Defining the Conditions for the Generation of Melanocytes from Human Embryonic Stem Cells
|
|
- Veronica Wright
- 5 years ago
- Views:
Transcription
1 EMBRYONIC STEM CELLS Defining the Conditions for the Generation of Melanocytes from Human Embryonic Stem Cells DONG FANG, a KIM LEISHEAR, a THIENNGA K. NGUYEN, a RENA FINKO, a KUN CAI, a MIZUHO FUKUNAGA, a LING LI, a PATRICIA A. BRAFFORD, a ANGELA N. KULP, a XIAOWEI XU, b KEIRAN S. M. SMALLEY, a MEENHARD HERLYN a a Program of Molecular and Cellular Oncogenesis, The Wistar Institute, Philadelphia, Pennsylvania, USA; b Department of Pathology and Laboratory Medicine, University of Pennsylvania School of Medicine, Philadelphia, Pennsylvania, USA Key Words. Human embryonic stem cells Melanocytes Development Wnt3a Stem cell factor Endothelin-3 ABSTRACT Because of their undifferentiated nature, human embryonic stem cells (hescs) are an ideal model system for studying both normal human development and the processes that underlie disease. In the current study, we describe an efficient method for differentiating hescs into a melanocyte population within 4 6 weeks using three growth factors: Wnt3a, endothelin-3, and stem cell factor. The hesc-derived melanocytes expressed melanocyte markers (such as microphthalmia-associated transcription factor and tyrosinase), developed melanosomes, and produced melanin. They retained the melanocyte phenotype during long-term cell culture (>90 days) and, when incorporated into human reconstructed skin, homed to the appropriate location along the basement membrane in the same manner as epidermisderived melanocytes. They maintained a stable phenotype even after grafting of the reconstructs to immunodeficient mice. Over time in culture, the hesc-derived melanocytes lost expression of telomerase and underwent senescence. In summary, we have shown for the first time the differentiation of hescs into melanocytes. This method provides a novel in vitro system for studying the development biology of human melanocytes. STEM CELLS 2006;24: INTRODUCTION Human embryonic stem cells (hescs) are primitive, undifferentiated cells with the capacity for unlimited self-renewal and the ability to differentiate into multiple cell lineages (pluripotency). Their potential for regenerating diseased and damaged tissues is well known and has generated much excitement within both the lay and scientific communities. Embryonic stem cells are powerful tools with which to dissect processes underlying embryonic development. For many years, the use of these cells in medical and developmental studies has been hampered by the tendency of hescs to spontaneously differentiate. Although there is evidence that some of these technical limitations are being overcome [1], there is still a need to develop methods and define conditions necessary to generate reproducible and homogenous populations of distinct cell lineages from hescs. Although many cell types have been derived from hescs including neural cells, hematopoietic cells, cardiomyocytes, trophoblasts, and -cells [2 11] their populations are often heterogeneous, and the propagation methods are not suitable for high-throughput generation. As an added complication, differentiation of some cell types were achieved under coculture conditions with supporting cells, making it very difficult to determine the key signaling pathways in the differentiation process. Epidermal melanocytes play a critical role in protecting human skin from harmful ultraviolet (UV) rays. Their primary function is to produce the pigment melanin, which is packaged into vesicles known as melanosomes. Once generated, the melanosomes are rapidly transported to the surrounding epidermal keratinocytes, giving the skin its characteristic pigmentation. Defects in melanocytes can lead to pigmentary disorders such as albinism, piebaldism, and vitiligo, which are characterized by depigmented areas of skin and hair. In vertebrate development, melanocytes originate from the neural crest and undergo a complex process of fate-specification, proliferation, migration, survival, and differentiation before finally residing in the epidermis [12]. Experimental evidence suggests that the WNT family of proteins [13, 14], stem cell factor (SCF) [15], and endothelin-3 (EDN3) [16] are all involved in the differentiation from neural crest to pigmented Correspondence: Meenhard Herlyn, D.V.M., D.S.C., Program of Molecular and Cellular Oncogenesis, The Wistar Institute, Philadelphia, Pennsylvania 19104, USA. Telephone: ; Fax: ; herlynm@wistar.org Received August 26, 2005; accepted for publication March 22, 2006; first published online in STEM CELLS EXPRESS March 30, AlphaMed Press /2006/$20.00/0 doi: /stemcells STEM CELLS 2006;24:
2 Fang, Leishear, Nguyen et al cells. The Wnt family of proteins induce neural crest and pigment cell formation in Xenopus, zebrafish [17 19], birds [14], and mice [13]. The essential role of Wnt family proteins in mouse melanocyte development are demonstrated by studies on mice null for Wnt-1 and Wnt3a [20]. Mutations in the SCF receptor c-kit cause pigmentation deficiencies in mice and humans (piebaldism) [21 23]. Disruptions in the EDN3 system are associated with pigment loss and aganglionic megacolon in mice [16, 24] and Waardenburg-Shah syndrome and Hirschsprung s disease type 2 in humans [25, 26]. Attempts to study human melanocyte development have long been hampered by the differences in skin architecture between human and mouse. In particular, human melanocytes rest on the basement membrane among keratinocytes, whereas mouse melanocytes are localized near the hair follicles, deep in the dermis. This difference in environmental niche makes it difficult to extrapolate mouse development studies to humans. Although we know little about the existence of melanocyte stem cells in human skin, their presence is suggested by recent reports identifying a melanocyte stem cell population in the bulge region of the mouse hair follicle [27, 28]. Possible evidence for the existence of a melanocyte precursor population in human skin also comes from an earlier study that identified an intraepithelial KIT-positive cell population with melanocyte-like characteristics [29]. It is hoped that through the study of differentiation from hescs to melanocytes, we may learn more about the phenotype of melanocyte stem cells in human skin and whether these cells can transform more readily than mature epidermal melanocytes. In the current study, we have defined conditions for the efficient derivation of a human melanocyte population from hescs. The resulting hesc-derived melanocytes were subjected to detailed characterization and were found to produce melanin, synthesize melanosomes, and express all major melanocyte markers. When put into a reconstructed human skin model, the hesc-derived melanocytes behaved as fetal melanocytes, homed to the correct niche on the basement membrane, and produced melanosomes. MATERIALS AND METHODS Cell Culture, DNA