Xiangde Liu, Amy Nelson, Xingqi Wang, MahaFarid, Yoko Gunji, Jun Ikari, ShunIwasawa, HeshamBasma, Carol Feghali-Bostwick, Stephen I.
|
|
- Vivien Bryan
- 5 years ago
- Views:
Transcription
1 Online Data Supplement Vitamin D Modulates PGE 2 Synthesis and Degradation in Human Lung Fibroblasts Xiangde Liu, Amy Nelson, Xingqi Wang, MahaFarid, Yoko Gunji, Jun Ikari, ShunIwasawa, HeshamBasma, Carol Feghali-Bostwick, Stephen I. Rennard
2 Supplement Materials and Methods Collagen gel contraction assay Gels were prepared using a previously published method (18). Briefly, distilled water, 4 X concentrated DMEM and RTTC were mixed so that the final mixture resulted in a physiological ionic strength, that is, 1 X DMEM and a ph of 7.4. Cell pellets were suspended with serum free DMEM (SF-DMEM) at a density of 10 7 cells/ml and then mixed with the RTTC solution mentioned above so that the final cell density in the collagen solution was 3 x 10 5 cells/ml, and the final concentration of collagen was 0.75 mg/ml. Aliquots of the mixture were then cast into each well of 24-well tissue culture plate (0.5ml/well). After 20 minutes at room temperature during which gelation occurs, the gels were released into 60mm tissue culture dishes (three gels each dish), which contained 5ml of freshly prepared SF-DMEM with or without vitamin Ds as designed. The gels were then incubated at 37 C in a 5% CO 2 atmosphere for 5 days as indicated, and the area of each gel was measured with an Optimax V Image Analyzer (Optimax, Burlington, MA) daily. Data were expressed as the percentage of the size compared to original gel size. Supplement Figure 1. Effect of vitamin Ds on PGE 2, fibronectin, TGF-ß1 and VEGF release by HFL-1 cells cultured in three-dimensional collagen gels. HFL-1 cells were cast into the collagen gelsand released into SF-DMEM containing EOH (1:1000), 1µM vitamin D, 25(OH)D or 1,25(OH) 2 D.After 2 days culture, medium was harvested for quantification of PGE 2, fibronectin, TGF-ß1 or VEGF as described in the Materials and Methods. Vertical axes: protein amount adjusted by cell number; horizontal axes: treatment. Data presented are one representative from 4 separate experiments. ** p<0.05. Supplement Figure 2. Effect of Vitamin D, 25(OH)D and 1,25(OH) 2 D fibroblast-mediated collagen gel contraction. Panel A: Time-dependent
3 effect. HFL-1 cells were cast into collagen gels as described in the materials and methods. After 20 minutes polymerization at room temperature, gels were released into SF-DMEM plus EOH (1:1000), vitamin D (1µM), 25(OH)D (1µM) or 1,25(OH) 2 D (1µM) and allowed to contract for 5 days. Gel size was measured with an image analyzer daily. Vertical axis: gel size expressed as percent of initial size (%); horizontal axis: time (day). Data presented is one representative of 6 separate experiments. Panel B: Concentration-dependent effect. Collagen gels with fibroblasts were released into SF-DMEM containing varying concentrations of vitamin D, 25(OH)D or 1,25(OH) 2 D. Gel size was measured on day 2. Vertical axis: gel size expressed as percent of initial size (%); horizontal axis: concentrations of vitamin Ds (nm). Data presented is one representative of 3 separate experiments. Panel C: Effect of exogenous PGE 2. Collagen gels with fibroblasts were released into SF-DMEM containing varying concentrations of PGE2 witheoh (1:1000), vitamin D (1µM), 25(OH)D (1µM) or 1,25(OH) 2 D (1µM). Gel size was measured on day 2. Vertical axis: gel size expressed as percent of initial size (%); horizontal axis: concentration of PGE 2 (M). Data presented is one representative of 3 separate experiments.* p<0.05, ** p<0.01 compared to no PGE 2 by Two-way ANOVA followed by Bonferroni correction. Panel D: Effect of indomethacin. HFL-1 cells were pre-treated with 1µM indomethacin for 4 hours. Cells were then cast into collagen gels and released into SF-DMEM supplemented with 0, 100nM, 500nM or 1000nM 25(OH)D. Gel size was measured on day 2. Vertical axis: gel size expressed as percent of initial size (%); horizontal axis: concentrations of 25(OH)D (nm). Data presented is one representative of 3 separate experiments. * p<0.05, ** p<0.01 by Two-way ANOVA followed by Bonferroni correction. Supplement Figure 3. Effect of vitamin D on -smooth muscle actin ( -SMA) expression.hfl-1 cells were treated with ethanol (1:1000), 1µM vitamin D, 25(OH)D, 1,25(OH)2D, or 100pM TGF-ß1 for 24 hours. Total cell lysates were harvested and immunoblotted to -SMA and ß-actin as described in the methods.
