HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy

Size: px
Start display at page:

Download "HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy"

Transcription

1 HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy Scott R. Manson, Joseph B. Song, Keith A. Hruska and Paul F. Austin* From the Division of Urology, Department of Surgery and Division of Pediatric Nephrology, Departments of Medicine and Pediatrics (KAH), Washington University, St. Louis Children s Hospital, St. Louis, Missouri Abbreviations and Acronyms a-sma ¼ a-smooth muscle actin BMP-7 ¼ bone morphogenic protein 7 COLIa1 ¼ type I collagen, a1 chain ELISA ¼ enzyme-linked immunosorbent assay GAPDH ¼ glyceraldehyde-3- phosphate dehydrogenase HDAC ¼ histone deacetylase IMCD ¼ inner medullary collecting duct PCR ¼ polymerase chain reaction RT-PCR ¼ reverse transcriptase-pcr SMAD ¼ SMA- and MAD-related protein TGF-b ¼ transforming growth factor-b TSA ¼ trichostatin A UUO ¼ unilateral ureteral obstruction Accepted for publication June 27, Study received institutional animal care and use committee approval. Supported by NIH/NIDDK Grant 1R01DK * Correspondence: Washington University, 660 South Euclid Ave., Campus Box 8242, St. Louis, Missouri (telephone: ; FAX: ; austinp@wustl.edu). Purpose: Recombinant BMP-7 inhibits the pathogenesis of renal injury in response to various stimuli. However, little is known about the molecular regulation of endogenous BMP-7 and its renal protective functions. We examined transcriptional regulation of Bmp-7 and its role in the pathogenesis of renal injury resulting from urinary tract dysfunction. Materials and Methods: Obstruction induced renal injury was modeled in vivo in mice by unilateral ureteral obstruction and in vitro in primary kidney cells by treatment with transforming growth factor-b, a profibrotic cytokine that is increased in the obstructed kidney. Results: Unilateral ureteral obstruction resulted in the loss of BMP-7 expression in conjunction with histone deacetylation and transcriptional repression of the Bmp-7 promoter. The histone deacetylase inhibitor trichostatin A stimulated Bmp-7 expression in primary kidney cells. Trichostatin A also inhibited the expression of transforming growth factor-b dependent profibrotic genes in a manner that depended on BMP receptor signaling. These findings extended to the obstructed kidney in vivo, in which trichostatin A treatment restored the expression of Bmp-7 along with BMP-7 mediated suppression of transforming growth factor-b dependent signaling pathways. Finally, trichostatin A stimulated activation of the BMP-7 pathway the ameliorated obstruction induced renal injury by preventing disruption of the renal architecture and the development of renal fibrosis. Conclusions: These findings show that histone deacetylase dependent repression of Bmp-7 transcription is a critical event during the pathogenesis of renal injury in obstructive uropathy. Accordingly, treatment with histone deacetylase inhibitors represents a potentially effective strategy to restore BMP-7 expression and its renal protective functions during treatment of obstructive uropathy. Key Words: kidney, ureteral obstruction, bone morphogenetic protein 7, fibrosis, histone deacetylase inhibitors OBSTRUCTIVE uropathy is a leading cause of pediatric kidney disease, accounting for 16.5% of kidney transplants in children. 1 While the kidney has innate repair mechanisms that can restore renal structure and function after acute injury due to urinary obstruction and other stimuli, 2e4 the clinical manifestation of chronic renal injury stems in part 242 j /14/ /0 THE JOURNAL OF UROLOGY 2014 by AMERICAN UROLOGICAL ASSOCIATION EDUCATION AND RESEARCH,INC. Vol. 191, , January 2014 Printed in U.S.A.

2 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY 243 from a dysregulated wound healing response, which results in renal fibrosis. 3,4 At the molecular level activation of the TGF-b pathway is classically described as a critical pathological step in the development of renal fibrosis that promotes apoptosis, cellular dedifferentiation, myofibroblast activation and matrix protein synthesis. 5 Given that these processes are involved in injury repair, 4 it is likely that TGF-b also has a physiological role in the early stages of injury repair but when TGF-b activity is dysregulated, it instead promotes disease progression. Nonetheless, mechanisms that counter regulate TGF-b activity during the response to renal injury are poorly understood. Interestingly, another member of the TGF-b superfamily, BMP-7, inhibits TGF-b dependent signaling pathways. 6 The inhibitory effects of BMP-7 are mediated by the activation of SMAD1/5/8 proteins, which in turn suppress the activity of TGF-b dependent transcription factors and their ability to stimulate profibrotic gene expression. 7,8 Treatment with recombinant BMP-7 inhibits the development of renal injury in response to urinary obstruction and various other stimuli. 6e17 While the renal protective effects of recombinant BMP-7 are well established, at our laboratory it was recently noted that endogenous BMP-7 activity is required for cessation of the TGF-b response along with the restoration of renal architecture and the resolution of fibrotic changes in the kidney that occur during the repair of obstruction induced renal injury. 8 The importance of BMP-7 in the repair of renal injury was further supported by studies at our laboratory and by others showing that treatment with recombinant BMP-7 can reverse the progression of chronic renal injury. 8e10 Despite the biological importance of BMP-7 little is known about the molecular mechanisms that regulate endogenous BMP-7 activity and its renal protective functions. However, at our laboratory it was found that BMP-7 expression is up-regulated during kidney repair after acute obstruction induced renal injury. 7,8 Conversely, chronic renal injury in response to various stimuli, including urinary obstruction, is associated with loss of BMP-7 expression. 8,11e13,18 Along with the previous findings this suggests that loss of BMP-7 expression is a critical event during the pathogenesis of chronic renal injury that may lead to the suppression of BMP-7 dependent repair mechanisms and in part the persistent, inappropriate activation of TGF-b dependent profibrotic pathways. In this study we delineated the molecular mechanisms that lead to loss of BMP-7 expression in the obstructed kidney and examined their potential importance for the treatment of obstructive uropathy and other conditions that lead to chronic renal injury. MATERIALS AND METHODS Unilateral Ureteral Obstruction UUO was created in 8 to 10-week-old C57BL/6J mice by placing a microvascular clamp on the proximal ureter. 2 When indicated, mice were treated with 500 mg/kg TSA (SigmaÒ) daily by intraperitoneal injection. All procedures were approved by institutional review. Histology Trichrome staining was done using the AccustainÔ Masson trichrome staining kit. Immunofluorescence was performed using rabbit anti-bmp-7 and rabbit anti-type IV collagen (AbcamÒ), as previously described. 8 Tubular volume was quantified in samples stained for type IV collagen by digitally overlaying a grid on microscopy images and determining the percent of grid points located in the interstitial/tubular regions. 14 Collagen Quantification Kidney samples were hydrolyzed and hydroxyproline was quantified by comparison to standards in a colorimetric reaction, as previously described. 19 Collagen content was calculated using the approximation that collagen contains approximately 14% (weight per weight) hydroxyproline. Values are expressed as a ratio to the dry tissue weight of the sample. BMP-7 Enzyme-Linked Immunosorbent Assay Kidneys were pulverized in liquid nitrogen. They were homogenized in 100 mm tris-hcl (ph 7.4), 150 mm NaCl, 1% Triton Ò, 0.5% sodium deoxycholate, 1 mm ethylenediaminetetraacetic acid, 1 mm ethylene glycol tetraacetic acid and Complete Protease Inhibitor Cocktail (Roche, Mannheim, Germany). Samples were normalized to total protein content using the PierceÔ BCA Protein Assay Kit. BMP-7 levels were quantified using the BMP-7 ELISA Kit (R&D SystemsÒ) according to product specifications. Reverse Transcription-PCR Kidneys were pulverized in liquid nitrogen and homogenized in TRIzolÒ. RNA was isolated. RT-PCR was done using the SuperScriptÔ RT-PCR system with primers specific for BMP-7 (5 0 -GAAAACAGCAGCAGTGACCA-3 0 and 5 0 -GCTCAGGAGAGGTTGGTCTG-3 0 ), TGF-b1 (5 0 -CA AACGTCGGGGCGACCTGG-3 0 and 5 0 -TGCTCCACCTTG GGCTTGCG-3 0 ), a-sma (5 0 -CCCTGAGACGCTGCTCCAG CTA-3 0 and 5 0 -GGCATAGAGGGACAGCACAGCCT-3 0 ), COLIa1 (5 0 -TGGTCCTGCCGGTCCTCCTG-3 0 and 5 0 -ACA CATTGGGGGTAGGAACA-3 0 ), and GAPDH (5 0 -AACTTTG GCATTGTGGAAGG-3 0 and 5 0 -ACACATTGGGGGTAGGA ACA-3 0 ). The relative intensity of PCR bands was quantified using ImageJ ( and normalized as a ratio to GAPDH levels. Chromatin Immunoprecipitation Chromatin immunoprecipitation was performed using the ImprintÒ Chromatin Immunoprecipitation Kit. DNA was sheared to 2 kb fragments by sonication.

