). J Biol Chem 268: Roberds SL, Leturcq F, Allamand V, Piccolo F, Jeanpierr M, Anderson RD, Lim LE, et al. (1994) Missense mutations in the adhalin gene linked to autosomal recessive muscular dystrophy. Cell 8: Straub V, Campbell KP (1997) Muscular dystrophies and the dystrophin-glycoprotein complex. Curr Opin Neurol 10: Straub V, Ettinger AJ, Durbeej M, Venke DP, Cutshall S, Sanes JR, Campbell KP (1999) e-sarcoglycan replaces a-sarcoglycan in smooth muscle to form a unique dystrophin-glycoprotein complex. J Biol Chem 274: Suzuki A, Yoshida M, Yamamoto H, Ozawa E (1992) Glycoproteinbinding site of dystrophin is confined to the cysteine-rich domain and the first half of the carboxy-terminal domain. FEBS Lett 308: Tinsley JM, Blake DJ, Zuellig RA, Davies KE (1994) Increasing complexity of the dystrophin-associated protein complex. Proc Natl Acad Sci USA 91: Wheeler MT, McNally EM (2003) Sarcoglycans in vascular smooth and striated muscle. Trends Cardiovasc Med 13: Wheeler MT, Zarnegar S, McNally EM (2002) ~-Sarcoglycan, a novel component of the sarcoglycan complex, is reduced in muscular dystrophy. Hum Mol Genet 11: Yamamoto H, Mizuno Y, Hayashi K, Nonaka I, Yoshida M, Ozawa E (1994) Expression of dystrophin-associated protein 35DAG (A4) and 50DAG (A2) is confined to striated muscle. J Biochem (Tokyo) 115: Yoshida M, Suzuki A, Yamamoto H, Noguchi S, Mizuno Y, Ozawa E (1994) Dissociation of the complex of dystrophin and its associated proteins into several unique groups by n-octyl b-d-glucoside. Eur J Biochem 222: Yoshida T, Pan Y, Hanada H, Iwata Y, Shigekawa M (1998) Bidirectional signaling between sarcoglycans and the integrin adhesion system in cultured L6 myocytes. J Biol Chem 273:

Research Article: Histology and Cell Biology Preliminary study on sarcoglycan sub-complex in rat cerebral and cerebellar cortex

Research Article: Histology and Cell Biology Preliminary study on sarcoglycan sub-complex in rat cerebral and cerebellar cortex IJAE Vol. 117, n. 1: 54-64, 2012 Italian Journal of Anatomy and Embryology Research Article: Histology and Cell Biology Preliminary study on sarcoglycan sub-complex in rat cerebral and cerebellar cortex

More information

IJAE. Introduction. Key words Sarcoglycans, GABA A receptor, cerebellar cortex, neurons, rat. Vol. 120, n. 2: , 2015

IJAE. Introduction. Key words Sarcoglycans, GABA A receptor, cerebellar cortex, neurons, rat. Vol. 120, n. 2: , 2015 IJAE Vol. 120, n. 2: 105-116, 2015 ITALIAN JOURNAL OF ANATOMY AND EMBRYOLOGY Research article - Histology and cell biology Sarcoglycans and gaba a receptors in rat central nervous system: an immunohistochemical

More information

An Immunofluorescence Study About Staining Pattern Variability of Sarcoglycans in Rat s Cerebral and Cerebellar Cortex

An Immunofluorescence Study About Staining Pattern Variability of Sarcoglycans in Rat s Cerebral and Cerebellar Cortex Research Article imedpub Journals http://www.imedpub.com/ DOI: 10.21767/2248-9215.100049 European Journal of Experimental Biology An Immunofluorescence Study About Staining Pattern Variability of Sarcoglycans

More information

READ ORPHA.NET WEBSITE ABOUT BETA-SARCOGLYOCANOPATHY LIMB-GIRDLE MUSCULAR DYSTROPHIES

READ ORPHA.NET WEBSITE ABOUT BETA-SARCOGLYOCANOPATHY LIMB-GIRDLE MUSCULAR DYSTROPHIES READ ORPHA.NET WEBSITE ABOUT BETA-SARCOGLYOCANOPATHY LIMB-GIRDLE MUSCULAR DYSTROPHIES (LGMD) Limb-girdle muscular dystrophies (LGMD) are a heterogeneous group of genetically determined disorders with a

