Figure 1. Growth characteristics of GLI2 expressing cells in monolayer culture (A) Expression of GLI2 and downstream targets GLI1 and PTCH in control
|
|
- Lindsay Flynn
- 5 years ago
- Views:
Transcription
1 Figure 1. Growth characteristics of GLI2 expressing cells in monolayer culture (A) Expression of GLI2 and downstream targets GLI1 and PTCH in control HaCaT Tet, uninduced HaCaT GLI2 and induced HaCaT GLI2 cells. For each cell type, cells were harvested from a T75 flask and RNA was isolated using TRIZOL reagent. Expression levels were measured relative to GUSB by quantitative RT PCR using the ABI Assays-on-Demand as described previously (Snijders et al., 2005). (B) Growth characteristics in monolayer cultures of inducible HaCaT GLI2 cells with and without addition of doxycycline to the medium. Five hundred HaCaT GLI2 cells were seeded in 100 μl culture media in 12 wells of tissue culture treated 96-well plates. After allowing cells to attach and grow for 24 hours, an additional 100 μl of culture media was added and the media in six wells of each plate was supplemented with 1 μg/ml doxycycline to induce GLI2 expression. Thereafter, one plate was harvested each day over a four day period, stored at -80 C, and then proliferation was measured using the CyQUANT Cell Proliferation Assay kit. (C) Growth characteristics in monolayer cultures of HaCaT cells infected with p-babe-6xhis- GLI2 N.
2 Figure 2. GLI2 induces genome instability (A) Methotrexate resistant colonies arising in HT1080 cells and derivatives expressing egfp, CCND1 or 6xHis-GLI2ΔN. To prepare HT1080 cells overexpressing CCND1 or GLI2ΔN, the genes were cloned into FG12-RFP or FG12-eGFP lentiviral vectors, respectively. The parental HT1080 cells were subsequently infected with these lentiviruses or the FG12-eGFP empty vector lentivirus to obtain control lentivirus infected HT1080 cells (HT1080 egfp). Approximately 5 days post infection, 1x10 3 cells were seeded in each well of two 6-well plates and the cells expanded to ~80% confluency before 4x10 5 cells from each well were cultured in medium containing 25 nm methotrexate (2-3x LD50). Plates were incubated for 27 days after which time one resistant colony was picked from each 100 mm plate and expanded in medium containing 25 nm methotrexate. The colonies remaining on the plates were fixed in methanol/acetic acid (3:1) and stained with crystal violet. Colonies visible by eye (> ~50 cells) were counted as described previously (Snijders et al., 2003; Snijders et al., 2008). Shown are boxplots representing the number of resistant colonies. The thick horizontal line represents the median number of colonies, while the bottom and top of each box represent the 25 th and 75 th percentile, respectively. The width of each box is proportional to the square root of the number of samples. Outlier values are indicated with circles. (B) The p-values for each pairwise comparison are shown and were calculated using a two-sided Wilcoxon rank sum test. A p-value cut-off of 0.05 was used to declare significance. The GLI2 and CCND1 expressing HT1080 cells gave rise to equal numbers of drug resistant colonies and these numbers were significantly greater than the number recovered from either egfp expressing or parental HT1080 cells. Note, a significantly greater number of colonies was also formed in the egfp expressing HT1080 cells compared to parental HT1080 cells, from which we did recover a few drug resistant colonies unlike previous studies (Paulson et al., 1998). (C) Heatmap representation of copy number changes detected by array CGH in methotrexate resistant colonies. For array CGH, cells were harvested from a T75 flask and DNA extracted by overnight incubation at 55 C in a 3 ml solution containing 0.01 M Tris, ph 7.5, M EDTA, ph 8, 0.5% SDS and 0.1 μg/μl proteinase K. The DNA was precipitated with ethanol, recovered it by spooling and then dissolved it in ~300 μl H 2 O. Labeling of DNA for array CGH, hybridization and image analysis were carried out as described previously (Snijders et al., 2003). Each column represents one resistant colony. Individual BAC clones are shown as rows and ordered according their genome position (May 2004 freeze, UCSC Genome Browser). Copy number aberrations were assigned as described previously (Fridlyand et al., 2006). Losses are indicated in red, gains in green and amplifications as yellow dots. Copy number changes present in the parental HT1080 cell line include +3q, +5p and deletion of a single BAC at 9p21 spanning CDKN2A. Array CGH data were deposited in the NCBI Gene Expression Omnibus database, accession number GSE No significant differences were observed between the various HT1080 genotypes in the spectra of copy number changes or the number and types of copy number alterations arising in the drug resistant cells