3 244 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY Immunoprecipitation was performed using rabbit IgG or rabbit anti-acetyl-histone H3 (Sigma). PCR was done with primers specific to the e407 to e151 bp region of the proximal Bmp-7 promoter, including (5 0 -GTTTGTTGCTGGTG CCCGCG-3 0 and 5 0 -GCTCTACGCGCGATCCGGG-3 0 ). The relative intensity of PCR bands was quantified using ImageJ and normalized as a ratio to PCR products from reactions performed on input DNA. Primary Kidney Cell Culture Murine IMCD-3 cells (ATCCÒ) were cultured in Dulbecco s modified Eagle s medium/f12 growth medium supplemented with 10% fetal bovine serum. As indicated, cells were treated with 100 nm TSA, 1 ng/ml TGF-b, 10 ng/ml BMP-7 (R&D Systems) or 10 mm dorsomorphin (Sigma). Statistical Analysis Statistical significance was determined using the t-test or ANOVA with the Bonferroni correction for multiple comparisons, as appropriate. Data are shown as the mean SD. RESULTS Obstruction Induced Renal Injury Associated with Transcriptional Repression of Bmp-7 Expression To examine the molecular regulation of BMP-7 we studied a murine model of obstruction induced renal injury after UUO (fig. 1). 2 UUO resulted in a dramatic decrease in BMP-7 expression in various cell types throughout the kidney (fig. 1, A). When quantifying the loss of BMP-7 expression, we found that UUO induced renal injury was associated with a mean 88.1% 11.1% decrease in BMP-7 protein levels along with a corresponding 83.1% 12.8% decrease in BMP-7 mrna levels (p <0.005 and <0.01, respectively, fig. 2, A to C ). Together these data suggest the possibility that the loss of BMP-7 expression is mediated at the transcriptional level. Accordingly, we determined whether the loss of BMP-7 mrna expression was associated with chromatin modifications in the regulatory regions of the Bmp-7 gene. UUO resulted in a mean 63.0% 8.5% decrease in the acetylation of histone H3 proteins bound to the proximal Bmp-7 promoter (p <0.005, fig. 2, D and E ). This was a significant finding, given that a number of transcriptional factors function by recruiting HDAC complexes to target genes, a process that subsequently promotes chromatin condensation and transcriptional repression. 20 HDAC Proteins Regulated Bmp-7 Expression and BMP-7 Mediated Suppression of TGF-b Dependent Profibrotic Pathways In Vitro To begin to investigate the role of changes in histone acetylation in the regulation of BMP-7 expression we examined transcriptional regulation of Bmp-7 in IMCD-3 cells, which are a significant source of BMP-7 in the kidney. 6 Treatment with the pan-hdac inhibitor TSA 20 stimulated a mean fold increase in BMP-7 mrna levels in IMCD-3 cells (p <0.005, fig. 3). In addition to other results (fig. 2, D and E ), this finding shows that Bmp-7 expression is repressed by HDAC proteins. We then determined the importance of HDAC dependent regulation of Bmp-7 expression in the renal protective functions of the BMP-7 pathway. To accomplish this we studied an in vitro model of TGF-b mediated renal fibrosis and used the suppression of TGF-b dependent profibrotic gene expression as a functional readout for BMP-7 activity. As previously demonstrated, treatment with TGF-b induced the expression of several profibrotic genes central to the pathogenesis of renal injury, including COLIa1, a gene that encodes a protein that significantly contributes to fibrosis, 21 and a-sma, a gene that encodes a protein that contributes to Figure 1. Obstruction induced renal injury led to loss of BMP-7 expression. Five mice underwent sham operation or UUO for 7 days (7D) and kidneys were analyzed. A, type IV collagen immunofluorescence (green areas) with DAPI counterstaining (blue areas). BMP-7 immunofluorescence (red areas) with DAPI counterstaining (blue areas). B, quantification of collagen content. Asterisk indicates p <0.05.

4 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY 245 Figure 2. Loss of BMP-7 expression was mediated at mrna level in conjunction with histone deacetylation in proximal Bmp-7 promoter. Three mice underwent sham operation or UUO for 7 days (7D) and kidneys were analyzed. A, BMP-7 ELISA. Asterisk indicate p < B, RT-PCR for Bmp-7 and TGF-b1 with GAPDH as control. C, quantification of Bmp-7 expression (B). Asterisks indicate p <0.01. D, chromatin immunoprecipitation with anti-acetylated histone H3 or rabbit IgG as control, followed by PCR directed against proximal region (e407 to e151 bp) of Bmp-7 promoter. E, quantification of HDAC in Bmp-7 promoter (D). Asterisk indicate p < the differentiation of profibrotic myofibroblasts 22 (each p <0.005, fig. 4, A to C ). Importantly, co-treatment with recombinant BMP-7 resulted in a mean 67.3% 25.8% decrease in COLIa1 induction and a 68.7% 19.1% decrease in a-sma induction (each p <0.005, fig. 4, A to C ). This shows that BMP-7 pathway activation is sufficient to suppress TGF-b dependent profibrotic gene expression in this model system. When examining the effects of HDAC inhibition on BMP-7 pathway activity, we found that TSA treatment resulted in a mean fold increase in Bmp-7 expression (p <0.005) and stimulation of Bmp-7 expression was not affected by TGF-b co-treatment (fig. 4, A and D). In a manner similar to BMP-7 treatment co-treatment with TSA resulted in a mean 73.7% 21.9% decrease in TGF-b induced COLIa1 expression and a 60.0% 13.6% decrease in TGF-b induced a-sma expression (each p <0.005, fig. 4, A to C ). Given that TGF-b dependent Smad binding sites are required for promoter activity in the COLIa1 and a-sma genes, 21,22 it is likely that the inhibitory effects of TSA treatment are mediated by the suppression of downstream steps in the TGF-b pathway. In support of this possibility TSA treatment had only