More information

Muscular Dystrophy. Biol 405 Molecular Medicine

Muscular Dystrophy. Biol 405 Molecular Medicine Muscular Dystrophy Biol 405 Molecular Medicine Duchenne muscular dystrophy Duchenne muscular dystrophy is a neuromuscular disease that occurs in ~ 1/3,500 male births. The disease causes developmental

More information

The New England Journal of Medicine MUTATIONS IN THE SARCOGLYCAN GENES IN PATIENTS WITH MYOPATHY

The New England Journal of Medicine MUTATIONS IN THE SARCOGLYCAN GENES IN PATIENTS WITH MYOPATHY MUTATIONS IN THE SARCOGLYCAN GENES IN PATIENTS WITH MYOPATHY DAVID J. DUGGAN, B.S., J. RAFAEL GOROSPE, M.D., PH.D., MARINA FANIN, M.S., ERIC P. HOFFMAN, PH.D., A CORRADO ANGELINI, M.D. ABSTRACT Background

More information

18 (2), DOI: /bjmg

18 (2), DOI: /bjmg 18 (2), 2015 71-76 DOI: 10.1515/bjmg-2015-0088 CASE REPORT SARCOLEMMAL DEFICIENCY OF SARCOGLYCAN COMPLEX IN AN 18-MONTH-OLD TURKISH BOY WITH A LARGE DELETION IN THE BETA SARCOGLYCAN GENE Diniz G 1,*, Tekgul

More information

Three Muscular Dystrophies: Loss of Cytoskeleton-Extracellular Matrix Linkage

Three Muscular Dystrophies: Loss of Cytoskeleton-Extracellular Matrix Linkage Cell, Vol. 80, 675-679, March 10, 1995, Copyright 1995 by Cell Press Three Muscular Dystrophies: Loss of Cytoskeleton-Extracellular Matrix Linkage Review Kevin P. Campbell Howard Hughes Medical Institute

More information

The dystrophin glycoprotein complex (DGC)1 consists

The dystrophin glycoprotein complex (DGC)1 consists Molecular Organization of Sarcoglycan Complex in Mouse Myotubes in Culture Yiu-mo Chan,* Carsten G. Bönnemann,* Hart G.W. Lidov, and Louis M. Kunkel* *Howard Hughes Medical Institute, Division of Genetics,

More information

K. P. Loss of sarcolemma nnos in sarcoglycandeficient

K. P. Loss of sarcolemma nnos in sarcoglycandeficient Loss of sarcolemma nnos in sarcoglycan-deficient muscle RACHELLE H. CROSBIE 1,2, RITA BARRESI 1, AND KEVIN P. CAMPBELL 1 Howard Hughes Medical Institute, Department of Physiology and Biophysics, Department

More information

Localization of talin in skeletal and cardiac muscles

Localization of talin in skeletal and cardiac muscles Volume 200, number 1 FEBS 3591 May 1986 Localization of talin in skeletal and cardiac muscles A.M. Belkin, N.I. Zhidkova and V.E. Koteliansky* Laboratory of Molecular and Cellular Cardiology, Institute

More information

CHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000)

CHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000) CHAPTER 4 RESULTS 4.1 Growth Characterization of C. vulgaris 4.1.1 Optical Density Growth study of Chlorella vulgaris based on optical density at 620 nm (OD 620 ) showed that all three replicates had similar

More information

Disruption of heart sarcoglycan complex and severe cardiomyopathy caused by β sarcoglycan mutations

Disruption of heart sarcoglycan complex and severe cardiomyopathy caused by β sarcoglycan mutations 102 Department of Neuromuscular Diseases, Istituto Nazionale Neurologico C Besta, Via Celoria 11, 20133 Milano, Italy R Barresi C Di Blasi T Negri R Brugnoni S Daniel F Cornelio L Morandi M Mora Department

More information

Chapter 3. Expression of α5-megfp in Mouse Cortical Neurons. on the β subunit. Signal sequences in the M3-M4 loop of β nachrs bind protein factors to

Chapter 3. Expression of α5-megfp in Mouse Cortical Neurons. on the β subunit. Signal sequences in the M3-M4 loop of β nachrs bind protein factors to 22 Chapter 3 Expression of α5-megfp in Mouse Cortical Neurons Subcellular localization of the neuronal nachr subtypes α4β2 and α4β4 depends on the β subunit. Signal sequences in the M3-M4 loop of β nachrs

More information

about structure and function between ipsilateral and contralateral muscles could, long-term, lead and/ or worsen skeletal asymmetries.

