Non-clinical efficacy

Size: px
Start display at page:

Download "Non-clinical efficacy"

Transcription

1 Non-clinical efficacy 1 st Workshop -Novel Compounds from Renewable Sources David Pereira, Patrícia Valentão, Paula B. Andrade dpereira@ff.up.pt Context The Natural Products Group develops its scientific activities in the chemistry-biology interface. Context 1

2 Context INFLAMMATION CANCER DIABETES NEUROPROTECTION Cell-free - Cell-free - Morphology Morphology Morphology mrna levels mrna levels mrna levels CELL LINES Protein expression Protein expression Protein expression Enzyme activity Enzyme activity Enzyme activity Context A complex biological response of body tissues to harmful stimuli, such as pathogens, damaged cells, or irritants. 2

3 The many faces of inflammation Trauma Skin inflammation(e.g. contact dermatitis, fibrosis) Psoriasis Osteoarthritis Liver fibrosis Lung inflammation Delayed type hypersensitivity(dth) Peritonitis Sepsis Acute asthma Chronic asthma Arachidonic acid metabolism n-hydroperoxyeicosatetraenoicacid (HPETs) n-hydroxyeicosatetraenoicacid (HETEs) 3

4 Arachidonic acid metabolism n-hydroperoxyeicosatetraenoicacid (HPETs) n-hydroxyeicosatetraenoicacid (HETEs) Cell lines Anti-inflammatory in anti-inflammatory research research RAW Mouse leukaemic monocyte-macrophage Control LPS 1 µg/ml 4

5 Cell lines Anti-inflammatory in anti-inflammatory research research RAW Control LPS 1 µg/ml Cell Anti-inflammatory lines in anti-inflammatory research research Toll-like receptors vs ROS Nature Immunology 6, (2005) 5

6 Cell Anti-inflammatory lines in anti-inflammatory research research Toll-like receptors vs ROS Control LPS 1 µg/ml Cell Anti-inflammatory lines in anti-inflammatory research research 6

7 Anti-inflammatory research IκB-α NF-κB Pathway p50 p65 IKK P P IκB-α Proteasomal degradation p50 p65 TXA 2 p50 p65 COX-2 inos PGH 2 PGI 2 NO IL-6 PGE 2 TNF-α Cell lines Anti-inflammatory in anti-inflammatory research research DNA RNA Proteins RT-PCR Western Blot inos 130 kd COX-2 72 kd IKB-α 30 kd β-tubulin 55 kd 7

8 Case studies study Cancer Genetic disease, highly regulated Rising incidence& prevalence 2008: 7.8 million deaths. Changes in metabolism& gene expression Treatment: Proliferation Protein kinases Microtubules Angiogenesis APOPTOSIS? Cancer 8

9 Cancer Cancer Cancer 9

10 Cancer Cancer 10

11 Control Ext PA Combination Control Ext PA Combination Cancer Diabetes Diabetes 11

12 Diabetes Diabetes Diabetes α-glucosidase inhibitors α-amylase inhibitors α-amylase Diabetes 12

13 Myrcia spp. 280 nm 350 nm Diabetes Diabetes 13

14 Diabetes 14

15 15

16 Solanum lycopersicum 16

17 SH-SY5Y Human neuroblastoma cell line 17

18 Calls: present & future Funding Calls: present & future FUNDING OPPORTUNITIES DISCOVERY RESEARCH and DEVELOPMENT FET Open research and innovation actions Funding 18

19 Faculdade de Ciências, Universidade do Porto Departamento de Química, Universidade do Minho Faculdade de Ciências e Tecnologias, Universidade do Algarve Tecnologia Farmacêutica, Faculdade de Farmácia da Universidade de Coimbra Laboratório de Farmacognosia, Faculdade de Farmácia da Universidade de Lisboa CSIC, Murcia, Espanha Université de Montpellier, Institut desbiomolécules Max Mousseron IBMM, France Department of Biology, University of Basilicata, Itália Departamento dequímicaanalítica yalimentaria, Facultad de Ciencias, Universidade de Vigo, Espanha Heinrich Heine Universitat, Institute of Pharmaceutical Biology, Dusseldorf, Alemanha 19

TD-BF01: Innate immunity to microorganisms

TD-BF01: Innate immunity to microorganisms TD-BF01: Innate immunity to microorganisms I. Toll receptors (adapted from Takeuchi, O. et al. (1999) Immunity 11:443; Kawai, T. et al. (1999) Immunity 11:115; Hemmi, H. et al. (2000) Nature 408:740; Muzio,

More information

SUPPLEMENTARY FIGURES AND TABLES

SUPPLEMENTARY FIGURES AND TABLES SUPPLEMENTARY FIGURES AND TABLES Supplementary Figure S1: CaSR expression in neuroblastoma models. A. Proteins were isolated from three neuroblastoma cell lines and from the liver metastasis of a MYCN-non

More information

Page 39 of 44. 8h LTA & AT h PepG & AT h LTA

Page 39 of 44. 8h LTA & AT h PepG & AT h LTA Page 39 of 44 Fig. S1 A: B: C: D: 8h LTA 8h LTA & AT7519 E: F: 8h PepG G: 8h PepG & AT7519 Fig. S1. AT7519 overrides the survival effects of lipoteichoic acid (LTA) and peptidoglycan (PepG). (A) Human