5 246 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY Figure 3. HDAC proteins repressed BMP-7 mrna expression in 3 plates of IMCD-3 primary kidney cells per sample treated with PBS as control or 100 nm TSA for 24 hours. Cells were analyzed. A, RT-PCR for Bmp-7 with GAPDH as control. B, quantification of Bmp-7 expression (A). Asterisks indicate p < minimal effects on baseline expression of COLIa1, a-sma and endogenous TGF-b1 in the absence of recombinant TGF-b (fig. 4, A to C and E ). We next determined the requirement for BMP-7 activity in the ability of TSA to inhibit TGF-b dependent profibrotic gene expression. To accomplish this we examined the effects of dorsomorphin, a pharmacological inhibitor of BMP receptor activity, 23 on the inhibitory effects of TSA. As noted (fig. 4), TSA treatment stimulated Bmp-7 expression and suppressed TGF-b induced COLIa1 and a-sma expression (each p <0.005, fig. 5, A to D). However, when combined with dorsomorphin treatment, the inhibitory effects of TSA on TGF-b induced COLIa1 expression and on TGF-b induced a-sma expression decreased a mean of 66.8% 5.5% and 77.9% 17.1% (p <0.01 and <0.05, respectively, fig. 5, A, C and D). Importantly, dorsomorphin treatment did not affect TSA stimulated Bmp-7 expression and had only minimal effects on baseline expression of COLIa1, a-sma and endogenous TGF-b1 in the absence of recombinant TGF-b (fig. 5). Together these findings show that the TGF-b suppressing effects of HDAC inhibition largely depend on stimulating BMP-7 pathway activity. HDAC Inhibition Restored BMP-7 Expression, Suppressed TGF-b Activity and Ameliorated Renal Injury in Obstructive Uropathy To extend these findings to the pathogenesis of chronic renal injury in vivo we examined the effects of HDAC inhibition on BMP-7 expression in our murine model of obstructive uropathy. While UUO resulted in a significant decrease in BMP-7 protein levels, TSA treatment restored BMP-7 expression in the obstructed kidney by stimulating a mean fold increase in BMP-7 protein levels (p <0.01, fig. 6, A). Importantly, these changes in BMP-7 expression at the protein level were paralleled by a mean fold increase in BMP-7 mrna expression (p <0.01, fig. 6, B and C ). In addition to other findings (fig. 2, D and E ), these results show that Bmp-7 transcription is regulated by HDAC dependent mechanisms in vivo. We subsequently determined whether the HDAC dependent repression of Bmp-7 expression has a role in the molecular mechanisms that respond to renal injury. As shown in previous studies, UUO resulted in significant up-regulation of TGF-b1 expression along with its downstream profibrotic target genes COLIa1 (each p <0.005) and a-sma (p <0.05) during the development of obstruction induced renal fibrosis (fig. 6, B and D to F ). 5 Importantly, TSA treatment not only restored BMP-7 expression in the obstructed kidney but also decreased COLIa1 expression a mean of 41.6% 7.0% and a-sma expression by 61.6% 37.0% (p <0.01, <0.005 and <0.05, respectively, fig. 6, A to C, E and F ). Furthermore, TSA treatment had only minimal effects on TGF-b1 expression (fig. 6, B and D), revealing that the inhibitory effects of HDAC inhibition were mediated by the suppression of downstream steps in the TGF-b pathway. In addition to our prior results (figs. 4 and 5), these results strongly suggest that HDAC dependent repression of Bmp-7 expression contributes to dysregulation of the TGF-b pathway after chronic renal injury. Since previous findings revealed that HDAC inhibition restored BMP-7 expression and the balance in TGF-b/BMP-7 signaling in the obstructed kidney (fig. 6), we examined the therapeutic effects of treatment with HDAC inhibitors during chronic renal injury progression. While UUO resulted in the loss of BMP-7 expression in various cell types in the obstructed kidney, TSA treatment effectively

6 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY 247 Figure 4. HDAC inhibition suppressed activity of TGF-b dependent profibrotic pathways in 3 plates of IMCD-3 primary kidney cells per sample. Cells were serum starved for 24 hours, reintroduced to serum containing medium and treated with PBS as control, 1 ng/ml TGF-b with PBS as control, 10 ng/ml BMP-7 or 100 nm TSA for 24 hours. Cells were analyzed. A, RT-PCR for Bmp-7, TGF-b1, COLIa1 and a-sma with GAPDH as control. B to E, quantification of expression (A). ns, p >0.05. Open bars indicate control. Light gray bars indicate BMP-7. Dark gray bars indicate TSA. Single asterisk indicates p <0.05. Double asterisks indicate p <0.01.Triple asterisks indicate p < B, COLIa1. C, a-sma. D, BMP-7. E, TGF-b1. targeted each of these cell populations to restore BMP-7 expression (fig. 7, A). More importantly, TSA treatment also markedly inhibited the development of UUO induced renal injury. TSA treatment was associated with a mean 31.1% 7.6% decrease in total renal collagen content (p <0.05, fig. 7, A and B). This was a striking finding, given that this corresponded to a 65.3% reduction in the increase in collagen expression above baseline after UUO. TSA treatment also resulted in a mean 43.4% 10.1% decrease in tubular volume loss after UUO (p <0.01, (fig. 7, A and C ). Together these findings show that pharmacological HDAC inhibitors are an effective therapeutic approach not only to prevent the loss of BMP-7 expression in the injured kidney but also to inhibit renal fibrosis and the disruption of renal architecture during the progression of chronic renal injury.

7 248 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY Figure 5. TGF-b suppressing effects of HDAC inhibition depended on BMP activity stimulation. Three plates of IMCD-3 cells per sample were serum starved for 24 hours, reintroduced to serum containing medium and treated with PBS as control or 1 ng/ml TGF-b with PBS as control, 10 ng/ml BMP-7 or 100 nm TSA with PBS as control, or 10 mm dorsomorphin for 24 hours. Cells were analyzed. A, RT-PCR for Bmp-7, TGF-b1, COLIa1 and a-sma with GAPDH as control. B to E, quantification of expression (A). DM, dorsomorphin. ns,p>0.05. Open bars indicate control. Light gray bars indicate BMP-7. Dark gray bars indicate TSA. Single asterisk indicates p <0.05. Double asterisks indicate p <0.01. Triple asterisks indicate p < B, Bmp-7. C, COLIa1. D, a-sma. E, TGF-b1. DISCUSSION In the last decade BMP-7 emerged as a critical renal protective protein that safeguards the kidney against various stimuli that cause renal injury. 6e17 However, loss of BMP-7 expression occurs in obstructive uropathy and other conditions that lead to chronic renal injury. 8,11e13,18 While mechanisms that lead to the loss of BMP-7 expression remain unclear, we noted in a mouse model of obstructive uropathy that loss of BMP-7 expression occurs at the mrna level in conjunction with histone deacetylation and transcriptional repression of the Bmp-7 promoter (fig. 2). Importantly, treatment with the pan-specific HDAC inhibitor TSA

8 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY 249 Figure 6. HDAC inhibition restored BMP-7 expression and suppressed TGF-b dependent profibrotic pathways after UUO induced renal injury in 3 mice with sham operation or UUO for 7 days (7D) treated with PBS as control or 500 mg/kg TSA. Kidneys were analyzed. A, BMP-7 ELISA. Open bars indicate control. Gray bars indicate TSA. Double asterisks indicate p <0.01. Triple asterisks indicate p < B, RT-PCR for Bmp-7, TGF-b1, COLIa1 and a-sma with GAPDH as control. C to F, quantification of expression (B). ns, p >0.05. Single asterisk indicates p <0.05. C, Bmp-7. D, TGF-b1. E, COLIa1. F, a-sma.