about structure and function between ipsilateral and contralateral muscles could, long-term, lead and/ or worsen skeletal asymmetries. European Journal of Histochemistry 2016; volume 60:2605 Morphofunctional compensation of masseter muscles in unilateral posterior crossbite patients G. Cutroneo, 1 G. Vermiglio, 1 A. Centofanti, 1 G. Rizzo,

More information

Dystrophin-glycoprotein complex: molecular organization and critical roles in skeletal muscle

Dystrophin-glycoprotein complex: molecular organization and critical roles in skeletal muscle Dystrophin-glycoprotein complex: molecular organization and critical roles in skeletal muscle Yoshihide Sunada and Kevin P. Campbell Howard Hughes Medical Institute, Department of Physiology and Biophysics,

More information

Progress in human genetics has identified a number. -Sarcoglycan Deficiency Leads to Muscle Membrane Defects and Apoptosis Independent of Dystrophin

Progress in human genetics has identified a number. -Sarcoglycan Deficiency Leads to Muscle Membrane Defects and Apoptosis Independent of Dystrophin -Sarcoglycan Deficiency Leads to Muscle Membrane Defects and Apoptosis Independent of Dystrophin Andrew A. Hack,* Chantal T. Ly, Fang Jiang, Cynthia J. Clendenin, Kirsten S. Sigrist, Robert L. Wollmann,

More information

For in vitro Veterinary Diagnostics only. Kylt Rotavirus A. Real-Time RT-PCR Detection.

For in vitro Veterinary Diagnostics only. Kylt Rotavirus A. Real-Time RT-PCR Detection. For in vitro Veterinary Diagnostics only. Kylt Rotavirus A Real-Time RT-PCR Detection www.kylt.eu DIRECTION FOR USE Kylt Rotavirus A Real-Time RT-PCR Detection A. General Kylt Rotavirus A products are

More information

Immunohistochemical Study of Dystrophin Associated Glycoproteins in Limb-girdle Muscular Dystrophies

Immunohistochemical Study of Dystrophin Associated Glycoproteins in Limb-girdle Muscular Dystrophies Dystrophin Immunohistochemical Study of Dystrophin Associated Glycoproteins in Limb-girdle Muscular Dystrophies NSC 89-2314-B-002-111 88 8 1 89 7 31 ( Peroxidase -AntiPeroxidase Immnofluorescence) Abstract

More information

T he limb-girdle muscular dystrophies (LGMDs) are genetically

T he limb-girdle muscular dystrophies (LGMDs) are genetically 1of8 ELECTRONIC LETTER Genotype-phenotype correlations in 35 Brazilian families with sarcoglycanopathies including the description of three novel mutations E S Moreira, M Vainzof, O T Suzuki, RCMPavanello,

More information

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan

More information

Table S1. Primers and PCR protocols for mutation screening of MN1, NF2, KREMEN1 and ZNRF3.

Table S1. Primers and PCR protocols for mutation screening of MN1, NF2, KREMEN1 and ZNRF3. Table S1. Primers and PCR protocols for mutation screening of MN1, NF2, KREMEN1 and ZNRF3. MN1 (Accession No. NM_002430) MN1-1514F 5 -GGCTGTCATGCCCTATTGAT Exon 1 MN1-1882R 5 -CTGGTGGGGATGATGACTTC Exon

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Deficiency of -sarcoglycan differently affects fast- and slow-twitch skeletal muscles

Deficiency of -sarcoglycan differently affects fast- and slow-twitch skeletal muscles Am J Physiol Regul Integr Comp Physiol 289: R1328 R1337, 2005. First published July 7, 2005; doi:10.1152/ajpregu.00673.2004. Deficiency of -sarcoglycan differently affects fast- and slow-twitch skeletal

More information

International Graduate Research Programme in Cardiovascular Science

International Graduate Research Programme in Cardiovascular Science 1 International Graduate Research Programme in Cardiovascular Science This work has been supported by the European Community s Sixth Framework Programme under grant agreement n LSHM-CT-2005-01883 EUGeneHeart.

More information

Supplementary Information Titles Journal: Nature Medicine

Supplementary Information Titles Journal: Nature Medicine Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A.

Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Upper part, three-primer PCR strategy at the Mcm3 locus yielding

More information

Gene therapy and genome editing technologies for the study and potential treatment of :

Gene therapy and genome editing technologies for the study and potential treatment of : WORKSHOP ON GENOME EDITING Gene therapy and genome editing technologies for the study and potential treatment of : Duchenne Muscular Dystrophy by Dr France Piétri-Rouxel, Institut de Myologie Centre de

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Choi YL, Soda M, Yamashita Y, et al. EML4-ALK mutations in

More information

Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell

Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Wenxin Li Department of Biological Sciences Fordham University Abstract MEFV is a human gene that codes for an

More information

14. BIBLIOGRAFÍA Y REFERENCIAS CITADAS

14. BIBLIOGRAFÍA Y REFERENCIAS CITADAS 14. BIBLIOGRAFÍA Y REFERENCIAS CITADAS Ahn AH y Kunkel LM. 1995. Syntrophin binds to an alternatively spliced exon of dystrophin. J Cell Biol. 128: 363-371. Ailhaud G y Hauner H. Development of white adipose

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 The average sigmoid parametric curves of capillary dilation time courses and average time to 50% peak capillary diameter dilation computed from individual capillary responses averaged

More information

Senior Thesis. Presented to. The Faculty of the School of Arts and Sciences Brandeis University

Senior Thesis. Presented to. The Faculty of the School of Arts and Sciences Brandeis University Greenwald 1 Mouse intercellular adhesion molecule 1 (ICAM-1) isoforms demonstrate different binding affinities to mouse macrophage-1 antigen (Mac-1) and preliminary evidence for alternatively-spliced variants

More information

Muscle Tissue. General concepts. Classification of muscle. I. Functional classification is based on the type of neural control.

Muscle Tissue. General concepts. Classification of muscle. I. Functional classification is based on the type of neural control. Muscle Tissue LEARNING OBJECTIVES 1. Identify the three types of muscle tissue at the light microscopic level. 2. List and compare the structural and functional features of each of the three muscle fiber

More information

SUPPORTING MATREALS. Methods and Materials

SUPPORTING MATREALS. Methods and Materials SUPPORTING MATREALS Methods and Materials Cell Culture MC3T3-E1 (subclone 4) cells were maintained in -MEM with 10% FBS, 1% Pen/Strep at 37ºC in a humidified incubator with 5% CO2. MC3T3 cell differentiation

More information

Supplementary Figure 1 Expression of Crb3 in mouse sciatic nerve: biochemical analysis (a) Schematic of Crb3 isoforms, ERLI and CLPI, indicating the

Supplementary Figure 1 Expression of Crb3 in mouse sciatic nerve: biochemical analysis (a) Schematic of Crb3 isoforms, ERLI and CLPI, indicating the Supplementary Figure 1 Expression of Crb3 in mouse sciatic nerve: biochemical analysis (a) Schematic of Crb3 isoforms, ERLI and CLPI, indicating the location of the transmembrane (TM), FRM binding (FB)

More information

MUSCLE DISEASE ANTIBODIES NOVOCASTRA ADVANCING MUSCLE DISEASE DIAGNOSIS, MANAGEMENT AND RESEARCH RESULTS YOU CAN RELY ON

MUSCLE DISEASE ANTIBODIES NOVOCASTRA ADVANCING MUSCLE DISEASE DIAGNOSIS, MANAGEMENT AND RESEARCH RESULTS YOU CAN RELY ON MUSCLE DISEASE ANTIBODIES ADVANCING MUSCLE DISEASE DIAGNOSIS, MANAGEMENT AND RESEARCH NOVOCASTRA RESULTS YOU CAN RELY ON Novocastra Muscle Disease Antibodies The Novocastra muscle disease portfolio comprises

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Online Appendix Material and Methods: Pancreatic RNA isolation and quantitative real-time (q)rt-pcr. Mice were fasted overnight and killed 1 hour (h)

Online Appendix Material and Methods: Pancreatic RNA isolation and quantitative real-time (q)rt-pcr. Mice were fasted overnight and killed 1 hour (h) Online Appendix Material and Methods: Pancreatic RNA isolation and quantitative real-time (q)rt-pcr. Mice were fasted overnight and killed 1 hour (h) after feeding. A small slice (~5-1 mm 3 ) was taken

More information

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on

More information

Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/-

Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.