4 Supplement Figure 4. Effect of VDR-siRNA on the expression of 15-PGDH and mpges-1.hfl-1 cells were transfected with control-sirna or VDR-siRNA. Total cell lysates were harvested and immunoblottedfor VDR, 15-PGDH, mpges-1 and ß-actin as describedin the materials and methods.
5 A. B. C. D. Supplemental Figure 1
6 A. Time-dependent effect C. Effect of exogenous PGE 2 B. Concentration-dependent effect D. Effect of indomethacin Supplement Figure 2
7 Effect on α-sma EOH Vitamin D 25(OH)D 1,25(OH) 2 D TGF-ß1 α-sma ß-actin Supplement Figure 3
8 Con-siRNA VDR-siRNA ß-actin VDR 15-PGDH mpges-1 Supplement Figure 4
SUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationSupplemental Materials. STK16 regulates actin dynamics to control Golgi organization and cell cycle
Supplemental Materials STK16 regulates actin dynamics to control Golgi organization and cell cycle Juanjuan Liu 1,2,3, Xingxing Yang 1,3, Binhua Li 1, Junjun Wang 1,2, Wenchao Wang 1, Jing Liu 1, Qingsong
More informationSupplementary Figure 1. Characterization of human carotid plaques. (a) Flash-frozen human plaques were separated into vulnerable (V) and stable (S),
Supplementary Figure 1. Characterization of human carotid plaques. (a) Flash-frozen human plaques were separated into vulnerable (V) and stable (S), regions which were then quantified for mean fluorescence
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationSupplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.
More informationSupplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).
More informationDownregulation of the small GTPase SAR1A: a key event underlying alcohol-induced Golgi fragmentation in hepatocytes
Downregulation of the small GTPase SAR1A: a key event underlying alcohol-induced Golgi fragmentation in hepatocytes Armen Petrosyan 1*, Pi-Wan Cheng 1,3, Dahn L. Clemens 2,3 & Carol A. Casey 2,3 1 Department
More informationAPPLICATION SPECIFIC PROTOCOL ANGIOGENESIS... 1 TABLE OF CONTENTS... 1 MONOLAYER FORMATION... 2 OPTION 1: APPLICATION OF ANGIOGENIC STIMULI...
APPLICATION SPECIFIC PROTOCOL ANGIOGENESIS AIM 3D Cell Culture Chips offer a new perspective in studying angiogenesis by allowing the growth of new vascular sprouts in a 3D matrix from a pre-existing endothelial
More informationSupplemental Material:
Supplemental Material: MATERIALS AND METHODS RNA interference Mouse CHOP sirna (ON-TARGETplus SMARTpool Cat# L-062068-00) and control sirna (ON-TARGETplus Control) were purchased from Dharmacon. Transfection
More informationCD34 + VEGFR-3 + progenitor cells have a potential to differentiate towards lymphatic endothelial cells
CD34 + VEGFR-3 + progenitor cells have a potential to differentiate towards lymphatic endothelial cells Tan YZ et al. J Cell Mol Med. (2014 Mar;18(3):422-33) Denise Traxler-Weidenauer April 2014 Introduction
More informationSupplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice.