More information

Plasma exposure levels from individual mice 4 hours post IP administration at the

Plasma exposure levels from individual mice 4 hours post IP administration at the Supplemental Figure Legends Figure S1. Plasma exposure levels of MKC-3946 in mice. Plasma exposure levels from individual mice 4 hours post IP administration at the indicated dose mg/kg. Data represent

More information

Virchow s Hypothesis lymphorecticular infiltration of cancer reflected the origin of cancer at sites of inflammation

Virchow s Hypothesis lymphorecticular infiltration of cancer reflected the origin of cancer at sites of inflammation Virchow s Hypothesis 1863 lymphorecticular infiltration of cancer reflected the origin of cancer at sites of inflammation Barrett s esophagus/ Esophageal adenocarcinoma PSC / Cholangiocarcinoma Viral hepatitis

More information

Stewart et al. CD36 ligands promote sterile inflammation through assembly of a TLR 4 and 6 heterodimer

Stewart et al. CD36 ligands promote sterile inflammation through assembly of a TLR 4 and 6 heterodimer NFκB (fold induction) Stewart et al. ligands promote sterile inflammation through assembly of a TLR 4 and 6 heterodimer a. mrna (fold induction) 5 4 3 2 1 LDL oxldl Gro1a MIP-2 RANTES mrna (fold induction)

More information

Nutrition and Age-Associated Inflammation :Role of Nutritional Intervention Simin Nikbin Meydani, DVM, PhD.

Nutrition and Age-Associated Inflammation :Role of Nutritional Intervention Simin Nikbin Meydani, DVM, PhD. Nutrition and Age-Associated Inflammation :Role of Nutritional Intervention Simin Nikbin Meydani, DVM, PhD simin.meydani@tufts.edu Outline 1) Role of immune and inflammatory responses in age-related diseases

More information

Figure S1 Genetic or pharmacologic COX-2 inhibition led to increased kidney

Figure S1 Genetic or pharmacologic COX-2 inhibition led to increased kidney SUPPLEMENTAL FIGURE LEGENDS Figure S1 Genetic or pharmacologic COX-2 inhibition led to increased kidney macrophage infiltration. Wild type or COX-2 -/- mice (2 months old, C57/Bl6 background) were treated

More information

Supporting Information

Supporting Information Supporting Information Natural small molecule FMHM inhibits lipopolysaccharide-induced inflammatory response by promoting TRAF6 degradation via K48-linked polyubiquitination Ke-Wu Zeng 1, Li-Xi Liao 1,

More information

Inflammation in OA. Osteoarthritis. Crystals found in synovial fluid. Calcium-containing crystals in OA 10/28/2013. I have no disclosures

Inflammation in OA. Osteoarthritis. Crystals found in synovial fluid. Calcium-containing crystals in OA 10/28/2013. I have no disclosures Dublin Academic Medical Centre Dublin Academic Medical Centre How Do Calcium Crystals Induce Inflammation and Contribute to Osteoarthritis I have no disclosures Geraldine McCarthy MD, FRCPI Clinical Professor

More information

NFκB What is it and What s the deal with radicals?

NFκB What is it and What s the deal with radicals? The Virtual Free Radical School NFκB What is it and What s the deal with radicals? Emily Ho, Ph.D Linus Pauling Institute Scientist Department of Nutrition and Food Management Oregon State University 117

More information

fig. S1 Gene silencing of LC3B by sirna enhances IL-1β secretion. Peritoneal

fig. S1 Gene silencing of LC3B by sirna enhances IL-1β secretion. Peritoneal 15 Scramble sirna LC3B sirna IL-1β (pg/ml) 1 5 LC3B (kda) - 18 (LC3B I) - 16 (LC3B II) β-actin - 42 ( _ ) LPS LPS ATP fig. S1 Gene silencing of LC3B by sirna enhances IL-1β secretion. Peritoneal macrophages

More information

Intracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation

Intracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining Btk activation Xingguang Liu, Zhenzhen Zhan, Dong Li, Li Xu, Feng Ma, Peng Zhang, Hangping Yao and Xuetao

More information

Innate Immunity. Chapter 3. Connection Between Innate and Adaptive Immunity. Know Differences and Provide Examples. Antimicrobial peptide psoriasin

Innate Immunity. Chapter 3. Connection Between Innate and Adaptive Immunity. Know Differences and Provide Examples. Antimicrobial peptide psoriasin Chapter Know Differences and Provide Examples Innate Immunity kin and Epithelial Barriers Antimicrobial peptide psoriasin -Activity against Gram (-) E. coli Connection Between Innate and Adaptive Immunity

More information

Materials and Methods

Materials and Methods Short term hyperthermia prevents activation of proinflammatory genes in type B synoviocytes by blocking the activation of the transcription factor NF-κB Marica Markovic Institute of Medical Biochemistry,

More information

Crucial role for human Toll-like receptor 4 in the development of contact allergy to nickel