9 250 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY restored BMP-7 expression in the obstructed kidney (fig. 6). When examining the role of HDAC dependent repression of Bmp-7 expression in molecular mechanisms that respond to renal injury, we found that HDAC inhibition limited the profibrotic potential of renal epithelial cells in vitro by suppressing the downstream steps in the TGF-b signaling pathway in a BMP-7 dependent manner (figs. 4 and 5). These signaling mechanisms also had considerable implications during the in vivo response to renal injury (fig. 8). This was demonstrated by the finding that TSA treatment inhibited the expression of TGF-b induced profibrotic genes in the obstructed kidney (fig. 6). We previously reported that BMP-7 is required for cessation of the TGF-b response and for Figure 7. HDAC inhibition ameliorated UUO induced renal injury in 5 mice with sham operation or UUO for 7 days (7D) and treatment with PBS as control or 500 mg/kg TSA. Kidneys were analyzed. A, type IV collagen immunofluorescence (green areas) with DAPI counterstaining (blue areas). BMP-7 immunofluorescence (red areas) with DAPI counterstaining (blue areas). B and C, quantification. Open bars indicate control. Gray bars indicate TSA. Single asterisk indicates p <0.05. Double asterisks indicate p <0.01. B, collagen content. C, tubular volume.

10 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY 251 Figure 8. HDAC dependent transcriptional repression of Bmp-7 potentiated TGF-b mediated renal fibrosis in obstructive uropathy. BMP-7 protein is secreted cytokine that normally functions to stimulate gene transcription by binding to its receptor and activating Smad1/5/8 transcription factors. BMP-7 pathway activation also suppresses profibrotic TGF-b pathway by sequestering Smad4, protein needed for transcription of many TGF-b dependent genes. 6 These counter regulatory mechanisms are important to suppress TGF-b dependent profibrotic pathways during kidney repair. 8 However, chronic urinary tract obstruction results in HDAC dependent suppression of Bmp-7 transcription. BMP-7 loss results in dysregulation of kidney repair with persistent, inappropriate activation of TGF-b pathway. Pharmacological HDAC inhibitor treatment restores BMP-7 expression, suppresses TGF-b dependent signaling pathways and prevents renal fibrosis after chronic urinary tract obstruction. the repair of obstruction induced renal injury. 8 The current findings strongly suggest that HDAC dependent repression of Bmp-7 expression contributes to persistent activation of the TGF-b pathway and to dysregulation of kidney repair after chronic renal injury. Based on these findings, we have begun to examine the therapeutic potential of administering pharmacological HDAC inhibitors to limit the progression of chronic renal injury. Importantly, TSA treatment significantly inhibits the development of renal fibrosis and the loss of renal architecture in response to urinary tract dysfunction (fig. 7). While the suppression of TGF-b signaling likely explains many of the antifibrotic effects of TSA stimulated BMP-7 expression, TGF-b independent mechanisms likely also have an important role in inhibiting the pathogenesis of renal injury. We and others previously noted that recombinant BMP-7 promotes the regeneration of renal architecture after injury 8e10,17 in a manner that recapitulates the requirement for BMP-7 during kidney development. 24 A possible role for these functions in the renal protective effects of HDAC inhibition was recently suggested by a group that identified an HDAC inhibitor as the leading candidate in a high throughput screen designed to identify compounds that stimulate regenerative cell populations in the kidney. 25 To fully realize the therapeutic potential of HDAC inhibitors it is necessary to translate these findings to in vivo models that more closely parallel the development of kidney disease after congenital urinary obstruction. While in our study we examined obstruction induced renal injury in the mature kidney, surgical models of fetal/neonatal obstruction as well as genetic models of congenital obstruction may provide useful tools for examining the importance of these biological pathways in the developing kidney. 26 Also, while our treatment regimen for TSA administration was supported by prior pharmacokinetic studies, 27 these protocols may be improved through further optimization. Finally, isoform specific HDAC inhibitors may provide a means of developing more specific, effective therapies for kidney disease. CONCLUSIONS While working toward the development of novel therapies for chronic kidney disease, it has become increasingly evident that loss of BMP-7 is a critical molecular event that contributes to disease progression across a broad spectrum of etiologies. 6e18 Our study shows that loss of BMP-7 occurred due to HDAC dependent repression of Bmp-7 transcription in a murine model of obstructive uropathy. Furthermore, treatment with HDAC inhibitors was an effective therapeutic approach to restore BMP-7 expression and limit the progression of chronic renal injury in the obstructed kidney. The importance of these findings is accentuated by studies showing the renal protective effects of HDAC inhibition in other settings. 28e30 Although the mechanisms underlying these effects remain unclear, our series reveals that the remarkable therapeutic potential of HDAC inhibitors is due in part to