Supplementary Figures: Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice. Male apoe -/- mice were fed a high-fat diet for 8 weeks, and given PBS (model group) or
More informationImpact of hyper-o-glcnacylation on apoptosis and NF-κB activity SUPPLEMENTARY METHODS
SUPPLEMENTARY METHODS 3D culture and cell proliferation- MiaPaCa-2 cell culture in 3D was performed as described previously (1). Briefly, 8-well glass chamber slides were evenly coated with 50 µl/well
More informationInhibition of TGFβ enhances chemotherapy action against triple negative breast cancer by abrogation of
SUPPLEMENTAL DATA Inhibition of TGFβ enhances chemotherapy action against triple negative breast cancer by abrogation of cancer stem cells and interleukin-8 Neil E. Bhola 1, Justin M. Balko 1, Teresa C.
More informationB16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small
More informationsupplementary information
DOI: 10.1038/ncb2133 Figure S1 Actomyosin organisation in human squamous cell carcinoma. (a) Three examples of actomyosin organisation around the edges of squamous cell carcinoma biopsies are shown. Myosin
More informationSupplementary data Supplementary Figure 1 Supplementary Figure 2
Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna
More informationTRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
More informationInvolvement of FKBP6 in hepatitis C virus replication
Supplementary Information Involvement of FKBP6 in hepatitis C virus replication Hirotake Kasai 1,*, Kunihiro Kawakami 2,*, Hiromasa Yokoe 3, Kentaro Yoshimura 4, Masanori Matsuda 5, Jun Yasumoto 1, Shinya
More informationa! b! c! Supplementary Fig. 1! Diameter (μm) S1P (LogM) U (LogM) enos! β-actin! Nogo-B! MLEC! nnos! β-actin!
a! b! c! Diamet (μm) 2 2 1 WT Nogo-A/B-deficient -9-8 -7 - -5-4 PE (LogM) Diamet (μm) 2 2 1-12-11-1 -9-8 -7 - -5 U-419 (LogM) Diamet (μm) 2 2 1-8 -7 - -5 S1P (LogM) d! WT! Nogo-A/B-deficient! MLE! enos!
More informationSupplementary Figure 1. Validation of astrocytes. Primary astrocytes were
Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were separated from the glial cultures using a mild trypsinization protocol. Anti-glial fibrillary acidic protein (GFAP) immunofluorescent
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationDepartment of Pharmaceutical Sciences, School of Pharmacy, Northeastern University, Boston, MA 02115, USA 2
Pancreatic Cancer Cell Exosome-Mediated Macrophage Reprogramming and the Role of MicroRNAs 155 and 125b2 Transfection using Nanoparticle Delivery Systems Mei-Ju Su 1, Hibah Aldawsari 2, and Mansoor Amiji
More informationSerum Amyloid A3 Gene Expression in Adipocytes is an Indicator. of the Interaction with Macrophages
Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator of the Interaction with Macrophages Yohei Sanada, Takafumi Yamamoto, Rika Satake, Akiko Yamashita, Sumire Kanai, Norihisa Kato, Fons AJ van
More informationSupplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION
Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION X. Shawn Liu 1, 3, Bing Song 2, 3, Bennett D. Elzey 3, 4, Timothy L. Ratliff 3, 4, Stephen F. Konieczny
More informationSUPPLEMENTAL MATERIALS AND METHODS. Puromycin-synchronized metabolic labelling - Transfected HepG2 cells were depleted of
SUPPLEMENTAL MATERIALS AND METHODS Puromycin-synchronized metabolic labelling - Transfected HepG2 cells were depleted of cysteine and methionine and then treated with 10 μm puromycin in depletion medium
More informationSupplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were
Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl
More informationFang et al. NMuMG. PyVmT unstained Anti-CCR2-PE MDA-MB MCF MCF10A