Crucial role for human Toll-like receptor 4 in the development of contact allergy to nickel Supplementary Figures 1-8 Crucial role for human Toll-like receptor 4 in the development of contact allergy to nickel Marc Schmidt 1,2, Badrinarayanan Raghavan 1,2, Verena Müller 1,2, Thomas Vogl 3, György

More information

Bhatnagar et al, 2010 Cell Death and Disease Manuscript # CDDIS T

Bhatnagar et al, 2010 Cell Death and Disease Manuscript # CDDIS T Bhatnagar et al, Cell Death and Disease Manuscript # CDDIS--98-T Supplemental Materials. Supplemental Figure Legends Supplemental Figure (A) WPE-NA and WPE-NB6 cells were treated with 4 nm of Docetaxel

More information

a. b. c. d. e. f. g. h. i. j. k. l. m. n. o. p.

a. b. c. d. e. f. g. h. i. j. k. l. m. n. o. p. a. b. c. d. e. f. g. h. i. j. k. l. 2.5 2 1.5 1.5 IL-1β 12 8 6 4 2 IL-1β 9 8 7 6 4 3 3 2.9 IL-1β m. n. o. p. 1.8 1.6 1.4 1.2 1.8.6.4.2 6h LPS 2 15 1 5 6h LPS 2 6h LPS 6 4 3 6h LPS Supplementary Figure

More information

INFLAMMATION & REPAIR

INFLAMMATION & REPAIR INFLAMMATION & REPAIR Lecture 7 Chemical Mediators of Inflammation Winter 2013 Chelsea Martin Special thanks to Drs. Hanna and Forzan Course Outline i. Inflammation: Introduction and generalities (lecture

More information

MicroRNAs Modulate the Noncanonical NF- B Pathway by Regulating IKK Expression During Macrophage Differentiation

MicroRNAs Modulate the Noncanonical NF- B Pathway by Regulating IKK Expression During Macrophage Differentiation MicroRNAs Modulate the Noncanonical NF- B Pathway by Regulating IKK Expression During Macrophage Differentiation Tao Li 1 *, Michael J. Morgan 1 *, Swati Choksi 1, Yan Zhang 1, You-Sun Kim 2#, Zheng-gang

More information

- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml)

- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml) Supplementary Table ST1: The dynamic effect of LPS on IL-6 production in monocytes and THP-1 cells after GdA treatment. Monocytes, THP-1 cells and macrophages (5x10 5 ) were incubated with 10 μg/ml of

More information

Integrin CD11b negatively regulates TLR-triggered inflammatory responses by. activating Syk and promoting MyD88 and TRIF degradation via cbl-b

Integrin CD11b negatively regulates TLR-triggered inflammatory responses by. activating Syk and promoting MyD88 and TRIF degradation via cbl-b Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting MyD88 and TRIF degradation via cbl-b Chaofeng Han, Jing Jin, Sheng Xu, Haibo Liu, Nan Li, and Xuetao

More information

Genotoxic and inflammatory responses of human bronchial epithelial cells to diesel and biodiesel exhaust.

Genotoxic and inflammatory responses of human bronchial epithelial cells to diesel and biodiesel exhaust. Genotoxic and inflammatory responses of human bronchial epithelial cells to diesel and biodiesel exhaust. Ian WH Jarvis Research Associate, King s College London Background There is an increasing application

More information

Vadim Ivanov, M.D., Ph.D. Micronutrients in controlling INFLAMMATION Webinar June 12, 2012

Vadim Ivanov, M.D., Ph.D. Micronutrients in controlling INFLAMMATION Webinar June 12, 2012 Vadim Ivanov, M.D., Ph.D. Micronutrients in controlling INFLAMMATION Webinar June 12, 2012 1. What is Inflammation? 2. Acute and Chronic Inflammation 3. Role of Chronic Inflammation in Modern Human Diseases

More information

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β

More information

Understanding the mechanisms of asbestos related diseases

Understanding the mechanisms of asbestos related diseases University of Hawai i Cancer Center Understanding the mechanisms of asbestos related diseases Haining Yang, PhD Professor University of Hawai i Cancer Center Marker of exposure: Bilateral pleural plaques

More information

Inflammation and extracellular proteinases

Inflammation and extracellular proteinases Inflammation and extracellular proteinases Plaque rupture 75% of MI (heart attack) Foamy macrophages Thin cap No collagen Thin fibrous cap (

More information

LPS LPS P6 - + Supplementary Fig. 1.