11 252 REPRESSION OF Bmp-7 POTENTIATES RENAL FIBROSIS IN OBSTRUCTIVE UROPATHY their ability to target the BMP-7 pathway. Given that HDAC inhibitors are already in clinical use, it is imperative to further examine the usefulness of these compounds for treating obstructive uropathy and other conditions that lead to chronic kidney disease. REFERENCES 1. Roth KS, Koo HP, Spottswood SE et al: Obstructive uropathy: an important cause of chronic renal failure in children. Clin Pediatr (Phila) 2002; 41: Cochrane AL, Kett MM, Samuel CS et al: Renal structural and functional repair in a mouse model of reversal of ureteral obstruction. J Am Soc Nephrol 2005; 16: Chawla LS and Kimmel PL: Acute kidney injury and chronic kidney disease: an integrated clinical syndrome. Kidney Int 2012; 82: Yang L, Humphreys BD and Bonventre JV: Pathophysiology of acute kidney injury to chronic kidney disease: maladaptive repair. Contrib Nephrol 2011; 174: Bottinger EP: TGF-beta in renal injury and disease. Semin Nephrol 2007; 27: Meng XM, Chung AC and Lan HY: Role of the TGF-beta/BMP-7/Smad pathways in renal diseases. Clin Sci (Lond) 2013; 124: Manson SR, Niederhoff RA, Hruska KA et al: The BMP-7-Smad1/5/8 pathway promotes kidney repair after obstruction induced renal injury. J Urol 2011; 185: Manson SR, Niederhoff RA, Hruska KA et al: Endogenous BMP-7 is a critical molecular determinant of the reversibility of obstructioninduced renal injuries. Am J Physiol Renal Physiol 2011; 301: F Zeisberg M, Hanai J, Sugimoto H et al: BMP-7 counteracts TGF-beta1-induced epithelial-tomesenchymal transition and reverses chronic renal injury. Nat Med 2003; 9: Zeisberg M, Shah AA and Kalluri R: Bone morphogenic protein-7 induces mesenchymal to epithelial transition in adult renal fibroblasts and facilitates regeneration of injured kidney. J Biol Chem 2005; 280: Zeisberg M, Bottiglio C, Kumar N et al: Bone morphogenic protein-7 inhibits progression of chronic renal fibrosis associated with two genetic mouse models. Am J Physiol Renal Physiol 2003; 285: F Hruska KA, Guo G, Wozniak M et al: Osteogenic protein-1 prevents renal fibrogenesis associated with ureteral obstruction. Am J Physiol Renal Physiol 2000; 279: F Wang S, de Caestecker M, Kopp J et al: Renal bone morphogenetic protein-7 protects against diabetic nephropathy. J Am Soc Nephrol 2006; 17: Morrissey J, Hruska K, Guo G et al: Bone morphogenetic protein-7 improves renal fibrosis and accelerates the return of renal function. J Am Soc Nephrol, suppl., 2002; 13: S Wang S, Chen Q, Simon TC et al: Bone morphogenic protein-7 (BMP-7), a novel therapy for diabetic nephropathy. Kidney Int 2003; 63: Vukicevic S, Basic V, Rogic D et al: Osteogenic protein-1 (bone morphogenetic protein-7) reduces severity of injury after ischemic acute renal failure in rat. J Clin Invest 1998; 102: Zhen-Qiang F, Bing-Wei Y, Yong-Liang L et al: Localized expression of human BMP-7 by BM- MSCs enhances renal repair in an in vivo model of ischemia-reperfusion injury. Genes Cells 2012; 17: Wang SN, Lapage J and Hirschberg R: Loss of tubular bone morphogenetic protein-7 in diabetic nephropathy. J Am Soc Nephrol 2001; 12: Samuel CS: Determination of collagen content, concentration, and sub-types in kidney tissue. Methods Mol Biol 2009; 466: de Ruijter AJ, van Gennip AH, Caron HN et al: Histone deacetylases (HDACs): characterization of the classical HDAC family. Biochem J 2003; 370: Ritzenthaler JD, Goldstein RH, Fine A et al: Regulation of the alpha 1(I) collagen promoter via a transforming growth factor-beta activation element. J Biol Chem 1993; 268: Hautmann MB, Madsen CS and Owens GK: A transforming growth factor beta (TGFbeta) control element drives TGFbeta-induced stimulation of smooth muscle alpha-actin gene expression in concert with two CArG elements. J Biol Chem 1997; 272: Yu PB, Hong CC, Sachidanandan C et al: Dorsomorphin inhibits BMP signals required for embryogenesis and iron metabolism. Nat Chem Biol 2008; 4: Dudley AT, Lyons KM and Robertson EJ: A requirement for bone morphogenetic protein-7 during development of the mammalian kidney and eye. Genes Dev 1995; 9: de Groh ED, Swanhart LM, Cosentino CC et al: Inhibition of histone deacetylase expands the renal progenitor cell population. J Am Soc Nephrol 2010; 21: Chevalier RL, Forbes MS and Thornhill BA: Ureteral obstruction as a model of renal interstitial fibrosis and obstructive nephropathy. Kidney Int 2009; 75: Sanderson L, Taylor GW, Aboagye EO et al: Plasma pharmacokinetics and metabolism of the histone deacetylase inhibitor trichostatin a after intraperitoneal administration to mice. Drug Metab Dispos 2004; 32: Mishra N, Reilly CM, Brown DR et al: Histone deacetylase inhibitors modulate renal disease in the MRL-lpr/lpr mouse. J Clin Invest 2003; 111: Pang M and Zhuang S: Histone deacetylase: a potential therapeutic target for fibrotic disorders. J Pharmacol Exp Ther 2010; 335: Lee HB, Noh H, Seo JY et al: Histone deacetylase inhibitors: a novel class of therapeutic agents in diabetic nephropathy. Kidney Int Suppl 2007; 106: S61.

The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury

The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury Scott R. Manson, Robert A. Niederhoff, Keith A. Hruska and Paul F. Austin* From the Division of Pediatric Urology,

More information

HDAC Inhibition for Prevention of Fibrosis Following Sepsisinduced

HDAC Inhibition for Prevention of Fibrosis Following Sepsisinduced HDAC Inhibition for Prevention of Fibrosis Following Sepsisinduced AKI John A. Kellum, MD, MCCM Professor of Critical Care Medicine, Medicine, Bioengineering and Clinical & Translational Science Vice Chair

More information

Bone morphogenic protein-7 and the kidney: current concepts and open questions

Bone morphogenic protein-7 and the kidney: current concepts and open questions NDT Advance Access published December 22, 2005 Nephrol Dial Transplant (2005) 1 of 5 doi:10.1093/ndt/gfk010 Editorial Comment Bone morphogenic protein-7 and the kidney: current concepts and open questions

More information

Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury

Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury Hong Lu 1, Bicheng Chen 2, Weilong Hong 2, Yong Liang 2 and Yongheng Bai 2 1

More information

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Chapter 04 Boek 1_Gie.indb 55 21-05-2007 12:27:33 Chapter 04 Abstract Goal: TGF-b and IGF-I

More information

Social deficits in Shank3-deficient mouse models of autism are rescued by histone deacetylase (HDAC) inhibition

Social deficits in Shank3-deficient mouse models of autism are rescued by histone deacetylase (HDAC) inhibition SUPPLEMENTARY INFORMATION Articles https://doi.org/10.1038/s41593-018-0110-8 In the format provided by the authors and unedited. Social deficits in Shank3-deficient mouse models of autism are rescued by

More information

Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression

Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression Xiaoxu Zhou,* Xiujuan Zang,* Murugavel Ponnusamy,* Monica V. Masucci,*

More information

Regenerative Medicine for Sclerotic Disorders

Regenerative Medicine for Sclerotic Disorders Regenerative Medicine Regenerative Medicine for Sclerotic Disorders JMAJ 7(7): 3 37, Toshikazu NAKAMURA rofessor, Division of Molecular Regenerative Medicine, Course of Advanced Medicine, Osaka University

More information

Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling

Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling Lili Zhou,* Yingjian Li, Dong Zhou, Roderick J. Tan, and Youhua Liu* *Division of Nephrology, Nanfang Hospital, Southern

More information

Niki Prakoura. Calreticulin upregulation in renal fibrosis

Niki Prakoura. Calreticulin upregulation in renal fibrosis Calreticulin upregulation in renal fibrosis Niki Prakoura Section of Histology, Center of Basic Research, Biomedical Research Foundation of the Academy of Athens, Athens, Greece EuroKUP meeting, Madrid,

More information

Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats

Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Summary of Doctoral Thesis Hidenori Yasuda Graduate School of Veterinary

More information

PhD THESIS Epigenetic mechanisms involved in stem cell differentiation

PhD THESIS Epigenetic mechanisms involved in stem cell differentiation Romanian Academy Institute of Cellular Biology and Pathology "Nicolae Simionescu" PhD THESIS Epigenetic mechanisms involved in stem cell differentiation Coordinator: Acad. Maya Simionescu PhD Student:

More information

Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity

Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae

More information

Bone Morphogenetic Protein-7 Improves Renal Fibrosis and Accelerates the Return of Renal Function

Bone Morphogenetic Protein-7 Improves Renal Fibrosis and Accelerates the Return of Renal Function J Am Soc Nephrol 13: S14 S21, 2002 Bone Morphogenetic Protein-7 Improves Renal Fibrosis and Accelerates the Return of Renal Function JEREMIAH MORRISSEY,* KEITH HRUSKA,* GUANGJIE GUO,* SONG WANG,* QING

More information

Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury

Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting protein3) regulate autophagy and mitophagy in renal tubular cells in acute kidney injury by Masayuki Ishihara 1, Madoka Urushido 2, Kazu Hamada

More information

BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice

BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice SUPPLEMENTARY MATERIALS BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice Elena Corradini, Paul J. Schmidt, Delphine Meynard, Cinzia Garuti, Giuliana

More information

Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice

Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice J Am Soc Nephrol 13: 2464 2477, 2002 Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice JUNWEI YANG, CHUNSUN DAI, and YOUHUA

More information

Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with

Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).