A NMuMG PyVmT 16.5+.5 47.+7.2 Fang et al. unstained Anti-CCR2-PE 4T1 Control 37.6+6.3 56.1+.65 MCF1A 16.1+3. MCF-7 3.1+5.4 MDA-M-231 42.1+5.5 unstained Secondary antibody only Anti-CCR2 SUPPLEMENTAL FIGURE
More informationThe PDE4 inhibitors roflumilast and rolipram augment PGE 2 inhibition of TGF-β 1 stimulated fibroblasts
Articles in PresS. Am J Physiol Lung Cell Mol Physiol (March 20, 2009). doi:10.1152/ajplung.00508.2007 1 The PDE4 inhibitors roflumilast and rolipram augment PGE 2 inhibition of TGF-β 1 stimulated fibroblasts
More informationLarge Scale Infection for Pooled Screens of shrna libraries
Last modified 01/11/09 Large Scale Infection for Pooled Screens of shrna libraries Biao Luo, Glenn Cowley, Michael Okamoto, Tanaz Sharifnia This protocol can be further optimized if cells being used are
More informationIntegrin CD11b negatively regulates TLR-triggered inflammatory responses by. activating Syk and promoting MyD88 and TRIF degradation via cbl-b
Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting MyD88 and TRIF degradation via cbl-b Chaofeng Han, Jing Jin, Sheng Xu, Haibo Liu, Nan Li, and Xuetao
More informationCaspase-3 Assay Cat. No. 8228, 100 tests. Introduction
Introduction Caspase-3 Assay Cat. No. 8228, 100 tests Caspase-3 is a member of caspases that plays a key role in mediating apoptosis, or programmed cell death. Upon activation, it cleaves a variety of
More informationGallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity
Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae
More informationSUPPLEMENTAL MATERIAL. Supplementary Methods
SUPPLEMENTAL MATERIAL Supplementary Methods Culture of cardiomyocytes, fibroblasts and cardiac microvascular endothelial cells The isolation and culturing of neonatal rat ventricular cardiomyocytes was
More information2.5. AMPK activity
Supplement Fig. A 3 B phos-ampk 2.5 * Control AICAR AMPK AMPK activity (Absorbance at 45 nm) 2.5.5 Control AICAR Supplement Fig. Effects of AICAR on AMPK activation in macrophages. J774. macrophages were
More informationSupplementary Figure 1. MAT IIα is Acetylated at Lysine 81.
IP: Flag a Mascot PTM Modified Mass Error Position Gene Names Score Score Sequence m/z [ppm] 81 MAT2A;AMS2;MATA2 35.6 137.28 _AAVDYQK(ac)VVR_ 595.83-2.28 b Pre-immu After-immu Flag- WT K81R WT K81R / Flag
More informationL6 GLUT4myc Cell Growth Protocol
L6 GLUT4myc Cell Growth Protocol Background: Parental L6 cells selected for high fusion (2, 3) were stably transfected with a rat GLUT4 cdna carrying a myc epitope (recognized by the commercially available
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Díaz et al., http://www.jcb.org/cgi/content/full/jcb.201209151/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Hypoxia induces invadopodia formation in different epithelial
More informationMast Cell Tryptase Modifies The Contraction Of Human Joint Capsule Cells In Vitro
Mast Cell Tryptase Modifies The Contraction Of Human Joint Capsule Cells In Vitro Kevin A. Hildebrand, MD 1, Lindsey M. Logan 1, Mei Zhang 1, David A. Hart, PhD 1, Paul T. Salo, MD 1, A. Dean Befus, PhD
More informationTotal Phosphatidic Acid Assay Kit
Product Manual Total Phosphatidic Acid Assay Kit Catalog Number MET- 5019 100 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Phosphatidic Acid (PA) is a critical precursor
More informationSupplementary Materials for. c-abl Activation Plays a Role in α-synucleinopathy Induced Neurodegeneration
Supplementary Materials for c-abl Activation Plays a Role in α-synucleinopathy Induced Neurodegeneration Saurav Brahmachari, Preston Ge, Su Hyun Lee, Donghoon Kim, Senthilkumar S. Karuppagounder, Manoj
More informationBiodiversity Study & Biomass Analysis
PR072 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Biodiversity Study & Biomass Analysis Teacher s Guidebook (Cat. # BE-403) think proteins!