3 Figure 3. Contraction of HaCaT Tet and HaCaT GLI2 organotypic cultures In organotypic cultures, fibroblasts are initially cultured for a week in collagen gels resulting in contraction of the collagen gel to form a cup. Keratinocytes are then added on top of the collagen/fibroblast layer and the co-cultures further propagated for four days, before exposure to air. A stratified and differentiated epithelium is formed within three weeks. (A) Photomicrographs of reconstructs prior to fixation. Reconstructs were placed on a light box and photographed from the top. Contraction was determined by measuring the surface area of the mesa-shaped plateau formed by the fibroblast/collagen matrix (dashed black line). The surface area occupied by HaCaT cells identified as the embossed and opaque appearing area was also measured, which in control HaCaT Tet and HaCaT GLI2 cells (-doxycycline) was identical to the fibroblast area. In GLI2 expressing HaCaT GLI2 cells (+ doxycycline), however, the HaCaT area was smaller as indicated by the yellow dashed line. (B) Measured surface areas of fibroblast and HaCaT regions. Measurements were made from four replicate cultures for each cell type. These cultures used foreskin fibroblasts from at least two different donors. To control for variations in contraction capacities of different fibroblast cultures, fibroblast and HaCaT surface area calculations were each normalized to the fibroblast or HaCaT surface areas of reconstructs of HaCaT Tet cells, respectively.
4 Figure 4. Characteristics of organotypic cultures of primary foreskin derived keratinocytes grown on a collagen matrix containing foreskin derived primary fibroblasts Antibody staining patterns in sections from organotypic cultures of primary foreskin keratinocytes and fibroblasts visualized by immunohistochemistry (IHC) or immunfluorescence (IF). Sections were processed as for HaCaT cell cultures and the analyses were carried out with at least two pairs of fibroblasts and keratinocytes from two different donors.
5 Figure 5. Overexpression of GLI2 alters expression of genes related to the identification, growth and differentiation of stem cells. (A) Fold induction (values >1) and fold repression (values <1) after induction of GLI2 in organotypic cultures of GLI2 expressing HaCaT GLI2 and control HaCaT Tet keratinocytes. After epidermalization of the doxycycline induced HaCaT GLI2 (n=2) and control HaCaT Tet (n=2) organotypic cultures, the epidermal layer was carefully peeled away from the underlying fibroblast containing dermal equivalents using needle nose forceps. The epidermal layer was placed in 600 µl of TRIZOL reagent and stored at -80 C until RNA was isolated. Expression levels were measured relative to GAPDH by quantitative RT PCR using the Human Stem Cell RT 2 Profiler PCR Array (SuperArray Bioscience). Genes were considered not expressed in the event that one sample within either HaCaT GLI2 or HaCaT Tet duplicates failed to detect expression or when the Ct for either or both samples within each duplicate exceeded 30 cycles. Relative expression levels of duplicate cultures were averaged and fold induction/repression was calculated by dividing the average relative expression level in HaCaT GLI2 cells by the average relative expression level in control HaCaT Tet cells. (B) Expression of genes (n=7) relative to GAPDH that were induced in GLI2 expressing HaCaT GLI2 organotypic cultures, but not detected in organotypic cultures of control HaCaT Tet cells.
6 Figure 6. Induction of SOX2 expression in primary keratinocytes and HaCaT GLI2 cells. (A) Expression of GLI2, downstream target GLI1 and putative downstream target SOX2 in primary foreskin derived keratinocytes (FK5) infected with a GLI2 retrovirus or empty vector control. RNA was isolated using TRIZOL reagent. Expression levels were measured relative to GUSB by quantitative RT PCR using the ABI Assays-on-Demand as described previously (Snijders et al., 2005). (B) Response of GLI2 target genes GLI1 and PTCH1 and putative downstream target SOX2 after induction of GLI2 in HaCaT GLI2 cells. HaCaT GLI2 cells were seeded in six 6-well plates (200,000 cells per well; 4 wells per plate). Cells were allowed to recover overnight after which time RNA was harvested from one plate (T=0 hr). GLI2 expression was induced in the remaining plates by replacing the media in three wells of each plate with media containing doxycycline (1 µg/ml). Plates were harvested at 3, 6, 9 and 12 hours post addition of doxycycline. RNA was isolated using TRIZOL and expression levels were measured relative to GUSB by quantitative RT PCR using the ABI Assays-on-Demand. Relative expression levels for each gene were normalized to the average expression level of uninduced samples. The standard deviation represents the variation in gene expression between independent wells at each time point.