Fingerprinting, and Transmission Electron Microscopy Human embryonic stem cell (ESC) lines H1 and H9 were obtained from the WiCell Research Institute (Madison, WI, and were cultured on mitotically inactivated mouse embryonic fibroblast (MEF) feeder layers [4, 30]. Human ESCs were passaged every 7 10 days by scraping colonies off the dish. Human epidermal melanocytes, keratinocytes, and dermal fibroblasts were isolated from neonatal foreskins and cultured [31]. All human materials, including hescs, were processed according to the guidelines of the internal Institutional Review Board. DNA fingerprinting was performed by the Molecular Diagnostic Core Facility of University of Pennsylvania Cancer Center using the GenePrint Fluorescent STR system (Promega, Madison, WI, Polymerase chain reaction (PCR) products were electrophoresed using an ABI PRISM Genetic Analyzer 3100 (Applied BioSystems, Foster City, CA, and then analyzed with GENESCAN and Genotyper software (Applied Biosystems) for allele identification. Transmission electron microscopy (TEM) was performed by the Biomedical Imaging Core Laboratory of University of Pennsylvania Cancer Center using standard techniques. Differentiation Induction The L-Wnt3a cell line and its parental control L cells were obtained from American Type Culture Collection (Manassas, VA, Conditioned media from L-Wnt3a cells (Wnt3a- CM) and L cells (L-CM) were generated in Dulbecco s modified Eagle s medium (DMEM) supplemented with 1% fetal bovine serum. Compared with L-CM, Wnt3a-CM upregulated the expression of total -catenin in L cells (data not shown). To induce melanocytic differentiation, embryoid bodies (EBs) were derived from hescs by suspending cells in growth factor-depleted medium (80% knockout DMEM/Ham s F-12 medium [Invitrogen, Carlsbad, CA, 20% knockout serum replacer [Invitrogen], 200 mm L-glutamine [Sigma-Aldrich, St. Louis, 1% 10 mm minimal essential medium nonessential amino acids [Invitrogen]) [4]. After 4 days, EBs were collected and plated on 10 ng/ml fibronectin (Becton, Dickinson and Company, Franklin Lakes, NJ, flasks in differentiation medium Mel-1, containing 0.05 M dexamethasone (Sigma-Aldrich), 1 insulin-transferrin-selenium (Sigma-Aldrich), 1 mg/ml linoleic acidbovine serum albumin (Sigma-Aldrich), 30% low-glucose DMEM (Invitrogen), 20% MCDB 201 (Sigma-Aldrich), 10 4 M L-ascorbic acid (Sigma-Aldrich), 50% Wnt3a-CM, 50 ng/ml SCF (R&D Systems Inc., Minneapolis, com), 100 nm EDN3 (American Peptide Company, Sunnyvale, CA), 20 pm cholera toxin (Sigma-Aldrich), 50 nm 12-O-tetradecanoyl-phorbel 13-acetate (TPA) (Sigma-Aldrich), and 4 ng/ml basic fibroblast growth factor (bfgf) (Invitrogen). Medium was changed every other day. Differentiating cultures were passaged when adherent hescs reached 60% confluence. In Wnt blocking experiments, soluble recombinant human Dickkopf-1 (DKK-1) (R&D Systems) at 20 g/ml or recombinant mouse secreted frizzled-related protein-2 (sfrp-2) (R&D Systems) at 25 g/ml was added to culture medium. In differentiation experiments that tested the effects of individual growth factors, EBs were induced in basal growth medium (the same as that used for EB generation) supplemented with each growth factor at the concentration employed in the complete differentiation medium. Human Skin Reconstructs and Mouse Transplantation Human skin reconstructs were generated as described [31]. Briefly, dermal reconstructs consisted of collagen type 1 (Organogenesis, Canton, MA) embedded with fibroblasts. Epidermal melanocytes or hesc-derived melanocytes were seeded into tissue reconstruct trays (Organogenesis) together with keratinocytes onto dermal reconstructs at a ratio of 1:5 melanocytes to keratinocytes. Reconstructs containing epidermal melanocytes or depleted of melanocytes were used as positive and negative controls, respectively. Two weeks later, reconstructs were harvested or grafted onto severe combined immunodeficient (SCID) mice, as reported [32]. Harvested reconstructs were fixed in 10% neutral buffered formalin, processed by routine histological methods, and embedded in paraffin. Grafted reconstructs were harvested 4 weeks after transplantation,
3 1670 Differentiation of hescs into Melanocytes embedded in OCT compound embedding medium (Sakura Fineteck, Torrance, CA), and frozen at 80 C. Frozen sections were cut and fixed in cold acetone for staining. Immunocytochemical and Immunohistochemical Staining Monolayer cells were fixed with 4% paraformaldehyde and stained with primary antibodies specific for microphthalmiaassociated transcription factor (MITF) (monoclonal; Lab Vision, Fremont, CA, tyrosinase (TYR) (monoclonal; Novocastra Ltd., Newcastle upon Tyne, U.K., tyrosinase-related protein-1 (TYRP1) (monoclonal; Signet, Dedham, MA), dopachrome tautomerase (DCT) (polyclonal; a gift from Dr. V.J. Hearing, Bethesda, MD), KIT (monoclonal; BD Pharmingen, San Diego, SCF (polyclonal; Santa Cruz Biotechnology Inc., Santa Cruz, CA, scbt.com), silver protein (SILV/HMB45) (monoclonal; Dako, Carpinteria, CA), and S100 protein (polyclonal; Dako) proteins. Human ESC colonies on the feeder layer were directly stained with monoclonal antibodies for stage-specific embryonic antigen (SSEA)-3 and SSEA-4 (The Wistar Institute). Human ESC colonies were fixed with 100% ethanol and stained with monoclonal antibodies for TRA-1 60 and TRA-1 81 (The Wistar Institute). Isotype-matched mouse antibodies and normal rabbit IgG were used as controls. After washings, primary antibody binding was detected by the corresponding Alexa Fluor 488 secondary antibodies (Invitrogen). Staining was observed by a Nikon E600 fluorescence microscope. Immunohistochemical studies for TYRP1, HMB45, and S100 were performed on paraffin or frozen sections using standard immunoperoxidase techniques. Telomerase Activity Assay Telomerase activity was determined by the TRAPeze enzymelinked immunosorbent assay (ELISA) kit (Serologicals, Norcross, GA) according to the manufacturer s instructions. Briefly, cell lysates were obtained using a provided lysis buffer, and their protein concentrations were determined using the Bio-Rad II protein assay reagent (Bio-Rad, Hercules, CA, Equal amounts of protein were used for PCRs. PCR products were subjected to ELISA, and the absorbance of each sample was measured at 450 nm and 690 nm. Final absorbance (units) A 450 A 690. Aliquots of each sample were heat-inactivated to serve as controls. TUNEL and Alkaline Phosphatase Staining Cell viability was examined using the terminal deoxynucleotidyl transferase dutp nick-end labeling (TUNEL) kit (Roche Diagnostics, Indianapolis, IN). TUNEL label-only and DNase I- treated samples were included as negative and positive controls, respectively. Apoptotic cells were evaluated by a Nikon E600 fluorescence microscope. Alkaline phosphatase was detected by using the Vector Blue alkaline phosphatase substrate kit (Vector Laboratories, Burlingame, CA, Purification and Validation of Wnt3a Protein