More informationCombination of glycopyrronium and indacaterol inhibits carbachol-induced ERK5 signal in fibrotic processes
Namba et al. Respiratory Research (2017) 18:46 DOI 10.1186/s12931-017-0529-6 RESEARCH Open Access Combination of glycopyrronium and indacaterol inhibits carbachol-induced ERK5 signal in fibrotic processes
More informationWilliam Weidong Du 1,3, Ling Fang 1,2, Weining Yang 1,3, Wang Sheng 1,2, Yaou Zhang 1,2, Arun Seth 1,2, Burton B Yang 1,2 and Albert J Yee 1,3,4*
Du et al. BMC Cancer 212, 12:341 http://www.biomedcentral.com/1471-247/12/341 RESEARCH ARTICLE Open Access The role of versican domain in regulating breast cancer cell motility including effects on osteoblast
More informationTransfection of Sf9 cells with recombinant Bacmid DNA
Transposition Bacmid DNA Mini Culturing baculo cells Transfection of Sf9 cells with recombinant Bacmid DNA Amplification of the virus Titration of baculo stocks Testing the expression Transposition 1.
More informationPRODUCT: RNAzol BD for Blood May 2014 Catalog No: RB 192 Storage: Store at room temperature
PRODUCT: RNAzol BD for Blood May 2014 Catalog No: RB 192 Storage: Store at room temperature PRODUCT DESCRIPTION. RNAzol BD is a reagent for isolation of total RNA from whole blood, plasma or serum of human
More informationab Lipid Peroxidation (MDA) Assay kit (Colorimetric/ Fluorometric)
Version 10b Last updated 19 December 2018 ab118970 Lipid Peroxidation (MDA) Assay kit (Colorimetric/ Fluorometric) For the measurement of Lipid Peroxidation in plasma, cell culture and tissue extracts.
More informationA263 A352 A204. Pan CK. pstat STAT3 pstat3 STAT3 pstat3. Columns Columns 1-6 Positive control. Omentum. Rectosigmoid A195.
pstat3 75 Pan CK A A263 A352 A24 B Columns 1-6 Positive control A195 A22 A24 A183 Rectal Nodule STAT3 pstat3 STAT3 pstat3 Columns 7-12 Omentum Rectosigmoid Left Ovary Right Ovary Omentum Uterus Uterus
More informationA protocol for enhancement of the AAV-mediated expression of transgenes
A protocol for enhancement of the AAV-mediated expression of transgenes Hiroaki Mizukami, Takeharu Kanazawa, Takashi Okada, and Keiya Ozawa Division of Genetic Therapeutics, Center for Molecular Medicine,
More informationSupplementary Figure S1 Supplementary Figure S2
Supplementary Figure S A) The blots shown in Figure B were qualified by using Gel-Pro analyzer software (Rockville, MD, USA). The ratio of LC3II/LC3I to actin was then calculated. The data are represented
More informationSupplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated
Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate
More informationHiPer Western Blotting Teaching Kit
HiPer Western Blotting Teaching Kit Product Code: HTI009 Number of experiments that can be performed: 5/20 Duration of Experiment: ~ 2 days Day 1: 6-8 hours (SDS- PAGE and Electroblotting) Day 2: 3 hours
More information3-O-Ethyl Ascorbic Acid: A Stable, Vitamin C-Derived Agent for Skin Whitening
Formulating http://www.cosmeticsandtoiletries.com/formulating/function/active/ premium-3-o-ethyl-ascorbic-acid-a-stable-vitamin-c-derived- Agent-for-Skin-Whitening-225540872.html?c=n 3-O-Ethyl Ascorbic
More informationA Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells
Supporting Information for A Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells Mingguang Ren, Beibei Deng, Kai Zhou, Xiuqi