More information

MRC-Holland MLPA. Description version 07; 26 November 2015

MRC-Holland MLPA. Description version 07; 26 November 2015 SALSA MLPA probemix P266-B1 CLCNKB Lot B1-0415, B1-0911. As compared to version A1 (lot A1-0908), one target probe for CLCNKB (exon 11) has been replaced. In addition, one reference probe has been replaced

More information

Phosphate buffered saline (PBS) for washing the cells TE buffer (nuclease-free) ph 7.5 for use with the PrimePCR Reverse Transcription Control Assay

Phosphate buffered saline (PBS) for washing the cells TE buffer (nuclease-free) ph 7.5 for use with the PrimePCR Reverse Transcription Control Assay Catalog # Description 172-5080 SingleShot Cell Lysis Kit, 100 x 50 µl reactions 172-5081 SingleShot Cell Lysis Kit, 500 x 50 µl reactions For research purposes only. Introduction The SingleShot Cell Lysis

More information

Yara Saddam. Amr Alkhatib. Ihsan

Yara Saddam. Amr Alkhatib. Ihsan 1 Yara Saddam Amr Alkhatib Ihsan NOTE: Yellow highlighting=correction/addition to the previous version of the sheet. Histology (micro anatomy) :- the study of tissues and how they are arranged into organs.

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

Supplementary Materials and Methods

Supplementary Materials and Methods Supplementary Materials and Methods Immunoblotting Immunoblot analysis was performed as described previously (1). Due to high-molecular weight of MUC4 (~ 950 kda) and MUC1 (~ 250 kda) proteins, electrophoresis

More information

Disruption of the -Sarcoglycan Gene Reveals Pathogenetic Complexity of Limb-Girdle Muscular Dystrophy Type 2E

Disruption of the -Sarcoglycan Gene Reveals Pathogenetic Complexity of Limb-Girdle Muscular Dystrophy Type 2E Molecular Cell, Vol. 5, 141 151, January, 2000, Copyright 2000 by Cell Press Disruption of the -Sarcoglycan Gene Reveals Pathogenetic Complexity of Limb-Girdle Muscular Dystrophy Type 2E Madeleine Durbeej,*

More information

Peripheral nerve dystroglycan: its function and potential role in the molecular pathogenesis of neuromuscular diseases

Peripheral nerve dystroglycan: its function and potential role in the molecular pathogenesis of neuromuscular diseases Y. Fukuyama, M. Osawa and K. Saito (Eds.), Congenital Muscular Dyrfrophies O 1997 Elsevier Science B.V. All rights reserved CHAPTER 22 Peripheral nerve dystroglycan: its function and potential role in

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding

More information

Pair-fed % inkt cells 0.5. EtOH 0.0

Pair-fed % inkt cells 0.5. EtOH 0.0 MATERIALS AND METHODS Histopathological analysis Liver tissue was collected 9 h post-gavage, and the tissue samples were fixed in 1% formalin and paraffin-embedded following a standard procedure. The embedded

More information

******************************************************************************************************* MUSCLE CYTOLOGY AND HISTOLOGY

******************************************************************************************************* MUSCLE CYTOLOGY AND HISTOLOGY BIOLOGY 211: HUMAN ANATOMY & PHYSIOLOGY ******************************************************************************************************* MUSCLE CYTOLOGY AND HISTOLOGY *******************************************************************************************************

More information

Bio 111 Study Guide Chapter 17 From Gene to Protein

Bio 111 Study Guide Chapter 17 From Gene to Protein Bio 111 Study Guide Chapter 17 From Gene to Protein BEFORE CLASS: Reading: Read the introduction on p. 333, skip the beginning of Concept 17.1 from p. 334 to the bottom of the first column on p. 336, and

More information

Chapter Skeletal Muscle Structure and Function

Chapter Skeletal Muscle Structure and Function Chapter 10.2 Skeletal Muscle Structure and Function Introduction to Muscle Physiology Movement is a fundamental characteristic of all living things All muscle cells (skeletal, cardiac, and smooth) are

More information

A549 and A549-fLuc cells were maintained in high glucose Dulbecco modified

A549 and A549-fLuc cells were maintained in high glucose Dulbecco modified Cell culture and animal model A549 and A549-fLuc cells were maintained in high glucose Dulbecco modified Eagle medium supplemented with 10% fetal bovine serum at 37 C in humidified atmosphere containing

More information

Supplementary Material and Methods

Supplementary Material and Methods Online Supplement Kockx et al, Secretion of Apolipoprotein E from Macrophages 1 Supplementary Material and Methods Cloning of ApoE-GFP Full-length human apoe3 cdna (pcdna3.1/zeo + -apoe) was kindly provided

More information

Skeletal Muscle and the Molecular Basis of Contraction. Lanny Shulman, O.D., Ph.D. University of Houston College of Optometry

Skeletal Muscle and the Molecular Basis of Contraction. Lanny Shulman, O.D., Ph.D. University of Houston College of Optometry Skeletal Muscle and the Molecular Basis of Contraction Lanny Shulman, O.D., Ph.D. University of Houston College of Optometry Like neurons, all muscle cells can be excited chemically, electrically, and

More information

Supplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway

Supplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.