LPS LPS P6 - + Supplementary Fig. 1. P6 LPS - - - + + + - LPS + + - - P6 + Supplementary Fig. 1. Pharmacological inhibition of the JAK/STAT blocks LPS-induced HMGB1 nuclear translocation. RAW 267.4 cells were stimulated with LPS in the absence

More information

Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell

Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Wenxin Li Department of Biological Sciences Fordham University Abstract MEFV is a human gene that codes for an

More information

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null

More information

Biomarkers of inflammation in human nutrition studies

Biomarkers of inflammation in human nutrition studies NIHR Southampton Biomedical Research Centre in nutrition Biomarkers of inflammation in human nutrition studies Philip Calder Professor of Nutritional Immunology University of Southampton The NIHR Southampton

More information

Synthesis and Biological Evaluation of Protein Kinase D Inhibitors

Synthesis and Biological Evaluation of Protein Kinase D Inhibitors Synthesis and Biological Evaluation of Protein Kinase D Inhibitors Celeste Alverez Topic Seminar October 26, 2013 Celeste Alverez @ Wipf Group 10/26/2013 1 Protein Kinase D (PKD) A novel family of serine/threonine

More information

Microglia preconditioning (priming) in central nervous system pathologies

Microglia preconditioning (priming) in central nervous system pathologies Microglia preconditioning (priming) in central nervous system pathologies Florence Perrin florence.perrin@umontpellier.fr Montpellier, October 2018 1 Spanish anatomists Glia = glue in Greek Santiago Ramon

More information

Doctoral Degree Program in Marine Biotechnology, College of Marine Sciences, Doctoral Degree Program in Marine Biotechnology, Academia Sinica, Taipei,

Doctoral Degree Program in Marine Biotechnology, College of Marine Sciences, Doctoral Degree Program in Marine Biotechnology, Academia Sinica, Taipei, Cyclooxygenase 2 facilitates dengue virus replication and serves as a potential target for developing antiviral agents Chun-Kuang Lin 1,2, Chin-Kai Tseng 3,4, Yu-Hsuan Wu 3,4, Chih-Chuang Liaw 1,5, Chun-

More information

Supplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al

Supplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al Supplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al Suppl. Fig. 1 Tissue DN C Proteins kd TSC1-17 TSC 1 loxp bp -48-285 ctin PEMs Neutrophils

More information

p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO

p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO Supplementary Information p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO Yuri Shibata, Masaaki Oyama, Hiroko Kozuka-Hata, Xiao Han, Yuetsu Tanaka,

More information

Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration

Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration The Harvard community has made this article openly available. Please

More information

Effect of cystathionine-gamma-lyase gene silencing with sirna on inflammation in acute pancreatitis

Effect of cystathionine-gamma-lyase gene silencing with sirna on inflammation in acute pancreatitis I Effect of cystathionine-gamma-lyase gene silencing with sirna on inflammation in acute pancreatitis A thesis submitted at University of Otago, Christchurch for the degree of Doctor of Philosophy 2015

More information

Quantitative Real-Time PCR was performed as same as Materials and Methods.

Quantitative Real-Time PCR was performed as same as Materials and Methods. Supplemental Material Quantitative Real-Time PCR Quantitative Real-Time PCR was performed as same as Materials and Methods. Expression levels in the aorta were normalized to peptidylprolyl isomerase B

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/4/199/ra75/dc1 Supplementary Materials for Signaling by the Matrix Proteoglycan Decorin Controls Inflammation and Cancer Through PDCD4 and MicroRNA-21 Rosetta

More information

Insight into cancer research from discovery to validation

Insight into cancer research from discovery to validation Insight into cancer research from discovery to validation 1 Exosomes in cancer research: from exosome isolation to biomarker discovery Zheng Songyue, PhD Technical Sales Specialists Life Technologies The

More information

Analysis of the binding site of α S1 -casein to its cellular receptor TLR4 by selective inhibitors and microscale thermophoresis

Analysis of the binding site of α S1 -casein to its cellular receptor TLR4 by selective inhibitors and microscale thermophoresis Analysis of the binding site of α S1 -casein to its cellular receptor TLR4 by selective inhibitors and microscale thermophoresis Thorsten Saenger 1, *, Stefan Vordenbäumen 2, Swetlana Genich 1, Samer Haidar

More information

Pharmacologyonline 3: (2006)

Pharmacologyonline 3: (2006) MANGIFERA INDICA L. EXTRACT MODULATES NF-KAPPAB SIGNALING PATHWAY IN THE COURSE OF ACTIVATION-INDUCED T CELL DEATH Patricia Hernandez 1,2, Pedro C. Rodriguez 1, Rene Delgado 1 1 Department of Biomedical

More information

Inhibitory Effect of Methotrexate on Rheumatoid Arthritis Inflammation and Comprehensive Metabolomics Analysis Using UPLC-Q/TOF-MS

Inhibitory Effect of Methotrexate on Rheumatoid Arthritis Inflammation and Comprehensive Metabolomics Analysis Using UPLC-Q/TOF-MS SUPPLEMENTARY MATERIALS Inhibitory Effect of Methotrexate on Rheumatoid Arthritis Inflammation and Comprehensive Metabolomics Analysis Using UPLC-Q/TOF-MS Zhiqiang Pang 1, Guoqiang Wang 1, Nan Ran 1, Hongqiang

More information

1 st Workshop - Novel Compounds from Renewable Sources. Drug Discovery

1 st Workshop - Novel Compounds from Renewable Sources. Drug Discovery from Renewable Drug Discovery Romeu A. Videira, Fátima Fernandes, Patrícia Valentão, Andreia P. Oliveira, M. Figueiredo González, João Bernardo, Daniela Correia, Rui Gonçalves, David M. Pereira, Paula