Soluble Wnt3a protein was purified from Wnt3a-CM following the procedure described previously [33]. For details, see Dr. R. Nusse s website at rnusse/assays/w3apurif.htm. The activity of purified Wnt3a protein was evaluated by doseresponse upregulation of total -catenin in L cells. Western Blotting, RNA Isolation, Reverse Transcription-PCR, and Sequence Analysis Western blot analyses were performed as described [34] using antibodies against MITF, TYR, DCT, TYRP1, SOX10 (Abcam, Cambridge, U.K., PAX3 (Active Motif, Carlsbad, CA), -catenin (BD Biosciences, San Diego, A monoclonal antibody against -actin (Sigma-Aldrich) was used as a control. Band intensities on Western blots were measured by densitometry and normalized to -actin control. RNA isolation and reverse transcription- PCR amplification of the MITF gene were described previously [34]. Sequence analysis was performed on an ABI PRISM 377 DNA sequencer (Applied Biosystems). Statistical Analysis Statistical analysis was performed using SAS software version 9.1 (SAS Institute Inc., Cary, NC). Data from three independent experiments presented in Figure 1 were analyzed. General linear modeling with repeated measures was used to test significant differences between the nine different media. Least square mean was used to test whether there are significant differences between media. In this model, total EB numbers or the surface area of adherent EBs differentiated under each medium condition was used as dependent variables, and medium and day were used as other independent variables. Statistical significance was defined as p.05. RESULTS Differentiation of hescs into Homogeneous Melanocytic Populations Human ESCs (H1 and H9 lines) were routinely grown as colonies on mitotically inactivated MEF feeder layers (Fig. 1A). The cells were prepared for differentiation by mechanical removal from the feeder layer, resuspension in hesc media (without bfgf), and transfer to untreated tissue culture flasks. Under these conditions, the hescs grew in suspension as EBs (Fig. 1B). Any contaminating feeder layer cells rapidly adhered to the original flask and were discarded following serial passage of the cells into new flasks. After 4 days of culture, EBs were plated onto fibronectin-coated flasks containing complete differentiation media (which contained multiple growth factors including Wnt3a, SCF, and EDN3, as described in detail in Materials and Methods). After hours, some of the EBs formed adhesive colonies, out of which bipolar cells migrated (Fig. 1C, 1D). The differentiating hescs continued to proliferate and reached 60% confluence after 3 weeks of continuous culture. At this point, the cultures were dissociated into single-cell suspensions using trypsin and were replated onto fibronectin-coated flasks. Homogenous cultures of cells with a melanocyte-like dendritic morphology were established following an additional 4 6 weeks maintenance (Fig. 1E). Whereas EBs were unpigmented, hesc-derived melanocytes were highly pigmented by 9 weeks (Fig. 1F) and retained their pigmented phenotype in long-term culture over a 6-month period (Fig. 1F). This demonstrates the stable and efficient induction of melanocytic differentiation from hesc cells. The fact that
4 Fang, Leishear, Nguyen et al Figure 1. Highly efficient differentiation of human embryonic stem cells (hescs) into pigmented melanocytes in melanocyte differentiation medium. (A): hesc colonies grew on lethally irradiated mouse embryonic fibroblast feeder layers. (B): Embryoid bodies (EBs) formed in suspension under feeder-free conditions at day 4. (C): In differentiation medium, cells migrated out from an EB adhered to the substrate by day 6. (D): Differentiating cells appeared with morphology typical of melanocytic lineage migrated out of an adherent EB by day 16. (E): By day 30, differentiated populations homogeneously displayed melanocytic morphology after splitting. (F): Unpigmented EBs prior to differentiation (left) contrast with a highly pigmented cell pellet from hesc-derived melanocytes collected 9 weeks after differentiation (middle). Pigmentation was sustained in hesc-derived melanocytes in long-term cultures (6 months) maintained in differentiation medium without TPA (right). In each case, cells were spun down in each tube and photographed. (G): A transmission electron microscopy (TEM) image shows an hesc-derived melanocyte with many melanosomes in the cytoplasm 8 weeks after differentiation (arrow). (H): Premelanosomes (white arrow) and mature melanosomes (black arrows) are seen near the Golgi apparatus under TEM. (I): Melanocytes derived from hescs proliferated rapidly. A typical growth rate (cells per plate) during week 10 in the absence of TPA is shown (mean SD from triplicate samples). Bars (A), 3 mm; (B D), 200 m; (E), 100 m; (G), 10 m; and (H), 500 nm. melanocytic differentiation was induced in both the H1 and H9 hesc cell lines suggests that this method is broadly applicable to embryonic stem cell populations. Characterization of hesc-derived Melanocytes Critical tests for melanocyte differentiation include pigmentation and melanosome synthesis. Melanosomes were identified in the hesc-derived melanocyte population by TEM (Fig. 1G, 1H; data not shown). The proliferation characteristics of hescderived melanocytes were then compared with those of human epidermal melanocytes isolated from newborn foreskin. Like the epidermal melanocytes, hesc-derived melanocytes proliferated continuously over a 6-month period, eventually undergoing senescence at passage 40 (a representative proliferation rate over one passage cycle is shown in Fig. 1I). To confirm the melanocytic phenotype of hesc-derived cells, we determined expression of melanocyte-specific markers using immunostaining and Western blotting. Immunofluorescence studies demonstrated the presence of all tested melanocyte markers, including MITF, c-kit, DCT, TYR, TYRP1, SILV, and S100 (Fig. 2A). MITF expression was predominantly present in nuclei, whereas the other proteins were localized to the cytoplasm. Dermal fibroblasts did not express any of the markers tested, and all newborn-derived epidermal melanocytes used as positive controls were positive (data not shown). Western blot analyses further confirmed that the hesc-derived melanocytes express melanocyte markers MITF, sex-determining region Y (SRY)-related transcription factor SOX10, the paired homeodomain transcription factor PAX3, TYRP1, DCT, and TYR (Fig. 2B). No specific bands were detected that corresponded to the melanocyte markers in either EBs or human dermal fibroblasts (except for PAX3 expression in MEFs). To ascertain whether the hesc-derived melanocytes were of neural crest rather than retinal pigmented cell phenotype, total RNA was extracted from the hesc-derived melanocytes, and MITF cdna was amplified by RT-PCR using primers specific for the neural crest-derived MITF isoform [34], we confirmed that hesc-derived melanocytes were of neural crest origin.