More information

Supplementary Materials:

Supplementary Materials: Supplementary Materials: Supplemental Figure 1: Profibrotic markers in wt/wt or ex/ex mouse kidneys 42 days post IRI. The levels of fibronectin and αsma were examined by immunostaining in ADAM17 wt/wt

More information

Downregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral

Downregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral Supplementary Information Downregulation of angiotensin type 1 receptor and nuclear factor-κb by sirtuin 1 contributes to renoprotection in unilateral ureteral obstruction Shao-Yu Yang 1,2, Shuei-Liong

More information

Stem Cells and The Endometrium. Director, Division of Reproductive Endocrinology and infertility

Stem Cells and The Endometrium. Director, Division of Reproductive Endocrinology and infertility Stem Cells and The Endometrium Hugh S. Taylor, M.D. Director, Division of Reproductive Endocrinology and infertility Nothing to disclose Stem Cells Cells that are capable of both self-renewal and have

More information

Eukaryotic transcription (III)

Eukaryotic transcription (III) Eukaryotic transcription (III) 1. Chromosome and chromatin structure Chromatin, chromatid, and chromosome chromatin Genomes exist as chromatins before or after cell division (interphase) but as chromatids

More information

Mesenchymal progenitor cells in intramuscular connective tissue development

Mesenchymal progenitor cells in intramuscular connective tissue development Mesenchymal progenitor cells in intramuscular connective tissue development Min Du, Ph.D. Professor and Endowed Chair Department of Animal Sciences Washington State University Pullman, WA Beef Quality:

More information

Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal

Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal BRIEF COMMUNICATION www.jasn.org Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal Transition Elisabeth M. Zeisberg,* Scott E. Potenta,* Hikaru Sugimoto,* Michael Zeisberg,* and Raghu

More information

Supporting Information

Supporting Information Supporting Information Palmisano et al. 10.1073/pnas.1202174109 Fig. S1. Expression of different transgenes, driven by either viral or human promoters, is up-regulated by amino acid starvation. (A) Quantification

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Original Article BMP-7 attenuates liver fibrosis via regulation of epidermal growth factor receptor

Original Article BMP-7 attenuates liver fibrosis via regulation of epidermal growth factor receptor Int J Clin Exp Pathol 2014;7(7):3537-3547 www.ijcep.com /ISSN:1936-2625/IJCEP0000537 Original Article BMP-7 attenuates liver fibrosis via regulation of epidermal growth factor receptor Li-Ping Wang 1*,

More information

Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis

Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis Na Liu,* Jian-Kan Guo, Maoyin Pang, Evelyn Tolbert, Murugavel Ponnusamy, Rujun Gong, George Bayliss, Lance D. Dworkin, Haidong Yan,* and

More information

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate

More information

HDAC1 Inhibitor Screening Assay Kit

HDAC1 Inhibitor Screening Assay Kit HDAC1 Inhibitor Screening Assay Kit Catalog Number KA1320 96 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 Principle of the Assay...

More information

Abstract. Introduction

Abstract. Introduction Blocking the Class I Histone Deacetylase Ameliorates Renal Fibrosis and Inhibits Renal Fibroblast Activation via Modulating TGF-Beta and EGFR Signaling Na Liu 1,2, Song He 2,3,LiMa 2, Murugavel Ponnusamy

More information

Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)

Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained

More information

Supporting Information

Supporting Information Supporting Information M1 macrophage-derived nanovesicles potentiate the anticancer efficacy of immune checkpoint inhibitors Yeon Woong Choo, 1, Mikyung Kang, 2, Han Young Kim, 1 Jin Han, 1 Seokyung Kang,

More information

Journal Club Semmler Lorenz

Journal Club Semmler Lorenz Beer et al. 2015 - Analysis of the Secretome of Apoptotic Peripheral Blood Mononuclear Cells: Impact of Released Proteins and Exosomes for Tissue Regeneration Journal Club 13.11.2017 1 Introduction to

More information

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and

More information

Partial Nephrectomy: Does Ischemia Matter?

Partial Nephrectomy: Does Ischemia Matter? Partial Nephrectomy: Does Ischemia Matter? Karim Touijer, MD, MPH Attending Surgeon Memorial Sloan-Kettering Cancer Center Associate Professor of Urology Weill Cornell Medical College, New York No disclosures

More information

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1 PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:

More information

The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells

The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells 1 SUPPLEMENTARY INFORMATION The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells Karin Loser 1,2,6, Thomas Vogl 2,3, Maik Voskort 1, Aloys

More information

renoprotection therapy goals 208, 209

renoprotection therapy goals 208, 209 Subject Index Aldosterone, plasminogen activator inhibitor-1 induction 163, 164, 168 Aminopeptidases angiotensin II processing 64 66, 214 diabetic expression 214, 215 Angiotensin I intrarenal compartmentalization

More information

As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the

As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the 3 RESULTS As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the DKFZ in Heidelberg (Dept. of Cellular and Molecular pathology) contributed to this work by performing

More information

Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation

Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation indicated by the detection of -SMA and COL1 (log scale).

More information

Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance

Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance Matthew R. Weir, MD Professor and Director Division of Nephrology University of Maryland School of Medicine Overview Introduction Mechanisms

More information

Amniotic fluid stem cells provide considerable advantages in epidermal. regeneration: B7H4 creates a moderate inflammation

Amniotic fluid stem cells provide considerable advantages in epidermal. regeneration: B7H4 creates a moderate inflammation Amniotic fluid stem cells provide considerable advantages in epidermal regeneration: B7H4 creates a moderate inflammation microenvironment to promote wound repair Qing Sun 1, +, Fang Li 1, +, Hong Li 2,

More information

Uncovering the mechanisms of wound healing and fibrosis

Uncovering the mechanisms of wound healing and fibrosis Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:

More information

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan

More information

TITLE: Inhibitors of Histone Deacetylases for Radiosensitization of Prostate Cancer

TITLE: Inhibitors of Histone Deacetylases for Radiosensitization of Prostate Cancer AD Award Number: W81XWH-04-1-0170 TITLE: Inhibitors of Histone Deacetylases for Radiosensitization of Prostate Cancer PRINCIPAL INVESTIGATOR: Mira O. Jung, Ph.D. CONTRACTING ORGANIZATION: Georgetown University

More information

Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress

Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress 3/1/212 Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies K.R. Stenmark University of Colorado Denver, CO 845 Prominent Fibroproliferative