7 Figure 7. Smooth muscle actin staining in oral SCC with GLI2 amplification Antibody staining patterns of smooth muscle actin (SMA) in sections of two oral SCC showing highlevel amplification of the GLI2 locus. Strong staining was observed in areas surrounding epithelial tumor nests similar to the SMA staining pattern in GLI2 expressing HaCaT GLI2 reconstructs
8 Figure 8. Introduction of a layer of acellular collagen separating the dermal and epithelial compartments in organotypic cultures does not affect differentiation of uninduced HaCaT GLI2 cells, but prevents transdifferentiation of fibroblasts in GLI2 expressing HaCaT GLI2 cells. To create organotypic cultures with an acellular layer of collagen separating the epithelial and collagen/fibroblast layers, collagen solution (75 μl) was pipetted into the middle of each reconstruct after the fibroblasts had contracted the collagen layer to form the mesa shaped plateau. A cloning ring was immediately placed into the collagen and the plate was incubated at 37 C for 15 minutes. An additional 100 μl of collagen solution was pipetted into each cloning ring and the plates incubated at 37 C for 30 minutes before pipetting 250,000 egfp labeled HaCaT GLI2 cells onto the collagen layer and further culturing the reconstructs in the usual manner. (A) Formalin fixed paraffin embedded sections of cultures of uninduced HaCaT GLI2 cells were stained with antibodies to cytokeratin 10/13, involucrin and integrin β4 and visualized using Alexa 594 labeled secondary antibodies (red) as described in Table S5. Nuclei were counterstained with DAPI (blue). The acellular collagen layer is indicated by the arrowheads. (B) Sections from reconstructs prepared with a layer of acellular collagen separating the dermal and epithelial compartments of egfp expressing HaCaT GLI2 cells with or without addition of doxycycline (right and left panels, respectively). The acellular collagen layer appears as a clear region under the epithelial cells in the H&E stained sections (top panels). Sections from reconstructs of control and GLI2 expressing HaCaT GLI2 cells (left and right bottom panels, respectively) stained for egfp (green) and SMA (red).
9 Figure 9. Invading epithelial cells down regulate expression of the GLI2 target gene, BCL2. Sections of organotypic cultures of GLI2 expressing HaCaT GLI2 cells stained using HRP and DAB detection and antibodies to BCL2 (middle panel). The locations of keratinocytes in the sections are indicated by staining adjacent sections with antibodies to CAM5.2 and AE1/AE3.
10 REFERENCES Fridlyand, J., Snijders, A. M., Ylstra, B., Li, H., Olshen, A., Segraves, R., Dairkee, S., Tokuyasu, T., Ljung, B. M., Jain, A. N., et al. (2006). Breast tumor copy number aberration phenotypes and genomic instability. BMC Cancer 6, 96. Paulson, T. G., Almasan, A., Brody, L. L., and Wahl, G. M. (1998). Gene amplification in a p53- deficient cell line requires cell cycle progression under conditions that generate DNA breakage. Mol Cell Biol 18, Snijders, A. M., Fridlyand, J., Mans, D. A., Segraves, R., Jain, A. N., Pinkel, D., and Albertson, D. G. (2003). Shaping of tumor and drug-resistant genomes by instability and selection. Oncogene 22, Snijders, A. M., Hermsen, M. A., Baughman, J., Buffart, T. E., Huey, B., Gajduskova, P., Roydasgupta, R., Tokuyasu, T., Meijer, G. A., Fridlyand, J., and Albertson, D. G. (2008). Acquired genomic aberrations associated with methotrexate resistance vary with background genomic instability. Genes Chromosomes Cancer 47, Snijders, A. M., Schmidt, B. L., Fridlyand, J., Dekker, N., Pinkel, D., Jordan, R. C., and Albertson, D. G. (2005). Rare amplicons implicate frequent deregulation of cell fate specification pathways in oral squamous cell carcinoma. Oncogene 24,
(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationLentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression.
Supplementary Figure 1 Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. a, Design for lentiviral combinatorial mirna expression and sensor constructs.