More information

Supplementary Figure 1: Co-localization of reconstituted L-PTC and dendritic cells

Supplementary Figure 1: Co-localization of reconstituted L-PTC and dendritic cells a CD11c Na + K + ATPase Na + K + ATPase CD11c x-y CD11c Na + K + ATPase Na + K + ATPase CD11c x-z c b x-y view BoNT NAPs CD11c BoNT CD11c NAPs BoNT NAPs CD11c 90 x-z view Apical Basolateral Supplementary

More information

Cell Biology Lecture 9 Notes Basic Principles of cell signaling and GPCR system

Cell Biology Lecture 9 Notes Basic Principles of cell signaling and GPCR system Cell Biology Lecture 9 Notes Basic Principles of cell signaling and GPCR system Basic Elements of cell signaling: Signal or signaling molecule (ligand, first messenger) o Small molecules (epinephrine,

More information

Outline. Bio 105: Muscular System. Muscular System. Types of Muscles. Smooth Muscle. Cardiac Muscle 4/6/2016

Outline. Bio 105: Muscular System. Muscular System. Types of Muscles. Smooth Muscle. Cardiac Muscle 4/6/2016 Outline Bio 105: Muscular System Lecture 11 Chapter 6 Characteristics of muscles 3 types of muscles Functions of muscles Structure of skeletal muscles Mechanics of muscle contraction Energy sources for

More information

Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2],

Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2], Supplementary information Methods Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2], and A/Hong Kong/213/03 [H5N1]) were grown in Madin-Darby canine kidney (MDCK) cells

More information

Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4)

Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4) Identification and characterization of multiple splice variants of Cdc2-like kinase 4 (Clk4) Vahagn Stepanyan Department of Biological Sciences, Fordham University Abstract: Alternative splicing is an

More information

Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS)

Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS) Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS) and their exosomes (EXO) in resting (REST) and activated

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with

More information

SUPPLEMENTARY METHODS

SUPPLEMENTARY METHODS SUPPLEMENTARY METHODS Histological analysis. Colonic tissues were collected from 5 parts of the middle colon on day 7 after the start of DSS treatment, and then were cut into segments, fixed with 4% paraformaldehyde,

More information

Histology = the study of tissues. Tissue = a complex of cells that have a common function

Histology = the study of tissues. Tissue = a complex of cells that have a common function { EPITHELIAL TISSUE Histology = the study of tissues Tissue = a complex of cells that have a common function The Four Primary Tissue Types: Epithelium (epithelial tissue) covers body surfaces, lines body

More information

Human Rotavirus A. genesig Advanced Kit. Non structural protein 5 (NSP5) 150 tests. Primerdesign Ltd. For general laboratory and research use only

Human Rotavirus A. genesig Advanced Kit. Non structural protein 5 (NSP5) 150 tests. Primerdesign Ltd. For general laboratory and research use only TM Primerdesign Ltd Human Rotavirus A Non structural protein 5 (NSP5) genesig Advanced Kit 150 tests For general laboratory and research use only 1 Introduction to Human Rotavirus A Rotavirus is a genus

More information

T he sarcoglycanopathies are a group of autosomal

T he sarcoglycanopathies are a group of autosomal 1of7 ONLINE MUTATION REPORT Novel sarcoglycan gene mutations in a large cohort of Italian patients C Boito, M Fanin, G Siciliano, C Angelini, E Pegoraro... T he sarcoglycanopathies are a group of autosomal

More information

CELLS. Cells. Basic unit of life (except virus)

CELLS. Cells. Basic unit of life (except virus) Basic unit of life (except virus) CELLS Prokaryotic, w/o nucleus, bacteria Eukaryotic, w/ nucleus Various cell types specialized for particular function. Differentiation. Over 200 human cell types 56%

More information

Role of Paired Box9 (PAX9) (rs ) and Muscle Segment Homeobox1 (MSX1) (581C>T) Gene Polymorphisms in Tooth Agenesis