More information

Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients

Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients S. Yang, B. Chen, J. Shi, F. Chen, J. Zhang and Z. Sun Department of Nephrology, Huaihe Hospital

More information

Immunological Lung Diseases

Immunological Lung Diseases Emphysema and Fibrosis Universitätsklinik für Pneumologie Prof. Thomas Geiser Head Div. of Pulmonary Medicine and Laboratory of Lung Research, MU50 thomas.geiser@insel.ch The healthy lung: The pathway

More information

Chapter 4. Estrogen receptor expression in human macrophages

Chapter 4. Estrogen receptor expression in human macrophages Chapter 4 Estrogen receptor expression in human macrophages 4.1. Introduction Macrophages respond to estrogen present in their microenvironment and hence should express functional estrogen receptors unless

More information

hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This

hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed

More information

Journal Club. 03/04/2012 Lama Nazzal

Journal Club. 03/04/2012 Lama Nazzal Journal Club 03/04/2012 Lama Nazzal NOTCH and the kidneys Is an evolutionarily conserved cell cell communication mechanism. Is a regulator of cell specification, differentiation, and tissue patterning.

More information

Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/-

Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.

More information

PROCHONDRIX CARTILAGE RESTORATION MATRIX CONTAINS GROWTH FACTORS NECESSARY FOR HYALINE CARTILAGE REGENERATION

PROCHONDRIX CARTILAGE RESTORATION MATRIX CONTAINS GROWTH FACTORS NECESSARY FOR HYALINE CARTILAGE REGENERATION A L L O S O U R C E PROCHONDRIX CARTILAGE RESTORATION MATRIX CONTAINS GROWTH FACTORS NECESSARY FOR HYALINE CARTILAGE REGENERATION Ryan Delaney MS; Carolyn Barrett BS, MBA; Peter Stevens PhD, MBA AlloSource,

More information

p = formed with HCI-001 p = Relative # of blood vessels that formed with HCI-002 Control Bevacizumab + 17AAG Bevacizumab 17AAG

p = formed with HCI-001 p = Relative # of blood vessels that formed with HCI-002 Control Bevacizumab + 17AAG Bevacizumab 17AAG A.. Relative # of ECs associated with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 ol b p < 0.001 Relative # of blood vessels that formed with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 l b p = 0.002 Control IHC:

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Kidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI

Kidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI a e Na V 1.5 Ad-LacZ Ad- 110KD b Scn5a/ (relative to Ad-LacZ) f 150 100 50 0 p = 0.65 Ad-LacZ Ad- c Heart Lung Kidney Spleen 110KD d fl/fl c -/- DAPI 20 µm Na v 1.5 250KD fl/fl Rabbit IgG DAPI fl/fl Mouse

More information

Research Article. KIM-1 as a biomarker to predict and diagnose Acute Kidney Injury (AKI)

Research Article. KIM-1 as a biomarker to predict and diagnose Acute Kidney Injury (AKI) Available online wwwjocprcom Journal of Chemical and Pharmaceutical Research, 216, 8(4):56-61 Research Article ISSN : 975-7384 CODEN(USA) : JCPRC5 KIM-1 as a biomarker to predict and diagnose Acute Kidney

More information

Probe. Hind III Q,!&#12?R'!! /0!!!!D1"?R'! vector. Homologous recombination

Probe. Hind III Q,!&#12?R'!! /0!!!!D1?R'! vector. Homologous recombination Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!&#1?R'!!

More information

Children's Hospital of Pittsburgh Annual Progress Report: 2008 Formula Grant

Children's Hospital of Pittsburgh Annual Progress Report: 2008 Formula Grant Children's Hospital of Pittsburgh Annual Progress Report: 2008 Formula Grant Reporting Period July 1, 2011 June 30, 2012 Formula Grant Overview The Children's Hospital of Pittsburgh received $958,038 in

More information

Novel therapeutic approach for kidney fibrosis

Novel therapeutic approach for kidney fibrosis University of Sydney Novel therapeutic approach for kidney fibrosis DAVID HARRIS 30/09/17 Westmead Hospital Cadnapaphornchai CJASN 2014;9:889 Liraglutide: Renal Outcomes Mann JFE et al. N Engl J Med 2017;377:839-848

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

Title: Intermedin attenuates renal fibrosis by induction of heme oxygenase-1 in rats with unilateral ureteral obstruction

Title: Intermedin attenuates renal fibrosis by induction of heme oxygenase-1 in rats with unilateral ureteral obstruction Author's response to reviews Title: Intermedin attenuates renal fibrosis by induction of heme oxygenase-1 in rats with unilateral ureteral obstruction Authors: Xi Qiao (qiaoxi7347@126.com) Lihua Wang (lihuawang236@126.com)

More information

Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention

Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention REVIEW J Am Soc Nephrol 15: 1 12, 2004 Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention YOUHUA LIU Division of Cellular

More information

Supplementary Figure 1 IL-27 IL

Supplementary Figure 1 IL-27 IL Tim-3 Supplementary Figure 1 Tc0 49.5 0.6 Tc1 63.5 0.84 Un 49.8 0.16 35.5 0.16 10 4 61.2 5.53 10 3 64.5 5.66 10 2 10 1 10 0 31 2.22 10 0 10 1 10 2 10 3 10 4 IL-10 28.2 1.69 IL-27 Supplementary Figure 1.

More information

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3

More information

Comparison of Cryopreserved Amniotic Membrane and Umbilical Cord Tissues for use in Foot and Ankle Reconstructive Procedures

Comparison of Cryopreserved Amniotic Membrane and Umbilical Cord Tissues for use in Foot and Ankle Reconstructive Procedures Comparison of Cryopreserved Amniotic Membrane and Umbilical Cord Tissues for use in Foot and Ankle Reconstructive Procedures Howard M. Kimmel 1, Ek Kia Tan 2, Hua He 2, Julie O Connell 3 1 Buckeye Foot

More information

Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway

Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway Jieyuan Zhang, Xiaolin Liu, Haiyan Li, Chunyuan Chen, Bin Hu, Xin Niu, Qing

More information

Discovery of a Small Molecule Inhibitor of the Wnt Pathway as a Potential Disease Modifying Treatment for Knee Osteoarthritis

Discovery of a Small Molecule Inhibitor of the Wnt Pathway as a Potential Disease Modifying Treatment for Knee Osteoarthritis Discovery of a Small Molecule Inhibitor of the Wnt Pathway as a Potential Disease Modifying Treatment for Knee Osteoarthritis Charlene Barroga, Ph.D., Yong Hu, Ph.D., Vishal Deshmukh, Ph.D., and John Hood,

More information

Hepatocyte growth factor (HGF) has recently emerged

Hepatocyte growth factor (HGF) has recently emerged A Novel Mechanism by which Hepatocyte Growth Factor Blocks Tubular Epithelial to Mesenchymal Transition Junwei Yang,* Chunsun Dai,* and Youhua Liu* *Division of Cellular and Molecular Pathology, Department

More information

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with

More information

Target Protein Antibody name Product number Manufacturer Species Epitope Dilution Aggrecan Anti-aggrecan AB1031 EMD Millipore Corp Rabbit