5 1672 Differentiation of hescs into Melanocytes Figure 2. Expression of markers characteristic of the melanocytic lineage in human embryonic stem cell (hesc)-derived melanocytes. (A): Eight weeks after differentiation, hesc-derived melanocytes were positive for a panel of melanocyte markers (top rows). Phase-contrast images of the same field are shown in the bottom row. A representative image obtained from isotype matched mouse antibodies is shown as control. Bar 100 m. (B): Western blots show that hesc-derived melanocytes were positive for melanocyte markers SOX10, PAX3, TYRP1, DCT, TYR, and MITF. Lane 1, dermal fibroblasts; lane 2, mouse embryonic fibroblasts; lane 3, embryoid bodies; lane 4, hesc-derived melanocytes at day 35; lane 5, primary epidermal melanocytes; lane 6, melanoma cell line 451Lu. The loading variation is shown by -actin. Abbreviations: DCT, dopachrome tautomerase; MITF, microphthalmia-associated transcription factor; SCF, stem cell factor; SILV, silver protein; TYR, tyrosinase; TYRP1, tyrosinase-related protein-1. Sequence analysis of MITF cdna confirmed their neural crest origin based on the expression of epidermal melanocyte-specific isoform MITF-M (data not shown). DNA fingerprinting analysis showed identical alleles at 12 different STR loci and contained both X and Y alleles at the amelogenin locus between hescs and hesc-derived melanocytes, confirming that the hescs were the originating cells (data not shown). The mature phenotype of the hesc-derived melanocytes was demonstrated by the lack of telomerase expression (supplemental online Fig. 1). Further work demonstrated that hesc-derived melanocytes did not express markers characteristic of hescs, such as alkaline phosphatase, SSEA-3, SSEA-4, TRA-1 60, and TRA-1 81 (data not shown). Localization of hesc-derived Melanocytes in Reconstructed Human Skin Examining the behavior of hesc-derived cells in vivo or in a tissue-dependent context can provide definitive evidence for our hypothesis. Because, as noted in the Introduction, mouse skin is not a suitable model with which to study human melanocytes, we used a reconstructed human skin xenograft model in which keratinocytes are overlaid onto a dermis of human skin fibroblasts and collagen [31]. The hesc-derived melanocytes were introduced into the human skin reconstructs. When the skin reconstructs were harvested and sectioned, the hesc-derived melanocytes were found to localize to the basal keratinocyte layer, as do melanocytes in the skin of newborns (Fig. 3A). TEM studies revealed that the hesc-derived melanocytes grown in human skin reconstructs also expressed melanosomes (Fig. 3B, 3C). To answer whether the hesc-derived melanocytes were stable for prolonged periods of time in an in vivo situation, the cells were introduced into human skin reconstructs and then grafted onto SCID mice. This allowed the grafts to become vascularized and prolonged their survival (Fig. 3D). These studies demonstrate that the hesc-derived melanocytes homed to the basement membrane and remained stable for over 4 weeks, as demonstrated by the expression of the melanocyte marker TYRP1 (Fig. 3D). Control reconstruct grafts, which lacked hesc-derived melanocytes, expressed no TYRP1. The Critical Role of Wnt in hesc-to- Melanocyte Differentiation To date, little is known about the role of Wnt3a in human melanocyte differentiation. Here we show that after 2 3 weeks growth in the complete differentiation medium containing 50% Wnt3a-CM, hescs began to exhibit melanocyte morphology and expressed MITF (supplemental online Fig. 2A). They developed into pigmented melanocytes after 6 8 weeks (supplemental online Fig. 2B). When the concentration of Wnt3a-CM in the differentiation medium was lowered from 50% 20%, onset of melanocytic differentiation was delayed. After 4 5 weeks of culture, the hescs exhibited melanocyte morphology, but the majority of cells lacked strong expression of MITF (supplemental online Fig. 2A). When the hescs were grown in the medium in which Wnt3a-CM (50%) was replaced by L-CM control media (which lacked any Wnt3a), the cells exhibited a different, nonmelanocytic morphology. These cells were negative for MITF, and the cell pellets remained unpigmented for 9 10 weeks (supplemental online Fig. 2B) and never acquired pigmentation even during long-term ( 6 months) culture. Further proof of the indispensable role of Wnt3a in human melanocyte development was demonstrated by the use of WNT antagonists DKK-1 and sfrp-2 [35, 36]. In complete media (with 50% Wnt3a-CM), the differentiating hescs proliferated normally for 3 weeks, even in the presence of DKK-1 and sfrp-2. After this point, however, proliferation ceased, and the cells could not be maintained for more than 5 weeks (data not shown). The cells also demonstrated extensive TUNEL staining, indicating the onset of apoptosis in the antagonist-treated hesc population (data not