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationProtocol for A-549 VIM RFP (ATCC CCL-185EMT) TGFβ1 EMT Induction and Drug Screening
Protocol for A-549 VIM RFP (ATCC CCL-185EMT) TGFβ1 EMT Induction and Drug Screening Introduction: Vimentin (VIM) intermediate filament (IF) proteins are associated with EMT in lung cancer and its metastatic
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationNature Genetics: doi: /ng Supplementary Figure 1. SEER data for male and female cancer incidence from
Supplementary Figure 1 SEER data for male and female cancer incidence from 1975 2013. (a,b) Incidence rates of oral cavity and pharynx cancer (a) and leukemia (b) are plotted, grouped by males (blue),
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationTEB. Id4 p63 DAPI Merge. Id4 CK8 DAPI Merge
a Duct TEB b Id4 p63 DAPI Merge Id4 CK8 DAPI Merge c d e Supplementary Figure 1. Identification of Id4-positive MECs and characterization of the Comma-D model. (a) IHC analysis of ID4 expression in the
More informationOverview of methodology, tools and reagents for evaluating cell proliferation and invasion using multicellular tumor spheroids.
The Next Step in the Evolution of 3D Culture: Utilizing Extracellular Matrix to Enhance Multicellular Tumor Spheroid Models for Proliferation and Invasion Overview of methodology, tools and reagents for
More informationHuman Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Introduction Kit Components Cat. # # of vials Reagent Quantity Storage
Human Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Catalog #5901 Introduction Human pluripotent stem cells (hpsc), including embryonic stem cells (ESC) and induced pluripotent stem
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationSupplementary Figure S1. Gene expression analysis of epidermal marker genes and TP63.
Supplementary Figure Legends Supplementary Figure S1. Gene expression analysis of epidermal marker genes and TP63. A. Screenshot of the UCSC genome browser from normalized RNAPII and RNA-seq ChIP-seq data
More informationRNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using
Supplementary Information Materials and Methods RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Trizol reagent (Invitrogen,Carlsbad, CA) according to the manufacturer's instructions.
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationSupplemental Figure S1. RANK expression on human lung cancer cells.
Supplemental Figure S1. RANK expression on human lung cancer cells. (A) Incidence and H-Scores of RANK expression determined from IHC in the indicated primary lung cancer subgroups. The overall expression
More informationNature Immunology: doi: /ni Supplementary Figure 1. DNA-methylation machinery is essential for silencing of Cd4 in cytotoxic T cells.
Supplementary Figure 1 DNA-methylation machinery is essential for silencing of Cd4 in cytotoxic T cells. (a) Scheme for the retroviral shrna screen. (b) Histogram showing CD4 expression (MFI) in WT cytotoxic
More informationPrimary Cilia Can Both Mediate and Suppress Hedgehog Pathway- Dependent Tumorigenesis (Supplementary Figures and Materials)
Primary Cilia Can Both Mediate and Suppress Hedgehog Pathway- Dependent Tumorigenesis (Supplementary Figures and Materials) Sunny Y. Wong, Allen D. Seol, Po-Lin So, Alexandre N. Ermilov, Christopher K.
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Fig. 1: Quality assessment of formalin-fixed paraffin-embedded (FFPE)-derived DNA and nuclei. (a) Multiplex PCR analysis of unrepaired and repaired bulk FFPE gdna from
More informationFigure S1. ERBB3 mrna levels are elevated in Luminal A breast cancers harboring ERBB3
Supplemental Figure Legends. Figure S1. ERBB3 mrna levels are elevated in Luminal A breast cancers harboring ERBB3 ErbB3 gene copy number gain. Supplemental Figure S1. ERBB3 mrna levels are elevated in
More informationCorning BioCoat Matrigel Invasion Chamber
Corning BioCoat Matrigel Invasion Chamber Catalog No. 354480, 354481 Guidelines for Use Discovery Labware, Inc., Two Oak Park, Bedford, MA 01730, Tel: 1.978.442.2200 (U.S.) CLSTechServ@Corning.com www.corning.com/lifesciences
More informationExpressArt FFPE Clear RNAready kit
Features and Example Results General problems with FFPE samples Formalin-fixation of tissues results in severe RNA fragmentation, as well as in RNA RNA, RNA-DNA and RNA protein cross-linking, which impairs
More informations u p p l e m e n ta ry i n f o r m at i o n
Figure S1 Characterization of tet-off inducible cell lines expressing GFPprogerin and GFP-wt lamin A. a, Western blot analysis of GFP-progerin- or GFP-wt lamin A- expressing cells before induction (0d)
More informationProduct Use HPSC-CC are for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures.
HPSC-derived Cardiomyocyte Cells (HPSC-CC) Catalog #6240 Cell Specification Human primary cardiomyocytes and cardiac tissue are superior modeling systems for heart disease studies, drug discovery and toxicity
More informationFigure 1. Possible role of oncogene activation, receptor, G-protein mutation, or tumor
Figures Part of introduction Figure 1. Possible role of oncogene activation, receptor, G-protein mutation, or tumor supressor gene deletion in the induction of thyroid carcinoma. ( by James A Fagin, M.D.)