Target Protein Antibody name Product number Manufacturer Species Epitope Dilution Aggrecan Anti-aggrecan AB1031 EMD Millipore Corp Rabbit Family history Hypertension/ Maximum Degree of aortic Bicuspid Disease Age/Sex Diagnosed CTD of aortic disease Treated aortic insufficiency/stenosis aortic Aneurysm 63/M No Yes Yes/Yes diameter 59mm 1-2+/None

More information

Supplemental Information

Supplemental Information Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11095 Supplementary Table 1. Summary of the binding between Angptls and various Igdomain containing receptors as determined by flow cytometry analysis. The results were summarized from

More information

s u p p l e m e n ta ry i n f o r m at i o n

s u p p l e m e n ta ry i n f o r m at i o n Figure S1 Characterization of tet-off inducible cell lines expressing GFPprogerin and GFP-wt lamin A. a, Western blot analysis of GFP-progerin- or GFP-wt lamin A- expressing cells before induction (0d)

More information

TITLE: Hyaluronic acid is overexpressed in fibrotic lung tissue and promotes collagen expression

TITLE: Hyaluronic acid is overexpressed in fibrotic lung tissue and promotes collagen expression AD Award Number: W81XWH-07-1-0253 TITLE: Hyaluronic acid is overexpressed in fibrotic lung tissue and promotes collagen expression PRINCIPAL INVESTIGATOR: Pal Gooz, M.D. CONTRACTING ORGANIZATION: Medical

More information

Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment

Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure:

More information

2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications. DPP-4 Inhibition and Diabetic Nephropathy

2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications. DPP-4 Inhibition and Diabetic Nephropathy 2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications DPP-4 Inhibition and Diabetic Nephropathy Daisuke Koya Department of Diabetology & Endocrinology Kanazawa

More information

Supplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts

Supplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts Supplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts (TIG-3 cells) were rendered senescent by either serial passage

More information

Histone modifications in kidney disease

Histone modifications in kidney disease Histone modifications in kidney disease Masaomi Nangaku Division of Nephrology and Endocrinology The University of Tokyo Graduate School of Medicine Japan Mimura, Tanaka, & Nangaku. Semin Nephrol 2013

More information

Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma

Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma Pei-Song Gao, MD, PhD Division of Allergy & Clinical Immunology Johns Hopkins University School

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )

More information

SensoLyte 520 HDAC Activity Assay Kit *Fluorimetric*

SensoLyte 520 HDAC Activity Assay Kit *Fluorimetric* SensoLyte 520 HDAC Activity Assay Kit *Fluorimetric* Catalog # 72084 Kit Size 100 Assays (96-well plate) Optimized Performance: This kit is optimized to detect HDAC activity. Enhanced Value: It provides

More information

Prof. Sandrine Florquin Department of Pathology Academic Medical Center University of Amsterdam Amsterdam, The Netherlands. Slide 1.

Prof. Sandrine Florquin Department of Pathology Academic Medical Center University of Amsterdam Amsterdam, The Netherlands. Slide 1. Interleukin 17 in renal biopsies as risk factor for progression Sandrine Florquin, Amsterdam, The Netherlands Chairs: Mohamed R. Daha, Leiden, The Netherlands Pierre Ronco, Paris, France Prof. Sandrine

More information

Effective Targeting of Quiescent Chronic Myelogenous

Effective Targeting of Quiescent Chronic Myelogenous Cancer Cell, Volume 7 Supplemental Information Effective Targeting of Quiescent Chronic Myelogenous Leukemia Stem Cells by Histone Deacetylase Inhibitors in Combination with Imatinib Mesylate Bin Zhang,

More information

Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi

Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi Role of Vitamin D receptor (VDR) in HIV induced tubular injury Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi 07/10/2015 INTRODUCTION Vitamin D is technically not a Vitamin;

More information

BMP-7 fails to attenuate TGF-β1-induced epithelial-to-mesenchymal transition in human proximal tubule epithelial cells

BMP-7 fails to attenuate TGF-β1-induced epithelial-to-mesenchymal transition in human proximal tubule epithelial cells NDT Advance Access published December 4, 2008 Nephrol Dial Transplant (2008) 1 of 10 doi: 10.1093/ndt/gfn662 Original Article BMP-7 fails to attenuate TGF-β1-induced epithelial-to-mesenchymal transition

More information

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial Supplementary Information Häuselmann et al. Monocyte induction of E-selectin-mediated endothelial activation releases VE-cadherin junctions to promote tumor cell extravasation in the metastasis cascade

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

An oxygen-regulated switch in the protein synthesis machinery

An oxygen-regulated switch in the protein synthesis machinery An oxygen-regulated switch in the protein synthesis machinery 1 Inhibition of translation during acute hypoxia is mediated by eif2α phosphorilation mouse embryo fibroblasts (MEFs) 1 Watson et al., BIOLOGIA

More information

Effect of erythropoietin on the expression of dynamin-related protein-1 in rat renal interstitial fibrosis

Effect of erythropoietin on the expression of dynamin-related protein-1 in rat renal interstitial fibrosis EXPERIMENTAL AND THERAPEUTIC MEDICINE 9: 2065-2071, 2015 Effect of erythropoietin on the expression of dynamin-related protein-1 in rat renal interstitial fibrosis XIAN FENG ZHAO 1, YAN HONG LIU 2, ZI

More information

Supplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were

Supplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl

More information

EpiQuik Circulating Acetyl Histone H3K18 ELISA Kit (Colorimetric)

EpiQuik Circulating Acetyl Histone H3K18 ELISA Kit (Colorimetric) EpiQuik Circulating Acetyl Histone H3K18 ELISA Kit (Colorimetric) Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE Uses: The EpiQuik Circulating Acetyl Histone H3K18 ELISA Kit (Colorimetric)

More information

Total Histone H3 Acetylation Detection Fast Kit (Colorimetric)

Total Histone H3 Acetylation Detection Fast Kit (Colorimetric) Total Histone H3 Acetylation Detection Fast Kit (Colorimetric) Catalog Number KA1538 48 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use...

More information

Improved efficacy and in vivo cellular properties of human embryonic stem cell derivative

Improved efficacy and in vivo cellular properties of human embryonic stem cell derivative Supplementary Information Improved efficacy and in vivo cellular properties of human embryonic stem cell derivative in a preclinical model of bladder pain syndrome Aram Kim 1,11,, Hwan Yeul Yu 1,2,, Jisun

More information

Tissue repair. (3&4 of 4)

Tissue repair. (3&4 of 4) Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid

More information

SUPPLEMENTAL MATERIAL. Supplementary Methods

SUPPLEMENTAL MATERIAL. Supplementary Methods SUPPLEMENTAL MATERIAL Supplementary Methods Culture of cardiomyocytes, fibroblasts and cardiac microvascular endothelial cells The isolation and culturing of neonatal rat ventricular cardiomyocytes was

More information

Cardioprotection by endogenous fibroblast growth factor 2 in cardiac ischemia-reperfusion injury in vivo

Cardioprotection by endogenous fibroblast growth factor 2 in cardiac ischemia-reperfusion injury in vivo Washington University School of Medicine Digital Commons@Becker Conference Abstracts and Posters Division of Emergency Medicine/Emergency Care Research Section 2011 Cardioprotection by endogenous fibroblast

More information

Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice

Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice Supplementary Methods: Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice and gently meshed in DMEM containing 10% FBS to prepare for single cell suspensions. CD4 + CD25

More information