6 Fang, Leishear, Nguyen et al Figure 3. Homing of human embryonic stem cell (hesc)-derived melanocytes to the basal layer of the epidermis in three-dimensional organotypic cultures that mimic human skin architecture. (A): Human skin reconstructs (organotypic cultures) are generated without melanocytes (left; negative control), with human epidermal melanocytes (middle; positive control) or with hesc-derived melanocytes (right). The epidermal and dermal layers contain keratinocytes and fibroblasts, respectively, and are labeled in one of the representative H&E staining images. Both epidermal and hesc-derived melanocytes (arrows) are dispersed normally among the basal layer keratinocytes (shown at larger magnification in insets). (B): A transmission electron microscopy image shows an hesc-derived melanocyte among basal layer keratinocytes in skin reconstructs (arrow). (C): A close-up of the boxed area in (B) shows melanosomes at various stages in cytoplasm. (D): Identification of hesc-derived melanocytes in human skin reconstructs after being grafted onto severe combined immunodeficient mice. Grafted melanocyte-free reconstructs do not contain TYRP1-positve cells (left), whereas TYRP1 immunoreactive cells are found among basal layer keratinocytes in reconstructs containing either epidermal (middle) or hesc-derived (right) melanocytes (arrows). Bars (A), 100 m; insets, 40 m; (B), 4 m; (C), 1 m; and (D), 50 m. Abbreviations: F, fibroblasts; K, keratinocytes; SILV, silver protein; TYRP1, tyrosinase-related protein-1. shown). As a final exploration of the role of Wnt3a, we replaced the Wnt3a-CM with purified Wnt3a. The activity of the purified Wnt3a was confirmed by its concentration-dependent upregulation of -catenin levels (data not shown). It was also demonstrated that purified Wnt3a could substitute for Wnt3a-CM in the melanocyte differentiation medium and drive melanocytic differentiation, albeit with lower efficiency (data not shown). Effects of the Individual Growth Factors on Melanocytic Differentiation We investigated whether all three growth factors (Wnt3a, SCF, and EDN3) were required for melanocyte differentiation. We tested the growth factors individually and in every possible combination. The hescs did not repopulate to a large-cell mass when Wnt3a was excluded from the differentiation media, suggesting that proliferation or cell survival is not supported in the absence of Wnt3a (Fig. 4A, 4B). Indeed, in the presence of Wnt3a alone or in combination with one other growth factor, the EBs survived, and 20% adhered to the substrate and underwent differentiation (Fig. 4A). The numbers of total differentiating EBs cultured in the nine different media were statistically analyzed. Although experimental time itself did not have a significant effect on the differentiating EB numbers (F 1.01, p.37), both time and medium demonstrated a significant combined effect on the EB numbers (F 2.25, p.03). Significant differences were observed between medium SCF/ EDN3, SCF, EDN3, and the others at day 21, suggesting that lower numbers of differentiating EBs under these conditions may be caused by removal of Wnt3a-CM or L-CM. In Figure 4B, either experimental time or medium showed a significant effect on the surface area of adherent EBs (F 5.18, p.02; F 3.48, p.01, respectively). No significant differences were found among the media Wnt3a-CM, Wnt3a-CM/SCF, Wnt3a-CM/SCF/EDN3, and L-CM and complete medium; however, significant differences were identified between these media and medium SCF/EDN3, SCF, EDN3. These data further indicate that an unknown factor present in L-CM may act as a differentiation inducer or essential survival factor for differentiating hescs. Although stable cultures are established in the presence of basal media supplemented with Wnt3a-CM, Wnt3a-CM SCF, Wnt3a EDN3, Wnt3a SCF EDN3, or L-CM, melanocytes were only established in the presence of Wnt3a EDN3 and all three of the growth factors (Fig. 5). Melanocytes derived in the presence of all three growth factors persisted in culture for 90 days. Interestingly, an MITF population of cells was detected between days in the presence of Wnt3a EDN3, but these later regressed, which implies that the combination of Wnt3a EDN3 may be sufficient for melanocyte fate determination. No melanocytes were established following any other combination of growth factors.
7 1674 Differentiation of hescs into Melanocytes Figure 4. Fate of EBs, both adherent and floating, during differentiation of hescs cultured with individual or combined growth factors. Data obtained are from triplicate experiments using approximately 30 to 50 EBs in each trial. (A): Percentage of viable adherent (filled bars) and floating (blank bars) EBs during the first 3 weeks of differentiation. Basal medium containing SCF, EDN3, or both, resulted in only a small fraction of EBs adhering to substrate during the first 2 weeks. However, these EBs failed to proliferate into a large population. Consistent loss of floating EBs was also observed under these conditions. Wnt3a-CM alone and combined with other growth factors led to an increasing number of differentiating and adherent EBs. Complete differentiation media Mel-1 and L-CM were included as controls. (B): Percentage of flask surface areas occupied by differentiating EBs. EBs failed to differentiate and establish adherent cultures in basal medium containing SCF, EDN3, or both. In contrast, in any medium containing Wnt3a-CM, EBs progressively differentiated and produced adherent cultures. Using L-CM also resulted in proliferating adherent cultures. Abbreviations: EB, embryoid body; EDN3, endothelin-3; L-CM, conditioned medium from L cells; SCF, stem cell factor.