More informationSUPPLEMENTARY INFORMATION
Supplementary Figure 1. Ras V12 expression in the entire eye-antennal disc does not cause invasive tumours. a, Eye-antennal discs expressing Ras V12 in all cells (marked with GFP, green) overgrow moderately
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Figure S1. Clinical significance of ZNF322A overexpression in Caucasian lung cancer patients. (A) Representative immunohistochemistry images of ZNF322A protein expression in tissue
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationGastric Carcinoma with Lymphoid Stroma: Association with Epstein Virus Genome demonstrated by PCR
Gastric Carcinoma with Lymphoid Stroma: Association with Epstein Virus Genome demonstrated by PCR Pages with reference to book, From 305 To 307 Irshad N. Soomro,Samina Noorali,Syed Abdul Aziz,Suhail Muzaffar,Shahid
More informationSoft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v)
SUPPLEMENTARY MATERIAL AND METHODS Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v) top agar (LONZA, SeaKem LE Agarose cat.5004) and plated onto 0.5% (w/v) basal agar.
More informationSUPPLEMENTARY INFORMATION
b 350 300 250 200 150 100 50 0 E0 E10 E50 E0 E10 E50 E0 E10 E50 E0 E10 E50 Number of organoids per well 350 300 250 200 150 100 50 0 R0 R50 R100 R500 1st 2nd 3rd Noggin 100 ng/ml Noggin 10 ng/ml Noggin
More informationSupplementary material. Supplementary Figure legends
Supplementary material Supplementary Figure legends Supplementary Figure 1: Senescence-associated proliferation stop in response to oncogenic N-RAS expression Proliferation of NHEM cells without (ctrl.)
More informationSupplementary Figure 1. Spitzoid Melanoma with PPFIBP1-MET fusion. (a) Histopathology (4x) shows a domed papule with melanocytes extending into the
Supplementary Figure 1. Spitzoid Melanoma with PPFIBP1-MET fusion. (a) Histopathology (4x) shows a domed papule with melanocytes extending into the deep dermis. (b) The melanocytes demonstrate abundant
More informationsupplementary information
DOI: 10.1038/ncb2133 Figure S1 Actomyosin organisation in human squamous cell carcinoma. (a) Three examples of actomyosin organisation around the edges of squamous cell carcinoma biopsies are shown. Myosin
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Yatsenko AN, Georgiadis AP, Röpke A, et al. X-linked TEX11
More informationEXO-DNA Circulating and EV-associated DNA extraction kit
Datasheet EXO-DNA Circulating and EV-associated DNA extraction kit This product is for research use only. It is highly recommended to read this users guide in its entirety prior to using this product.
More informationHCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation
SUPPLEMENTARY INFORMATION Materials and Methods Human cell lines and culture conditions HCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation in exon 20 of BRCA1
More informationLoss of RhoA promotes skin tumor formation. Supplementary Figure 1. Loss of RhoA does not impair F-actin organization.
Supplementary Figure Legends Supplementary Figure 1. Loss of RhoA does not impair F-actin organization. a. Representative IF images of F-actin staining of big and small control (left) and RhoA ko tumors
More informationNext-Generation Immunohistochemistry: Multiplex tissue imaging with mass cytometry
Nat Met, April 2014 Nat Med, April 2014 Next-Generation Immunohistochemistry: Multiplex tissue imaging with mass cytometry Journal Club Timo Böge Overview Introduction Conventional Immunohistochemistry
More informationImpact of hyper-o-glcnacylation on apoptosis and NF-κB activity SUPPLEMENTARY METHODS
SUPPLEMENTARY METHODS 3D culture and cell proliferation- MiaPaCa-2 cell culture in 3D was performed as described previously (1). Briefly, 8-well glass chamber slides were evenly coated with 50 µl/well
More informationSupplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway
Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationSupplementary Information. Supplementary Figure 1
Supplementary Information Supplementary Figure 1 1 Supplementary Figure 1. Functional assay of the hcas9-2a-mcherry construct (a) Gene correction of a mutant EGFP reporter cell line mediated by hcas9 or
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1. The expression of ephrin-b2 H2BGFP persists in the post-hearingonset organ of Corti and is specifically restricted to supporting cells. Sox2 immunolabeling
More informationSupplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated,
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated, embedded in matrigel and exposed