Role of Paired Box9 (PAX9) (rs ) and Muscle Segment Homeobox1 (MSX1) (581C>T) Gene Polymorphisms in Tooth Agenesis EC Dental Science Special Issue - 2017 Role of Paired Box9 (PAX9) (rs2073245) and Muscle Segment Homeobox1 (MSX1) (581C>T) Gene Polymorphisms in Tooth Agenesis Research Article Dr. Sonam Sethi 1, Dr. Anmol

More information

Medical Biology. Dr. Khalida Ibrahim

Medical Biology. Dr. Khalida Ibrahim Dr. Khalida Ibrahim Medical Biology MUSCLE TISSUE 1. Muscle tissue is characterized by its well-developed properties of contraction. 2. Muscle is responsible for the movements of the body and the various

More information

Insulin Resistance. Biol 405 Molecular Medicine

Insulin Resistance. Biol 405 Molecular Medicine Insulin Resistance Biol 405 Molecular Medicine Insulin resistance: a subnormal biological response to insulin. Defects of either insulin secretion or insulin action can cause diabetes mellitus. Insulin-dependent

More information

WHO Prequalification of In Vitro Diagnostics PUBLIC REPORT. Product: Alere q HIV-1/2 Detect WHO reference number: PQDx

WHO Prequalification of In Vitro Diagnostics PUBLIC REPORT. Product: Alere q HIV-1/2 Detect WHO reference number: PQDx WHO Prequalification of In Vitro Diagnostics PUBLIC REPORT Product: Alere q HIV-1/2 Detect WHO reference number: PQDx 0226-032-00 Alere q HIV-1/2 Detect with product codes 270110050, 270110010 and 270300001,

More information

RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using

RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Supplementary Information Materials and Methods RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Trizol reagent (Invitrogen,Carlsbad, CA) according to the manufacturer's instructions.

More information

Instructions. Fuse-It-mRNA easy. Shipping and Storage. Overview. Kit Contents. Specifications. Note: Important Guidelines

Instructions. Fuse-It-mRNA easy. Shipping and Storage. Overview. Kit Contents. Specifications. Note: Important Guidelines Membrane fusion is a highly efficient method for transfecting various molecules and particles into mammalian cells, even into sensitive and primary cells. The Fuse-It reagents are cargo-specific liposomal

More information

Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation

Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation J. Du 1, Z.H. Tao 2, J. Li 2, Y.K. Liu 3 and L. Gan 2 1 Department of Chemistry,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer

TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer AD Award Number: TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer PRINCIPAL INVESTIGATOR: Audrey van Drogen, Ph.D. CONTRACTING ORGANIZATION: Sidney

More information

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the

More information

Chapter 4. Estrogen receptor expression in human macrophages

Chapter 4. Estrogen receptor expression in human macrophages Chapter 4 Estrogen receptor expression in human macrophages 4.1. Introduction Macrophages respond to estrogen present in their microenvironment and hence should express functional estrogen receptors unless

More information

Thursday, October 16 th

Thursday, October 16 th Thursday, October 16 th Good morning. Those of you needing to take the Enzymes and Energy Quiz will start very soon. Students who took the quiz Wednesday: Please QUIETLY work on the chapter 6 reading guide.

More information

Norgen s HIV Proviral DNA PCR Kit was developed and validated to be used with the following PCR instruments: Qiagen Rotor-Gene Q BioRad T1000 Cycler

Norgen s HIV Proviral DNA PCR Kit was developed and validated to be used with the following PCR instruments: Qiagen Rotor-Gene Q BioRad T1000 Cycler 3430 Schmon Parkway Thorold, ON, Canada L2V 4Y6 Phone: 866-667-4362 (905) 227-8848 Fax: (905) 227-1061 Email: techsupport@norgenbiotek.com HIV Proviral DNA PCR Kit Product# 33840 Product Insert Intended

More information

Structures in Cells. Cytoplasm. Lecture 5, EH1008: Biology for Public Health, Biomolecules

Structures in Cells. Cytoplasm. Lecture 5, EH1008: Biology for Public Health, Biomolecules Structures in Cells Lecture 5, EH1008: Biology for Public Health, Biomolecules Limian.zheng@ucc.ie 1 Cytoplasm Nucleus Centrioles Cytoskeleton Cilia Microvilli 2 Cytoplasm Cellular material outside nucleus

More information

Primary Cilia are Expressed on a Small Fraction of Cells in Trabecular Bone and Marrow

Primary Cilia are Expressed on a Small Fraction of Cells in Trabecular Bone and Marrow Primary Cilia are Expressed on a Small Fraction of Cells in Trabecular Bone and Marrow Thomas R. Coughlin 1, Muriel Voisin, Ph.D. 2, Glen L. Niebur, PhD 1, Laoise M. McNamara 2. 1 University of Notre Dame,