8 Fang, Leishear, Nguyen et al Figure 5. Requirement of Wnt3a, SCF, and EDN3 for melanocytic differentiation of human embryonic stem cells. Challenging embryoid bodies with individual or combined growth factors resulted in proliferating cell populations under several conditions, as indicated. Differentiated cells were examined at days 7, 14, 21, 28, and 90 by immunocytochemistry with melanocyte markers TYR (data not shown), MITF, and TYRP1. Images shown are from 28 days, with the exception of the insets. Melanocytes were identified at the early stage of differentiation (between 14 and 21 days) in the medium containing both Wnt3a-CM and EDN3 (insets); however, they were not detected after 28 days despite establishment of long-term cultures. Only a combination of Wnt3a-CM, SCF, and EDN3 sustained a long-term population containing melanocytic cells, as indicated by their morphology and immunoreactivity for MITF and TYRP1 (arrowheads). Medium containing L-CM also supported proliferation of nonmelanocytic cells. Abbreviations: EDN3, endothelin-3; L-CM, conditioned medium from L cells; MITF, microphthalmia-associated transcription factor; SCF, stem cell factor; TYRP1, tyrosinase-related protein-1. DISCUSSION This is the first reported derivation of a melanocyte population from human embryonic stem cells (hescs). Using a novel feeder cell-free approach and three defined melanocyte growth factors (Wnt3a, SCF, and EDN3), we reproducibly generated a homogenous population of bona fide human melanocytes from two hesc lines (H1 and H9). The hesc-derived melanocytes exhibit the correct melanocyte morphology, are pigmented, synthesize melanosomes, and express all of the melanocyte markers tested. A defining characteristic of melanocytes is their expression of melanocyte-specific transcription factors such as MITF. Of all of these transcription factors, MITF is best known as a critical player in melanocyte development [37]. Although the hesc-derived melanocytes expressed lower levels of MITF protein than newborn foreskin-derived melanocytes, they still expressed functional melanosomes and produced melanin, suggesting that they reached a critical expression level of MITF required for differentiation. In E10.5 mouse embryos, the appearance of MITF-positive cells at the dorsal midline of the neural tube is rapidly followed by melanocyte proliferation [38]. Two other melanocyte transcription factors, SOX10 and PAX3, also upregulate MITF expression [39 43]. Once activated, the major target genes of MITF are those of the melanocyte-specific tyrosinase family that encode three major pigment enzymes: TYR, TYRP-1, and DCT [44, 45]. Using hescs as a pluripotent model system, we have shown for the first time that a network of transcription factors essential for melanocyte development and pigmentation including MITF, SOX10, and PAX3 is upregulated during differentiation of human melanocytes. The critical challenge in differentiating hescs into cell populations of distinct lineages is defining the requisite cell culture conditions. The melanocyte differentiation medium used in this study contains multiple factors known to maintain melanocyte growth in culture, such as dexamethasone, TPA, and cholera toxin, as well as growth factors Wnt3a, SCF, EDN3, and basic fibroblast growth factor (bfgf). Among these factors, dexamethasone was recently reported to induce the differentiation of melanocytic cells from mouse ESCs [46]. TPA and cholera toxin, which activate protein kinase C and increase intracellular cyclic AMP, respectively, have long been included as growth enhancers in melanocyte media [47]. Interestingly, when cholera toxin, dexamethasone, and TPA were removed from differentiation medium, the three growth factors (Wnt3a, EDN3, and SCF) still induced partial melanocytic differentiation. This suggests that the three growth factors are sufficient to induce some degree of melanocytic differentiation on their own, and that cholera toxin, dexamethasone, and TPA act more as differentiation enhancers. Not all of the factors in our differentiation system are as well-defined. Although a role for Wnt3a in the development of avian [14] and murine [13] melanocytes has been demonstrated, little is known about its role in the human melanocyte. Here we demonstrate that decreasing the concentration of Wnt3a-CM in the differentiation media from 50% 20% delayed the onset of melanocytic differentiation and use of soluble Wnt antagonists induced apoptosis in the hesc population. These results are consistent with previous studies showing that blocking the Wnts using sfrp leads to death in developing embryonic tissues [48]. Other studies have also shown that Wnts are survival factors for neural crest progenitors [20, 49] and hematopoietic stem cells [50]. There is increasing evidence that cell fate is the result of many signals acting in a synergistic manner [51]. In agreement with this idea, our depletion experiments demonstrate that the combination of Wnt3a, SCF, and EDN3 is critical for full melanocyte differentiation from hescs. Treating the hescs with any one of these growth factors alone failed to induce expression of the mature melanocyte markers TYR or TYRP1. The absence of melanocytes in animals that are deficient in either EDN3 or its receptor suggests that this pathway is critical in the development of neural crest-derived melanocyte populations [16]. In vitro studies show that EDN3 promotes the proliferation, survival, and differentiation of melanocyte precursors [52 54]. Our results show that EDN3 is required for melanocyte development. The role of the KIT gene (encoding the SCF receptor) in melanocyte development is more complex. Mutations in KIT do not affect specification of melanocyte lineage but instead hamper melanoblast survival at later developmental stages [21, 22]. In particular, SCF/KIT signaling is essential for migration, proliferation, survival, and differentiation of the precursor melanoblasts [38, 55 58]. SCF/KIT signaling also upregulates MITF through the activation of mitogen-activated protein kinase [59].