More informationBin Liu, Lei Yang, Binfang Huang, Mei Cheng, Hui Wang, Yinyan Li, Dongsheng Huang, Jian Zheng,
The American Journal of Human Genetics, Volume 91 Supplemental Data A Functional Copy-Number Variation in MAPKAPK2 Predicts Risk and Survival of Lung Cancer Bin Liu, Lei Yang, Binfang Huang, Mei Cheng,
More informationSupplementary Material
Supplementary Material accompanying the manuscript Interleukin 37 is a fundamental inhibitor of innate immunity Marcel F Nold, Claudia A Nold-Petry, Jarod A Zepp, Brent E Palmer, Philip Bufler & Charles
More informationBoosted PRIM with Application to Searching for Oncogenic Pathway of Lung Cancer
Boosted PRIM with Application to Searching for Oncogenic Pathway of Lung Cancer Pei Wang Department of Statistics Stanford University Stanford, CA 94305 wp57@stanford.edu Young Kim, Jonathan Pollack Department
More informationSupplementary Data Dll4-containing exosomes induce capillary sprout retraction ina 3D microenvironment
Supplementary Data Dll4-containing exosomes induce capillary sprout retraction ina 3D microenvironment Soheila Sharghi-Namini 1, Evan Tan 1,2, Lee-Ling Sharon Ong 1, Ruowen Ge 2 * and H. Harry Asada 1,3
More informationHEK293FT cells were transiently transfected with reporters, N3-ICD construct and
Supplementary Information Luciferase reporter assay HEK293FT cells were transiently transfected with reporters, N3-ICD construct and increased amounts of wild type or kinase inactive EGFR. Transfections
More informationSupplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right
More informationINSTRUCTION MANUAL. RNA Clean & Concentrator -5 Catalog Nos. R1015 & R1016. Highlights. Contents
INSTRUCTION MANUAL Catalog Nos. R1015 & R1016 Highlights Quick (5 minute) method for cleaning and concentrating RNA. Ideal for purification of RNA from aqueous phase following an acid phenol extraction.
More informationSupplementary Figures for
mirns regulate s Supplementary igures for MicroRNs Reprogram Normal ibroblasts into Cancer ssociated ibroblasts in Ovarian Cancer nirban K. Mitra, Marion Zillhardt, Youjia Hua, Payal iwari, ndrea E. Murmann,
More informationProduct Contents. 1 Specifications 1 Product Description. 2 Buffer Preparation... 3 Protocol. 3 Ordering Information 4 Related Products..
INSTRUCTION MANUAL Quick-RNA MidiPrep Catalog No. R1056 Highlights 10 minute method for isolating RNA (up to 1 mg) from a wide range of cell types and tissue samples. Clean-Spin column technology allows
More informationSSM signature genes are highly expressed in residual scar tissues after preoperative radiotherapy of rectal cancer.
Supplementary Figure 1 SSM signature genes are highly expressed in residual scar tissues after preoperative radiotherapy of rectal cancer. Scatter plots comparing expression profiles of matched pretreatment
More informationSUPPLEMENTAL EXPERIMENTAL PROCEDURES
SUPPLEMENTAL EXPERIMENTAL PROCEDURES Crystal violet assay Cells were seeded in 24-well plates and cultured in media supplemented with % FBS for 7 days. Media were then removed, plates were briefly washed
More informationProduct Contents. 1 Specifications 1 Product Description. 2 Buffer Preparation... 3 Protocol. 3 Ordering Information 4
INSTRUCTION MANUAL Quick-RNA Midiprep Kit Catalog No. R1056 Highlights 10 minute method for isolating RNA (up to 1 mg) from a wide range of cell types and tissue samples. Clean-Spin column technology allows
More information7SK ChIRP-seq is specifically RNA dependent and conserved between mice and humans.
Supplementary Figure 1 7SK ChIRP-seq is specifically RNA dependent and conserved between mice and humans. Regions targeted by the Even and Odd ChIRP probes mapped to a secondary structure model 56 of the
More informationTo determine the effect of over-expression and/or ligand activation of. PPAR / on cell cycle, cell lines were cultured as described above until ~80%
Supplementary Materials and Methods Cell cycle analysis To determine the effect of over-expression and/or ligand activation of PPAR / on cell cycle, cell lines were cultured as described above until ~80%
More informationLipid (Oil Red O) staining Kit
Lipid (Oil Red O) staining Kit Catalog Number KA4541 1 Kit Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials
More informationJumpstart your research with ViraPower Lentiviral Expression Systems
ViraPower Lentiviral Expression Systems Jumpstart your research with ViraPower Lentiviral Expression Systems With ViraPower Lentiviral Systems you can: Efficiently transduce both dividing and non-dividing
More informationFigure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.