More informationSUPPLEMENT. Materials and methods
SUPPLEMENT Materials and methods Cell culture and reagents Cell media and reagents were from Invitrogen unless otherwise indicated. Antibiotics and Tet-certified serum were from Clontech. In experiments
More informationRayBio KinaseSTAR TM Akt Activity Assay Kit
Activity Assay Kit User Manual Version 1.0 March 13, 2015 RayBio KinaseSTAR TM Akt Activity Kit Protocol (Cat#: 68AT-Akt-S40) RayBiotech, Inc. We Provide You With Excellent Support And Service Tel:(Toll
More informationp = formed with HCI-001 p = Relative # of blood vessels that formed with HCI-002 Control Bevacizumab + 17AAG Bevacizumab 17AAG
A.. Relative # of ECs associated with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 ol b p < 0.001 Relative # of blood vessels that formed with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 l b p = 0.002 Control IHC:
More informationFigure 1. Possible role of oncogene activation, receptor, G-protein mutation, or tumor
Figures Part of introduction Figure 1. Possible role of oncogene activation, receptor, G-protein mutation, or tumor supressor gene deletion in the induction of thyroid carcinoma. ( by James A Fagin, M.D.)
More informationInterleukin-6 promotes pancreatic cancer cell migration by rapidly activating the small GTPase CDC42
Interleukin-6 promotes pancreatic cancer cell migration by rapidly activating the small GTPase CDC42 Gina L. Razidlo, Kevin M. Burton, and Mark A. McNiven SUPPORTING INFORMATION Figure S1. IL-6 promotes
More informationCytoSelect Tumor- Endothelium Adhesion Assay
Product Manual CytoSelect Tumor- Endothelium Adhesion Assay Catalog Number CBA- 215 100 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Cancer metastasis comprises several
More informationSupporting Information
Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 212. Supporting Information for Adv. Funct. Mater., DOI:.2/adfm.2122233 MnO Nanocrystals: A Platform for Integration of MRI and Genuine
More informationSupplemental Data. TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim.
Supplemental Data TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim. Molly A. Taylor 1, Khalid Sossey-Alaoui 2, Cheryl L. Thompson 3, David Danielpour 4, and William
More information1.1. Gelatinizing Plates Prepare plates by covering surface with 0.1% Gelatin solution:
1. Preparation of Feeder Layers And SNL Stocks 1.1. Gelatinizing Plates Prepare plates by covering surface with 0.1% Gelatin solution: Plate Size (cm) 3 2 6 4 10 9 15 18 Amount of Gelatin (ml) Swirl the
More informationHEK293FT cells were transiently transfected with reporters, N3-ICD construct and
Supplementary Information Luciferase reporter assay HEK293FT cells were transiently transfected with reporters, N3-ICD construct and increased amounts of wild type or kinase inactive EGFR. Transfections
More informationSupplementary Material
Supplementary Material accompanying the manuscript Interleukin 37 is a fundamental inhibitor of innate immunity Marcel F Nold, Claudia A Nold-Petry, Jarod A Zepp, Brent E Palmer, Philip Bufler & Charles
More informationSupporting Online Material Material and Methods References Supplemental Figures S1, S2, and S3