More information

Supplementary table and figures

Supplementary table and figures 3D single molecule tracking with multifocal plane microscopy reveals rapid intercellular transferrin transport at epithelial cell barriers Sripad Ram, Dongyoung Kim, Raimund J. Ober and E. Sally Ward Supplementary

More information

Mechanisms of alternative splicing regulation

Mechanisms of alternative splicing regulation Mechanisms of alternative splicing regulation The number of mechanisms that are known to be involved in splicing regulation approximates the number of splicing decisions that have been analyzed in detail.

More information

Doctor of Philosophy

Doctor of Philosophy Regulation of Gene Expression of the 25-Hydroxyvitamin D la-hydroxylase (CYP27BI) Promoter: Study of A Transgenic Mouse Model Ivanka Hendrix School of Molecular and Biomedical Science The University of

More information

Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated

Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C genes. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated from 7 day-old seedlings treated with or without

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/1171320/dc1 Supporting Online Material for A Frazzled/DCC-Dependent Transcriptional Switch Regulates Midline Axon Guidance Long Yang, David S. Garbe, Greg J. Bashaw*

More information

Annexin V-PE Apoptosis Detection Kit

Annexin V-PE Apoptosis Detection Kit Annexin V-PE Apoptosis Detection Kit Catalog Number KA0716 100 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information...

More information

Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS

Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS nucleotide sequences (a, b) or amino acid sequences (c) from

More information

Recommended laboratory tests to identify influenza A/H5 virus in specimens from patients with an influenza-like illness

Recommended laboratory tests to identify influenza A/H5 virus in specimens from patients with an influenza-like illness World Health Organization Recommended laboratory tests to identify influenza A/H5 virus in specimens from patients with an influenza-like illness General information Highly pathogenic avian influenza (HPAI)

More information

Abhd2 regulates alveolar type Ⅱ apoptosis and airway smooth muscle remodeling: a key target of COPD research

Abhd2 regulates alveolar type Ⅱ apoptosis and airway smooth muscle remodeling: a key target of COPD research Abhd2 regulates alveolar type Ⅱ apoptosis and airway smooth muscle remodeling: a key target of COPD research Shoude Jin Harbin Medical University, China Background COPD ------ a silent killer Insidious,

More information

Iowa Wellstone Center Muscle Tissue and Cell Culture Repository

Iowa Wellstone Center Muscle Tissue and Cell Culture Repository Iowa Wellstone Center Muscle Tissue and Cell Culture Repository Steven A. Moore, M.D., Ph.D. The University of Iowa Department of Pathology and Iowa Wellstone Muscular Dystrophy Cooperative Research Center

More information

In cardiac muscle, the dystrophin glycoprotein complex includes

In cardiac muscle, the dystrophin glycoprotein complex includes Dissociation of Sarcoglycans and the Dystrophin Carboxyl Terminus From the Sarcolemma in Enteroviral Cardiomyopathy Gil-Hwan Lee,* Cornel Badorff,* Kirk U. Knowlton Abstract Enteroviral infection can cause

More information

Altered membrane proteins and permeability correlate with cardiac dysfunction in cardiomyopathic hamsters

Altered membrane proteins and permeability correlate with cardiac dysfunction in cardiomyopathic hamsters Am J Physiol Heart Circ Physiol 278: H1362 H1370, 2000. Altered membrane proteins and permeability correlate with cardiac dysfunction in cardiomyopathic hamsters YASUHIRO IKEDA, 1 MARYANN MARTONE, 2 YUSU

More information

MRC-Holland MLPA. Description version 14; 28 September 2016

MRC-Holland MLPA. Description version 14; 28 September 2016 SALSA MLPA probemix P279-B3 CACNA1A Lot B3-0816. As compared to version B2 (lot B2-1012), one reference probe has been replaced and the length of several probes has been adjusted. Voltage-dependent calcium

More information

Structures in Cells. Lecture 5, EH1008: Biology for Public Health, Biomolecules.

Structures in Cells. Lecture 5, EH1008: Biology for Public Health, Biomolecules. Structures in Cells Lecture 5, EH1008: Biology for Public Health, Biomolecules Limian.zheng@ucc.ie 1 Cytoplasm Nucleus Centrioles Cytoskeleton Cilia Microvilli 2 Cytoplasm Cellular material outside nucleus

More information