More information

IMO-8400, a novel TLR7, TLR8 and TLR9 antagonist, psoriasis

IMO-8400, a novel TLR7, TLR8 and TLR9 antagonist, psoriasis IMO-8400, a novel TLR7, TLR8 and TLR9 antagonist, inhibits disease development in mouse models of psoriasis Weiwen e Ja Jiang, Fu-Gang Zhu, Dong Yu, Ekambar R. Kandimalla, a a, Nicola La Monica, and Sudhir

More information

William C. Comb, Jessica E. Hutti, Patricia Cogswell, Lewis C. Cantley, and Albert S. Baldwin

William C. Comb, Jessica E. Hutti, Patricia Cogswell, Lewis C. Cantley, and Albert S. Baldwin Molecular Cell, Volume 45 Supplemental Information p85 SH2 Domain Phosphorylation by IKK Promotes Feedback Inhibition of PI3K and Akt in Response to Cellular Starvation William C. Comb, Jessica E. Hutti,

More information

D2 inhibits TLR2- initiated 12p40 transcription (-) TLR2 PGN MDP. MyD88 IRAK ECSIT TRAF6 NIK. Smallest unit of PGN muramyl dipeptide IKK.

D2 inhibits TLR2- initiated 12p40 transcription (-) TLR2 PGN MDP. MyD88 IRAK ECSIT TRAF6 NIK. Smallest unit of PGN muramyl dipeptide IKK. D2 inhibits TLR2- initiated 12p40 transcription CARD CARD NOD2 LRR RICK/Rip2 NIK MDP TRAF6 PGN TLR2 MyD88 IRAK ECSIT (-) IKK Smallest unit of PGN muramyl dipeptide IκB NF-κB atanabe et al, 2004 NF-κB IL-12p40

More information

Supporting Information

Supporting Information Supporting Information Desnues et al. 10.1073/pnas.1314121111 SI Materials and Methods Mice. Toll-like receptor (TLR)8 / and TLR9 / mice were generated as described previously (1, 2). TLR9 / mice were

More information

Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was

Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin

More information

Involvement of n-3 PUFA-derived lipid mediators in the resolution of brain inflammation

Involvement of n-3 PUFA-derived lipid mediators in the resolution of brain inflammation The 1 th Nutrition-Neuroscience meeting The 27 th of march 217 Involvement of n-3 PUFA-derived lipid mediators in the resolution of brain inflammation Charlotte Rey- PhD student Acute inflammatory response

More information

Index. Index 439. Aequorin, 84, 94 Affinity precipitation, 372, AP-1, 100 Asthma, 170, 305

Index. Index 439. Aequorin, 84, 94 Affinity precipitation, 372, AP-1, 100 Asthma, 170, 305 Index 439 Index A Aequorin, 84, 94 Affinity precipitation, 372, 376 381 AP-1, 100 Asthma, 170, 305 B Bioassay, 185, comparison with ELISA, 318 GM-CSF bioassay, 351 IL-2 bioassay, 185 192, 300 IL-3 IL-6

More information

number Done by Corrected by Doctor

number Done by Corrected by Doctor number 9 Done by Corrected by Doctor 1 Cellular Infiltration The movement of cells from their original region to a new region is called cellular infiltration. In our case, this applies to the cells that

More information

Research progress on the use of estrogen receptor agonist for treatment of spinal cord injury

Research progress on the use of estrogen receptor agonist for treatment of spinal cord injury Research progress on the use of estrogen receptor agonist for treatment of spinal cord injury Swapan K. Ray, PhD Professor, Department of Pathology, Microbiology, and Immunology USC School of Medicine,

More information

Innate Immunity. Connection Between Innate and Adaptive Immunity. Know Differences and Provide Examples Chapter 3. Antimicrobial peptide psoriasin

Innate Immunity. Connection Between Innate and Adaptive Immunity. Know Differences and Provide Examples Chapter 3. Antimicrobial peptide psoriasin Know Differences and Provide Examples Chapter * Innate Immunity * kin and Epithelial Barriers * Antimicrobial peptide psoriasin -Activity against Gram (-) E. coli Connection Between Innate and Adaptive

More information

Reduction of metastatic and angiogenic potency of malignant cancer by Eupatorium. fortunei via suppression of MMP-9 activity and VEGF production

Reduction of metastatic and angiogenic potency of malignant cancer by Eupatorium. fortunei via suppression of MMP-9 activity and VEGF production Supplementary Information Reduction of metastatic and angiogenic potency of malignant cancer by Eupatorium fortunei via suppression of MMP-9 activity and VEGF production Aeyung Kim, Minju Im, Nam-Hui Yim

More information

Cutaneous Immunology: Innate Immune Responses. Skin Biology Lecture Series

Cutaneous Immunology: Innate Immune Responses. Skin Biology Lecture Series Cutaneous Immunology: Innate Immune Responses Skin Biology Lecture Series The Immune Response: Innate and Adaptive Components Source: Wolff, Goldsmith, Katz, Gilchrest, Paller, Leffell. Fitzpatrick s Dermatology

More information

Supplementary information to: Mechanism of lipopolysaccharide-induced skin edema formation in the mouse