Supporting Online Material Material and Methods References Supplemental Figures S1, S2, and S3 Sarbassov et al. 1 Material and Methods Materials Reagents were obtained from the following sources: protein
More informationLow Cell Binding Property of LIPIDURE -COAT
Technical Note_1 ver.1 Low Cell Binding Property of LIPIDURE -COAT 1. LIPIDURE -COAT MULTI DISH A-6MD (Cat. No. 51011617) 2. Cell; NIH 3T3 (Fibroblast, mouse) 1. 10 %CS-DMEM; DMEM (Dulbecco's Modified
More informationand follicular helper T cells is Egr2-dependent. (a) Diagrammatic representation of the
Supplementary Figure 1. LAG3 + Treg-mediated regulation of germinal center B cells and follicular helper T cells is Egr2-dependent. (a) Diagrammatic representation of the experimental protocol for the
More informationFigures S1-S5, Figure Legends, Table S1 List of primers used in the study
Insulin receptor alternative splicing is regulated by insulin signaling and modulates beta cell survival Pushkar Malakar,4, Lital Chartarifsky,4, Ayat Hija, Gil Leibowitz 3, Benjamin Glaser 3, Yuval Dor,
More informationHCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation
SUPPLEMENTARY INFORMATION Materials and Methods Human cell lines and culture conditions HCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation in exon 20 of BRCA1
More informationA. List of selected proteins with high SILAC (H/L) ratios identified in mass
Supplementary material Figure S1. Interaction between UBL5 and FANCI A. List of selected proteins with high SILAC (H/L) ratios identified in mass spectrometry (MS)-based analysis of UBL5-interacting proteins,
More informationOverview of methodology, tools and reagents for evaluating cell proliferation and invasion using multicellular tumor spheroids.
The Next Step in the Evolution of 3D Culture: Utilizing Extracellular Matrix to Enhance Multicellular Tumor Spheroid Models for Proliferation and Invasion Overview of methodology, tools and reagents for
More informationRetinoic Acid Attenuates Cytokine-Driven Fibroblast Degradation of Extracellular Matrix in Three-Dimensional Culture
Retinoic Acid Attenuates Cytokine-Driven Fibroblast Degradation of Extracellular Matrix in Three-Dimensional Culture Yun Kui Zhu, Xiangde Liu, Ronald F. Ertl, Tadashi Kohyama, Fu Qiang Wen, Hangjun Wang,
More informationProtocol for Thawing Cryopreserved Hepatocytes
cell and tissue-based products Protocol for Thawing Cryopreserved Hepatocytes Product Instruction The following procedure may be carried out in a biosafety containment hood to reduce the risk of contamination
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Chairoungdua et al., http://www.jcb.org/cgi/content/full/jcb.201002049/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Expression of CD9 and CD82 inhibits Wnt/ -catenin
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationSupplementary Material for
Supplementary Material for Parathyroid Hormone Signaling through Low-density-lipoprotein-related Protein 6 Mei Wan, Chaozhe Yang, Jun Li, Xiangwei Wu, Hongling Yuan, Hairong Ma, Xi He, Shuyi Nie, Chenbei
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2566 Figure S1 CDKL5 protein expression pattern and localization in mouse brain. (a) Multiple-tissue western blot from a postnatal day (P) 21 mouse probed with an antibody against CDKL5.