Figure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.129-Gt(ROSA)26Sor tm1(cre/ert2)tyj /J mice. To induce deletion of the Pten locus,
More informationab CytoPainter Golgi/ER Staining Kit
ab139485 CytoPainter Golgi/ER Staining Kit Instructions for Use Designed to detect Golgi bodies and endoplasmic reticulum by microscopy This product is for research use only and is not intended for diagnostic
More informationSupplementary Information. Supplementary Figures
Supplementary Information Supplementary Figures.8 57 essential gene density 2 1.5 LTR insert frequency diversity DEL.5 DUP.5 INV.5 TRA 1 2 3 4 5 1 2 3 4 1 2 Supplementary Figure 1. Locations and minor
More informationUnderstanding DNA Copy Number Data
Understanding DNA Copy Number Data Adam B. Olshen Department of Epidemiology and Biostatistics Helen Diller Family Comprehensive Cancer Center University of California, San Francisco http://cc.ucsf.edu/people/olshena_adam.php
More informationErzsebet Kokovay, Susan Goderie, Yue Wang, Steve Lotz, Gang Lin, Yu Sun, Badrinath Roysam, Qin Shen,
Cell Stem Cell, Volume 7 Supplemental Information Adult SVZ Lineage Cells Home to and Leave the Vascular Niche via Differential Responses to SDF1/CXCR4 Signaling Erzsebet Kokovay, Susan Goderie, Yue Wang,
More informationSupplemental Data. Wang et al. (2013). Plant Cell /tpc
Supplemental Data. Wang et al. (2013). Plant Cell 10.1105/tpc.112.108993 Supplemental Figure 1. 3-MA Treatment Reduces the Growth of Seedlings. Two-week-old Nicotiana benthamiana seedlings germinated on
More informationHands-On Ten The BRCA1 Gene and Protein
Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such
More informationEXO-DNAc Circulating and EV-associated DNA extraction kit
Datasheet EXO-DNAc Circulating and EV-associated DNA extraction kit This product is for research use only. It is highly recommended to read this users guide in its entirety prior to using this product.
More informationProduct Manual. Omni-Array Sense Strand mrna Amplification Kit, 2 ng to 100 ng Version Catalog No.: Reactions
Genetic Tools and Reagents Universal mrna amplification, sense strand amplification, antisense amplification, cdna synthesis, micro arrays, gene expression, human, mouse, rat, guinea pig, cloning Omni-Array
More informationNature Immunology: doi: /ni Supplementary Figure 1. Huwe1 has high expression in HSCs and is necessary for quiescence.
Supplementary Figure 1 Huwe1 has high expression in HSCs and is necessary for quiescence. (a) Heat map visualizing expression of genes with a known function in ubiquitin-mediated proteolysis (KEGG: Ubiquitin
More informationSupplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each
Supplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each species observed. Data show a binary response to a 4 mm
More informationAbstract. Optimization strategy of Copy Number Variant calling using Multiplicom solutions APPLICATION NOTE. Introduction
Optimization strategy of Copy Number Variant calling using Multiplicom solutions Michael Vyverman, PhD; Laura Standaert, PhD and Wouter Bossuyt, PhD Abstract Copy number variations (CNVs) represent a significant
More informationSingle Cell Quantitative Polymer Chain Reaction (sc-qpcr)
Single Cell Quantitative Polymer Chain Reaction (sc-qpcr) Analyzing gene expression profiles from a bulk population of cells provides an average profile which may obscure important biological differences
More informationmicrorna Presented for: Presented by: Date:
microrna Presented for: Presented by: Date: 2 micrornas Non protein coding, endogenous RNAs of 21-22nt length Evolutionarily conserved Regulate gene expression by binding complementary regions at 3 regions
More informationExoQuick Exosome Isolation and RNA Purification Kits
ExoQuick Exosome Isolation and RNA Purification Kits Cat # EQ806A-1, EQ806TC-1, EQ808A-1 User Manual Storage: Please see individual components Version 2 8/14/2018 A limited-use label license covers this
More informationSuppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial
Supplementary Information Häuselmann et al. Monocyte induction of E-selectin-mediated endothelial activation releases VE-cadherin junctions to promote tumor cell extravasation in the metastasis cascade
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationSupplementary Figure 1. IHC and proliferation analysis of pten-deficient mammary tumors