Supplementary information to: Mechanism of lipopolysaccharide-induced skin edema formation in the mouse Supplementary information to: Mechanism of lipopolysaccharide-induced skin edema formation in the mouse Ivan Zanoni*, Renato Ostuni*, Simona Barresi, Marco Di Gioia, Achille Broggi, Barbara Costa, Roberta

More information

Innate immune regulation of T-helper (Th) cell homeostasis in the intestine

Innate immune regulation of T-helper (Th) cell homeostasis in the intestine Innate immune regulation of T-helper (Th) cell homeostasis in the intestine Masayuki Fukata, MD, Ph.D. Research Scientist II Division of Gastroenterology, Department of Medicine, F. Widjaja Foundation,

More information

Modulating the inflammatory properties of activated microglia with Docosahexaenoic acid and Aspirin

Modulating the inflammatory properties of activated microglia with Docosahexaenoic acid and Aspirin Pettit et al. Lipids in Health and Disease 213, 12:16 RESEARCH Open Access Modulating the inflammatory properties of activated microglia with Docosahexaenoic acid and Aspirin Lauren K Pettit 1, Christopher

More information

Supplementary Figure 1:

Supplementary Figure 1: Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas

More information

c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.

c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p. a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8

More information

Bisphenol A alters transcript levels of biomarker genes for Major Depressive Disorder

Bisphenol A alters transcript levels of biomarker genes for Major Depressive Disorder II International Health Congress Gaia-Porto 19 th -21 st November 2015 Bisphenol A alters transcript levels of biomarker genes for Major Depressive Disorder Edna Ribeiro-Varandas *1,2, H. Sofia Pereira

More information

Serafino et al. Thymosin α1 activates complement receptor-mediated phagocytosis in human monocyte-derived macrophages. SUPPLEMENTARY FIGURES

Serafino et al. Thymosin α1 activates complement receptor-mediated phagocytosis in human monocyte-derived macrophages. SUPPLEMENTARY FIGURES Supplementary Fig. S1. Evaluation of the purity and maturation of macrophage cultures tested by flow cytometry. The lymphocytic/monocytic cellular fraction was isolated from buffy coats of healthy donors

More information

Supplemental Figure 1. Signature gene expression in in vitro differentiated Th0, Th1, Th2, Th17 and Treg cells. (A) Naïve CD4 + T cells were cultured

Supplemental Figure 1. Signature gene expression in in vitro differentiated Th0, Th1, Th2, Th17 and Treg cells. (A) Naïve CD4 + T cells were cultured Supplemental Figure 1. Signature gene expression in in vitro differentiated Th0, Th1, Th2, Th17 and Treg cells. (A) Naïve CD4 + T cells were cultured under Th0, Th1, Th2, Th17, and Treg conditions. mrna

More information

?Who binds to it. ? Who binds these inflammatory proteins RAGE SUGAR-FREE GLYCOBIOLOGY INFLAMMATION. BASIC SCIENCE?sugar chain structure

?Who binds to it. ? Who binds these inflammatory proteins RAGE SUGAR-FREE GLYCOBIOLOGY INFLAMMATION. BASIC SCIENCE?sugar chain structure SUGAR-FREE GLYCOBIOLOGY BASIC SCIENCE?sugar chain structure Unusual Sugar Chain It -- is a carboxylate Make lots of It Make an It antibody Inflammatory proteins?who binds to it? Who binds these inflammatory

More information

GFP/Iba1/GFAP. Brain. Liver. Kidney. Lung. Hoechst/Iba1/TLR9!

GFP/Iba1/GFAP. Brain. Liver. Kidney. Lung. Hoechst/Iba1/TLR9! Supplementary information a +KA Relative expression d! Tlr9 5!! 5! NSC Neuron Astrocyte Microglia! 5! Tlr7!!!! NSC Neuron Astrocyte! GFP/Sβ/! Iba/Hoechst Microglia e Hoechst/Iba/TLR9! GFP/Iba/GFAP f Brain

More information

RAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh-

RAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh- 1 a b Supplementary Figure 1. Effects of GSK3b knockdown on poly I:C-induced cytokine production. RAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh- GSK3b) were stimulated

More information

Recovery of Myocardial Infarction via Unique Modulation of the Cardiac Microenvironment

Recovery of Myocardial Infarction via Unique Modulation of the Cardiac Microenvironment 2016 춘계심혈관통합학술대회, 경주 Recovery of Myocardial Infarction via Unique Modulation of the Cardiac Microenvironment Youngkeun Ahn, MD, PhD Department of Cardiology, Cardiovascular Center Chonnam National University

More information

alveolar macrophages (AMs) after 24 hours of in vitro culture in complete medium

alveolar macrophages (AMs) after 24 hours of in vitro culture in complete medium Online Supplement for: NF-κB ACTIVATION IN ALVEOLAR MACROPHAGES REQUIRES IκB KINASE-β, BUT NOT NF-κB INDUCING KINASE Supershift and Competition Assays for NF-κB Competition and supershift assays were performed

More information

The biological bases of treatment related cardiac and lung toxicity

The biological bases of treatment related cardiac and lung toxicity The biological bases of treatment related cardiac and lung toxicity Monica Mangoni Cardiopulmonary toxicity of anticancer treatments Chemotherapy TKIs MoAB CARDIAC TOXICITY Radiation effect -------------------------------Early

More information

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and

More information

Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β

Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β

More information

High Fat Diets Induce Colonic Epithelial Cell Stress and Inflammation that is Reversed by IL-22

High Fat Diets Induce Colonic Epithelial Cell Stress and Inflammation that is Reversed by IL-22 Supplementary Information High Fat Diets Induce Colonic Epithelial Cell Stress and Inflammation that is Reversed by IL-22 Max Gulhane 1, Lydia Murray 1, Rohan Lourie 1, Hui Tong 1, Yong H. Sheng 1, Ran

More information

Departamento de Bioquímica e Biologia Molecular, Setor de Ciências Biológicas, Universidade Federal do Paraná, Curitiba, PR, Brazil.