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationAperto Cell Lysis and Protein Solubilization Users Manual
Aperto Cell Lysis and Protein Solubilization Users Manual Revision 2 THIS MANUAL APPLIES TO THE FOLLOWING PRODUCTS: 3A8600 Aperto, 5X Cell Lysis Buffer. 20mL 3A8610 Aperto, 5X Cell Lysis Buffer. 100mL
More informationSupplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS
Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS nucleotide sequences (a, b) or amino acid sequences (c) from
More informationAC Griffonia Lysate Advanced
AC Griffonia Lysate Advanced Innovative Neuro-Cosmetic + Anti-Aging + Instant Tightening Tomorrow s Vision Today! AC GRIFFONIA LYSATE ADVANCED Technical Information: Product Code: 16634 INCI Name: Griffonia
More informationSupplementary Data Table of Contents:
Supplementary Data Table of Contents: - Supplementary Methods - Supplementary Figures S1(A-B) - Supplementary Figures S2 (A-B) - Supplementary Figures S3 - Supplementary Figures S4(A-B) - Supplementary
More informationp47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO
Supplementary Information p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO Yuri Shibata, Masaaki Oyama, Hiroko Kozuka-Hata, Xiao Han, Yuetsu Tanaka,
More informationRAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh-
1 a b Supplementary Figure 1. Effects of GSK3b knockdown on poly I:C-induced cytokine production. RAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh- GSK3b) were stimulated
More informationFigure 1. Growth characteristics of GLI2 expressing cells in monolayer culture (A) Expression of GLI2 and downstream targets GLI1 and PTCH in control
Figure 1. Growth characteristics of GLI2 expressing cells in monolayer culture (A) Expression of GLI2 and downstream targets GLI1 and PTCH in control HaCaT Tet, uninduced HaCaT GLI2 and induced HaCaT GLI2
More informationsupplementary information
Figure S1 Nucleotide binding status of RagA mutants. Wild type and mutant forms of MycRagA was transfected into HEK293 cells and the transfected cells were labeled with 32 Pphosphate. MycRagA was immunoprecipitated
More informationSupplementary Material
Electronic Supplementary Material (ESI) for Integrative Biology. This journal is The Royal Society of Chemistry 2018 Supplementary Material 1 Supplemental Figures Supplemental Figure S1. Mechanical properties
More informationA Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS
A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism Arlee Fafalios, Jihong Ma, Xinping Tan, John Stoops, Jianhua Luo, Marie C. DeFrances and Reza Zarnegar
More informationGladstone Institutes, University of California (UCSF), San Francisco, USA
Fluorescence-linked Antigen Quantification (FLAQ) Assay for Fast Quantification of HIV-1 p24 Gag Marianne Gesner, Mekhala Maiti, Robert Grant and Marielle Cavrois * Gladstone Institutes, University of
More informationSupplementary Figures for
mirns regulate s Supplementary igures for MicroRNs Reprogram Normal ibroblasts into Cancer ssociated ibroblasts in Ovarian Cancer nirban K. Mitra, Marion Zillhardt, Youjia Hua, Payal iwari, ndrea E. Murmann,
More informationResearch article. Department of Pharmacology and Toxicology, Medical College of Georgia, Georgia Health Sciences University, Augusta, Georgia, USA.
Research article Calpain mediates pulmonary vascular remodeling in rodent models of pulmonary hypertension, and its inhibition attenuates pathologic features of disease Wanli Ma, 1 Weihong Han, 1 Peter
More informationEPIGENTEK. EpiQuik Total Histone Extraction Kit. Base Catalog # OP-0006 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE
EpiQuik Total Histone Extraction Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE Uses: The EpiQuik Total Histone Extraction Kit is suitable for a quick preparation of total histone extracts
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationWestern Immunoblotting Preparation of Samples:
Western Immunoblotting Preparation of Samples: Total Protein Extraction from Culture Cells: Take off the medium Wash culture with 1 x PBS 1 ml hot Cell-lysis Solution into T75 flask Scrap out the cells
More informationTotal Histone H3 Acetylation Detection Fast Kit (Colorimetric)
Total Histone H3 Acetylation Detection Fast Kit (Colorimetric) Catalog Number KA1538 48 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use...
More informationSUPPLEMENTAL EXPERIMENTAL PROCEDURES
SUPPLEMENTAL EXPERIMENTAL PROCEDURES Crystal violet assay Cells were seeded in 24-well plates and cultured in media supplemented with % FBS for 7 days. Media were then removed, plates were briefly washed
More informationMouse primary keratinocytes preparation
Mouse primary keratinocytes preparation 1. Fill a 150 X 25 mm petri dish with ice. Put newborn mice (2 3 days old) in the petri dish and insert it in an ice bucket. Leave the mice in the ice bucket for
More informationConnective Tissue Response in IBD
Connective Tissue Response in IBD Dr I C Lawrance MB BS, PhD FRACP School of Medicine and Pharmacology, University of Western Australia, Fremantle Hospital Intestinal response to Chronic Inflammation Control
More information