Wang et al LEGENDS TO SUPPLEMENTARY INFORMATION Supplementary Figure 1. IHC and proliferation analysis of pten-deficient mammary tumors A. Induced expression of estrogen receptor α (ERα) in AME vs PDA
More informationSupplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin
More informationCorporate Medical Policy
Corporate Medical Policy Microarray-based Gene Expression Testing for Cancers of Unknown File Name: Origination: Last CAP Review: Next CAP Review: Last Review: microarray-based_gene_expression_testing_for_cancers_of_unknown_primary
More informationCharacterization of the 11q13.3 amplicon in head and neck squamous cell carcinoma Gibcus, Johan Harmen
University of Groningen Characterization of the 11q13.3 amplicon in head and neck squamous cell carcinoma Gibcus, Johan Harmen IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's
More informationSupporting Information
Supporting Information Identification of Novel ROS Inducers: Quinone Derivatives Tethered to Long Hydrocarbon Chains Yeonsun Hong,, Sandip Sengupta,, Wooyoung Hur, *, Taebo Sim,, * KU-KIST Graduate School
More informationp.r623c p.p976l p.d2847fs p.t2671 p.d2847fs p.r2922w p.r2370h p.c1201y p.a868v p.s952* RING_C BP PHD Cbp HAT_KAT11
ARID2 p.r623c KMT2D p.v650fs p.p976l p.r2922w p.l1212r p.d1400h DNA binding RFX DNA binding Zinc finger KMT2C p.a51s p.d372v p.c1103* p.d2847fs p.t2671 p.d2847fs p.r4586h PHD/ RING DHHC/ PHD PHD FYR N
More informationA complete next-generation sequencing workfl ow for circulating cell-free DNA isolation and analysis
APPLICATION NOTE Cell-Free DNA Isolation Kit A complete next-generation sequencing workfl ow for circulating cell-free DNA isolation and analysis Abstract Circulating cell-free DNA (cfdna) has been shown
More informationfl/+ KRas;Atg5 fl/+ KRas;Atg5 fl/fl KRas;Atg5 fl/fl KRas;Atg5 Supplementary Figure 1. Gene set enrichment analyses. (a) (b)
KRas;At KRas;At KRas;At KRas;At a b Supplementary Figure 1. Gene set enrichment analyses. (a) GO gene sets (MSigDB v3. c5) enriched in KRas;Atg5 fl/+ as compared to KRas;Atg5 fl/fl tumors using gene set
More informationSupplementary information. MARCH8 inhibits HIV-1 infection by reducing virion incorporation of envelope glycoproteins
Supplementary information inhibits HIV-1 infection by reducing virion incorporation of envelope glycoproteins Takuya Tada, Yanzhao Zhang, Takayoshi Koyama, Minoru Tobiume, Yasuko Tsunetsugu-Yokota, Shoji
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationSupplemental Data. Wu et al. (2010). Plant Cell /tpc
Supplemental Figure 1. FIM5 is preferentially expressed in stamen and mature pollen. The expression data of FIM5 was extracted from Arabidopsis efp browser (http://www.bar.utoronto.ca/efp/development/),
More informationSerafino et al. Thymosin α1 activates complement receptor-mediated phagocytosis in human monocyte-derived macrophages. SUPPLEMENTARY FIGURES
Supplementary Fig. S1. Evaluation of the purity and maturation of macrophage cultures tested by flow cytometry. The lymphocytic/monocytic cellular fraction was isolated from buffy coats of healthy donors
More informationAP VP DLP H&E. p-akt DLP
A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy
More informationFocus Application. Compound-Induced Cytotoxicity
xcelligence System Real-Time Cell Analyzer Focus Application Compound-Induced Cytotoxicity For life science research only. Not for use in diagnostic procedures. Featured Study: Using the Time Resolving
More informationNature Genetics: doi: /ng Supplementary Figure 1. Phenotypic characterization of MES- and ADRN-type cells.
Supplementary Figure 1 Phenotypic characterization of MES- and ADRN-type cells. (a) Bright-field images showing cellular morphology of MES-type (691-MES, 700-MES, 717-MES) and ADRN-type (691-ADRN, 700-
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationPair-fed % inkt cells 0.5. EtOH 0.0
MATERIALS AND METHODS Histopathological analysis Liver tissue was collected 9 h post-gavage, and the tissue samples were fixed in 1% formalin and paraffin-embedded following a standard procedure. The embedded
More informationp47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO
Supplementary Information p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO Yuri Shibata, Masaaki Oyama, Hiroko Kozuka-Hata, Xiao Han, Yuetsu Tanaka,
More informationSupplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.
More information