Departamento de Bioquímica e Biologia Molecular, Setor de Ciências Biológicas, Universidade Federal do Paraná, Curitiba, PR, Brazil. Supplementary information - Supplementary Figures 1-8 Excited singlet molecular O 2 ( 1 Δ g ) is generated enzymatically from excited carbonyls in the dark Camila M. Mano 1, Fernanda M. Prado 1, Júlio

More information

The Future Outlook to DILI Research From The Perspective of China

The Future Outlook to DILI Research From The Perspective of China The Future Outlook to DILI Research From The Perspective of China Yimin Mao Renji Hospital,Shanghai Jiaotong University School of Medicine DILI in General Population Less than 20/100,000 The incidence

More information

Graphical Abstract. in silico studies and in vitro assays. inhibition of cyclooxygenases (COX-1 and COX-2) activity. protein binding affinity

Graphical Abstract. in silico studies and in vitro assays. inhibition of cyclooxygenases (COX-1 and COX-2) activity. protein binding affinity Chiral derivatives of xanthones: investigation of enantioselectivity as inhibitors of cyclooxygenases (COX-1 and COX-2) and binding interaction with human serum albumin Carla Fernandes 1,2, Andreia Palmeira

More information

Nature Neuroscience: doi: /nn Supplementary Figure 1

Nature Neuroscience: doi: /nn Supplementary Figure 1 Supplementary Figure 1 EGFR inhibition activates signaling pathways (a-b) EGFR inhibition activates signaling pathways (a) U251EGFR cells were treated with erlotinib (1µM) for the indicated times followed

More information

Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator. of the Interaction with Macrophages

Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator. of the Interaction with Macrophages Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator of the Interaction with Macrophages Yohei Sanada, Takafumi Yamamoto, Rika Satake, Akiko Yamashita, Sumire Kanai, Norihisa Kato, Fons AJ van

More information

Anti-inflammatory effects of a novel compound, MPQP, through the inhibition of IRAK1 signaling pathways in LPS-stimulated RAW 264.

Anti-inflammatory effects of a novel compound, MPQP, through the inhibition of IRAK1 signaling pathways in LPS-stimulated RAW 264. BMB Reports BMB Rep. 2018; 51(6): 308-313 www.bmbreports.org Anti-inflammatory effects of a novel compound, MPQP, through the inhibition of IRAK1 signaling pathways in LPS-stimulated RAW 264.7 macrophages

More information

IL-24 AND ITS ROLE IN WOUND HEALING

IL-24 AND ITS ROLE IN WOUND HEALING IL-24 AND ITS ROLE IN WOUND HEALING Nancy J. Poindexter, Ryan Williams, Garth Powis, Sunil Chada, and Elizabeth A. Grimm & Introgen Therapeutics, Inc., Houston, TX IL-24/MDA 24/MDA-77 is a Tumor Suppressor

More information

Inflammatory macrophages and dendritic cells guiding cancer manifestation

Inflammatory macrophages and dendritic cells guiding cancer manifestation Inflammatory macrophages and dendritic cells guiding cancer manifestation E. Marion Schneider 1, David Zielberg 2, Haouraa Mostafa 1, Karl Aigner 3, Andrej Pala 4, Michael Georgieff 5, C Rainer Wirtz 4,

More information

Amniotic fluid stem cells provide considerable advantages in epidermal. regeneration: B7H4 creates a moderate inflammation

Amniotic fluid stem cells provide considerable advantages in epidermal. regeneration: B7H4 creates a moderate inflammation Amniotic fluid stem cells provide considerable advantages in epidermal regeneration: B7H4 creates a moderate inflammation microenvironment to promote wound repair Qing Sun 1, +, Fang Li 1, +, Hong Li 2,

More information

Jayasooriya et al. Received: 1 April 2011 Revised accepted: 11 December 2011

Jayasooriya et al. Received: 1 April 2011 Revised accepted: 11 December 2011 Tropical Journal of Pharmaceutical Research February 2012; 11 (1): 43-50 Pharmacotherapy Group, Faculty of Pharmacy, University of Benin, Benin City, 300001 Nigeria. All rights reserved. Available online

More information

Medical Management of Endometriosis: Novel Targets and Future Treatments Erkut Attar, M.D. PhD.

Medical Management of Endometriosis: Novel Targets and Future Treatments Erkut Attar, M.D. PhD. Medical Management of Endometriosis: Novel Targets and Future Treatments Erkut Attar, M.D. PhD. Istanbul University Istanbul Medical School Department of Obstetrics & Gynecology Division of Reproductive

More information

EARLY INFLAMMATORY RESPONSES TO VASCULAR DEVICES

EARLY INFLAMMATORY RESPONSES TO VASCULAR DEVICES EARLY INFLAMMATORY RESPONSES TO VASCULAR DEVICES JAMES M. ANDERSON, MD, PhD DISTINGUISHED UNIVERSITY PROFESSOR DEPARTMENTS OF PATHOLOGY, MACROMOLECULAR SCIENCE, AND BIOMEDICAL ENGINEERING CASE WESTERN

More information

Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice.

Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice. Supplementary Figures: Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice. Male apoe -/- mice were fed a high-fat diet for 8 weeks, and given PBS (model group) or

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 A B mir-141, human cell lines mir-2c, human cell lines mir-141, hepatocytes mir-2c, hepatocytes Relative RNA.1.8.6.4.2 Relative RNA.3.2.1 Relative RNA 1.5 1..5 Relative RNA 2. 1.5

More information

B-cell. Astrocyte SCI SCI. T-cell

B-cell. Astrocyte SCI SCI. T-cell RF #2015 P-01 PI: Azizul Haque, PhD Grant Title: Targeting Enolase in Spinal Cord Injury 12-month Technical Progress Report Progress Report (First Six Months): Enolase is one of the most abundantly expressed

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Novel function of NADPH oxidase in atherosclerosis. Yun Soo Bae Department of Life Science Ewha Womans University

Novel function of NADPH oxidase in atherosclerosis. Yun Soo Bae Department of Life Science Ewha Womans University Novel function of NADPH oxidase in atherosclerosis Yun Soo Bae Department of Life Science Ewha Womans University Recent understanding of ROS: act as second messengers e e Catalase/peroxidase O 2 H 2 O

More information

Discovery of human zinc deficiency and its impact 50 years later. Ananda S. Prasad, M.D. Ph.D. Distinguished Professor Department of Oncology

Discovery of human zinc deficiency and its impact 50 years later. Ananda S. Prasad, M.D. Ph.D. Distinguished Professor Department of Oncology Discovery of human zinc deficiency and its impact 50 years later Ananda S. Prasad, M.D. Ph.D. Distinguished Professor Department of Oncology A C N November, 2011 Zinc Deficiency in Microorganisms, Plants

More information

The clinical relevance of circulating, cell-free and exosomal micrornas as biomarkers for gynecological tumors

The clinical relevance of circulating, cell-free and exosomal micrornas as biomarkers for gynecological tumors Department of Tumor Biology The clinical relevance of circulating, cell-free and exosomal micrornas as biomarkers for gynecological tumors cfdna Copenhagen April 6-7, 2017 Heidi Schwarzenbach, PhD Tumor

More information

PHM142 Lecture 4: Platelets + Endothelial Cells

PHM142 Lecture 4: Platelets + Endothelial Cells PHM142 Lecture 4: Platelets + Endothelial Cells 1 Hematopoiesis 2 Platelets Critical in clotting - activated by subendothelial matrix proteins (e.g. collagen, fibronectin, von Willebrand factor) and thrombin

More information

T cell maturation. T-cell Maturation. What allows T cell maturation?

T cell maturation. T-cell Maturation. What allows T cell maturation? T-cell Maturation What allows T cell maturation? Direct contact with thymic epithelial cells Influence of thymic hormones Growth factors (cytokines, CSF) T cell maturation T cell progenitor DN DP SP 2ry

More information

supplementary information

supplementary information DOI: 10.1038/ncb1875 Figure S1 (a) The 79 surgical specimens from NSCLC patients were analysed by immunohistochemistry with an anti-p53 antibody and control serum (data not shown). The normal bronchi served

More information

CHAPTER I INTRODUCTION. Nowadays chronic kidney disease (CKD) becomes one. of the most common diseases found in the population.

CHAPTER I INTRODUCTION. Nowadays chronic kidney disease (CKD) becomes one. of the most common diseases found in the population. CHAPTER I INTRODUCTION I.1 Background Nowadays chronic kidney disease (CKD) becomes one of the most common diseases found in the population. Based on community survey that is held by PERNEFRI (Perhimpunan

More information

EXPERIMENTAL and MOLECULAR MEDICINE, Vol. 41, No. 9, , September 2009

EXPERIMENTAL and MOLECULAR MEDICINE, Vol. 41, No. 9, , September 2009 EXPERIMENTAL and MOLECULAR MEDICINE, Vol. 41, No. 9, 629-637, September 2009 Differential regulation of inducible nitric oxide synthase and cyclooxygenase-2 expression by superoxide dismutase in lipopolysaccharide

More information

Supplementary Figure 1. Expression of EPO and EPOR during self-limited versus delayed

Supplementary Figure 1. Expression of EPO and EPOR during self-limited versus delayed Supplementary Figure 1. Expression of EPO and EPOR during self-limited versus delayed inflammation resolution. a: Flow cytometry analysis showing the electronic gating strategy used to identify peritoneal

More information

Supplementary Information

Supplementary Information Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1

More information