9 1676 Differentiation of hescs into Melanocytes A situation can be envisaged in which the three growth factors perform subtle but differing roles in hesc-to-melanocyte differentiation. In this model of activity, Wnt3a signaling determines melanocyte fate of neural crest cells, EDN3 contributes towards cell fate, and SCF promotes proliferation/survival of the committed progenitors. Further evidence for the close interaction of the three growth factors in melanocyte development comes from mouse embryonic development studies where Wnt3A is expressed at E7.5 [60], Edn3 is expressed at E9.5 [53], and Kit and Scf are expressed between E9.5 and E10.5 [61, 62]. Previous studies have described the generation of melanocytes from mouse ESCs [46]. In this instance, differentiation was independent of Wnt3a signaling and instead required SCF, EDN3, TPA, and dexamethasone. There are a number of possible explanations for the discrepancies between the study of Yamane et al. [46] and our own. First, that study used mouse ESCs [46]. It is likely that mouse melanocytes occupy an environmental niche different from that of human melanocytes and may require different signals. Second, that model used a coculture system in which differentiation of mouse ESCs was induced in the presence of stromal cells [46]. It could be assumed that Wnt3a was produced by the stromal cells. In summary, we have defined conditions and developed a highly efficient method of differentiating a homogenous human melanocyte population from hescs. We demonstrate that a complex synergistic interplay of three growth factors Wnt3a, SCF, and EDN3 is required for the differentiation of human melanocytes from embryonic stem cells. We hope that a greater understanding of the underlying biology of melanocytes will yield important new insights into pigmentary diseases and the development of melanoma. ACKNOWLEDGMENTS We thank the WiCell Research Institute for providing hescs and its staff members L.J. Crandall, K. Van Den Heuvel, and D. Manning for technical support in culturing the cells. We are very grateful to Dr. James Thomson for constructive discussions, Dr. V.J. Hearing for the DCT antibody, James Hayden for photographing the cell pellets, Akihiro Yoneta and Richelle Takemoto for assistance in mouse experiments, the Molecular Diagnostic Core Facility for DNA fingerprinting, and the Biomedical Imaging Core Laboratory for TEM. This work was supported by grants from the National Institutes of Health (CA25874, CA80999, and CA76674) and the Commonwealth Universal Research Enhancement Program, Pennsylvania Department of Health. DISCLOSURES The authors indicate no potential conflicts of interest. REFERENCES 1 Conti L, Pollard SM, Gorba T et al. Niche-independent symmetrical self-renewal of a mammalian tissue stem cell. PLoS Biol 2005;3:e Reubinoff BE, Itsykson P, Turetsky T et al. Neural progenitors from human embryonic stem cells. Nat Biotechnol 2001;19: Schuldiner M, Eiges R, Eden A et al. Induced neuronal differentiation of human embryonic stem cells. Brain Res 2001;913: Zhang SC, Wernig M, Duncan ID et al. In vitro differentiation of transplantable neural precursors from human embryonic stem cells. Nat Biotechnol 2001;19: Kaufman DS, Hanson ET, Lewis RL et al. Hematopoietic colonyforming cells derived from human embryonic stem cells. Proc Natl Acad SciUSA2001;98: Mummery C, Ward D, van den Brink CE et al. Cardiomyocyte differentiation of mouse and human embryonic stem cells. J Anat 2002;200: Xu RH, Chen X, Li DS et al. BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol 2002;20: He JQ, Ma Y, Lee Y et al. Human embryonic stem cells develop into multiple types of cardiac myocytes: Action potential characterization. Circ Res 2003;93: Gerami-Naini B, Dovzhenko OV, Durning M et al. Trophoblast differentiation in embryoid bodies derived from human embryonic stem cells. Endocrinology 2004;145: Gerecht-Nir S, Ziskind A, Cohen S et al. Human embryonic stem cells as an in vitro model for human vascular development and the induction of vascular differentiation. Lab Invest 2003;83: Segev H, Fishman B, Ziskind A et al. Differentiation of human embryonic stem cells into insulin-producing clusters. STEM CELLS 2004;22: Le Douarin NM, Kalcheim, C, eds. The Neural Crest (Developmental & Cell Biology Series). Cambridge, U.K.: Cambridge University Press, Dunn KJ, Brady M, Ochsenbauer-Jambor C et al. WNT1 and WNT3a promote expansion of melanocytes through distinct modes of action. Pigment Cell Res 2005;18: Jin EJ, Erickson CA, Takada S et al. Wnt and BMP signaling govern lineage segregation of melanocytes in the avian embryo. Dev Biol 2001;233: Kunisada T, Yoshida H, Yamazaki H et al. Transgene expression of steel factor in the basal layer of epidermis promotes survival, proliferation, differentiation and migration of melanocyte precursors. Development 1998;125: Baynash AG, Hosoda K, Giaid A et al. Interaction of endothelin-3 with endothelin-b receptor is essential for development of epidermal melanocytes and enteric neurons. Cell 1994;79: Dorsky RI, Moon RT, Raible DW. Control of neural crest cell fate by the Wnt signalling pathway. Nature 1998;396: Saint-Jeannet JP, He X, Varmus HE et al. Regulation of dorsal fate in the neuraxis by Wnt-1 and Wnt-3a. Proc Natl Acad Sci USA1997;94: LaBonne C, Bronner-Fraser M. Neural crest induction in Xenopus: Evidence for a two-signal model. Development 1998;125: Ikeya M, Lee SM, Johnson JE et al. Wnt signalling required for expansion of neural crest and CNS progenitors. Nature 1997;389: Geissler EN, Ryan MA, Housman DE. The dominant-white spotting (W) locus of the mouse encodes the c-kit proto-oncogene. Cell 1988;55: Copeland NG, Gilbert DJ, Cho BC et al. Mast cell growth factor maps near the steel locus on mouse chromosome 10 and is deleted in a number of steel alleles. Cell 1990;63: Spritz RA, Giebel LB, Holmes SA. Dominant negative and loss of function mutations of the c-kit (mast/stem cell growth factor receptor) proto-oncogene in human piebaldism. Am J Hum Genet 1992;50: Hosoda K, Hammer RE, Richardson JA et al. Targeted and natural (piebaldlethal) mutations of endothelin-b receptor gene produce megacolon associated with spotted coat color in mice. Cell 1994;79: Edery P, Attie T, Amiel J et al. Mutation of the endothelin-3 gene in the Waardenburg-Hirschsprung disease (Shah-Waardenburg syndrome). Nat Genet 1996;12: Puffenberger EG, Hosoda K, Washington SS et al. A missense mutation of the endothelin-b receptor gene in multigenic Hirschsprung s disease. Cell 1994;79: Nishimura EK, Jordan SA, Oshima H et al. Dominant role of the niche in melanocyte stem-cell fate determination. Nature 2002;416:
10 Fang, Leishear, Nguyen et al Nishimura EK, Granter SR, Fisher DE. Mechanisms of hair graying: Incomplete melanocyte stem cell maintenance in the niche. Science 2005;307: Grichnik JM, Ali WN, Burch JA et al. KIT expression reveals a population of precursor melanocytes in human skin. J Invest Dermatol 1996; 106: Thomson JA, Itskovitz-Eldor J, Shapiro SS et al. Embryonic stem cell lines derived from human blastocysts. Science 1998;282: Meier F, Nesbit M, Hsu MY et al. Human melanoma progression in skin reconstructs: Biological significance of bfgf. Am J Pathol 2000;156: Berking C, Takemoto R, Satyamoorthy K et al. Induction of melanoma phenotypes in human skin by growth factors and ultraviolet B. Cancer Res 2004;64: Willert K, Brown JD, Danenberg E et al. Wnt proteins are lipid-modified and can act as stem cell growth factors. Nature 2003;423: Fang D, Setaluri V. Role of microphthalmia transcription factor in regulation of melanocyte differentiation marker TRP-1. Biochem Biophys Res Commun 1999;256: Fedi P, Bafico A, Nieto Soria A et al. Isolation and biochemical characterization of the human Dkk-1 homologue, a novel inhibitor of mammalian Wnt signaling. J Biol Chem 1999;274: Rattner A, Hsieh JC, Smallwood PM et al. A family of secreted proteins contains homology to the cysteine-rich ligand-binding domain of frizzled receptors. Proc Natl Acad Sci USA1997;94: Widlund HR, Fisher DE. Microphthalamia-associated transcription factor: A critical regulator of pigment cell development and survival. Oncogene 2003;22: Opdecamp K, Nakayama A, Nguyen MT et al. Melanocyte development in vivo and in neural crest cell cultures: Crucial dependence on the Mitf basic-helix-loop-helix-zipper transcription factor. Development 1997; 124: Potterf SB, Furumura M, Dunn KJ et al. Transcription factor hierarchy in Waardenburg syndrome: Regulation of MITF expression by SOX10 and PAX3. Hum Genet 2000;107: Watanabe A, Takeda K, Ploplis B et al. Epistatic relationship between Waardenburg syndrome genes MITF and PAX3. Nat Genet 1998;18: Lee M, Goodall J, Verastegui C et al. Direct regulation of the Microphthalmia promoter by Sox10 links Waardenburg-Shah syndrome (WS4)- associated hypopigmentation and deafness to WS2. J Biol Chem 2000; 275: Potterf SB, Mollaaghababa R, Hou L et al. Analysis of SOX10 function in neural crest-derived melanocyte development: SOX10-dependent transcriptional control of dopachrome tautomerase. Dev Biol 2001;237: Hornyak TJ, Hayes DJ, Chiu LY et al. Transcription factors in melanocyte development: Distinct roles for Pax-3 and Mitf. Mech Dev 2001; 101: Yasumoto K, Yokoyama K, Takahashi K et al. Functional analysis of microphthalmia-associated transcription factor in pigment cell-specific transcription of the human tyrosinase family genes. J Biol Chem 1997; 272: Bertolotto C, Busca R, Abbe P et al. Different cis-acting elements are involved in the regulation of TRP1 and TRP2 promoter activities by cyclic AMP: Pivotal role of M boxes (GTCATGTGCT) and of microphthalmia. Mol Cell Biol 1998;18: Yamane T, Hayashi S, Mizoguchi M et al. Derivation of melanocytes from embryonic stem cells in culture. Dev Dyn 1999;216: Eisinger M, Marko O. Selective proliferation of normal human melanocytes in vitro in the presence of phorbol ester and cholera toxin. Proc Natl Acad Sci USA1982;79: Hussain SZ, Sneddon T, Tan X et al. Wnt impacts growth and differentiation in ex vivo liver development. Exp Cell Res 2004;292: Dickinson ME, Krumlauf R, McMahon AP. Evidence for a mitogenic effect of Wnt-1 in the developing mammalian central nervous system. Development 1994;120: Reya T, Duncan AW, Ailles L et al. A role for Wnt signalling in self-renewal of haematopoietic stem cells. Nature 2003;423: Sommer L, Rao M. Neural stem cells and regulation of cell number. Prog Neurobiol 2002;66: Lahav R, Dupin E, Lecoin L et al. Endothelin 3 selectively promotes survival and proliferation of neural crest-derived glial and melanocytic precursors in vitro. Proc Natl Acad Sci USA1998;95: Reid K, Turnley AM, Maxwell GD et al. Multiple roles for endothelin in melanocyte development: Regulation of progenitor number and stimulation of differentiation. Development 1996;122: Pla P, Solov eva O, Moore R et al. Dct::lacZ ES cells: A novel cellular model to study melanocyte determination and differentiation. Pigment Cell Res 2004;17: Murphy M, Reid K, Williams DE et al. Steel factor is required for maintenance, but not differentiation, of melanocyte precursors in the neural crest. Dev Biol 1992;153: Morrison-Graham K, Weston JA. Transient steel factor dependence by neural crest-derived melanocyte precursors. Dev Biol 1993;159: Ito M, Kawa Y, Ono H et al. Removal of stem cell factor or addition of monoclonal anti-c-kit antibody induces apoptosis in murine melanocyte precursors. J Invest Dermatol 1999;112: Wehrle-Haller B, Meller M, Weston JA. Analysis of melanocyte precursors in Nf1 mutants reveals that MGF/KIT signaling promotes directed cell migration independent of its function in cell survival. Dev Biol 2001;232: Hemesath TJ, Price ER, Takemoto C et al. MAP kinase links the transcription factor Microphthalmia to c-kit signalling in melanocytes. Nature 1998;391: Takada S, Stark KL, Shea MJ et al. Wnt-3a regulates somite and tailbud formation in the mouse embryo. Genes Dev 1994;8: Yoshida H, Kunisada T, Grimm T et al. Review: Melanocyte migration and survival controlled by SCF/c-kit expression. J Invest Dermatol Symp Proc 2001;6: Matsui Y, Zsebo KM, Hogan BL. Embryonic expression of a haematopoietic growth factor encoded by the Sl locus and the ligand for c-kit. Nature 1990;347: See for supplemental material available online.
Stem Cells. Induced Stem Cells
Induced Stem Cells Stem Cells Mouse and human somatic cells can either be reprogrammed to a pluripotent state or converted to another lineage with a combination of transcription factors suggesting that
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationHuman Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Introduction Kit Components Cat. # # of vials Reagent Quantity Storage
Human Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Catalog #5901 Introduction Human pluripotent stem cells (hpsc), including embryonic stem cells (ESC) and induced pluripotent stem
More informationIslet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot
Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter
More informationSupplemental Experimental Procedures
Cell Stem Cell, Volume 2 Supplemental Data A Temporal Switch from Notch to Wnt Signaling in Muscle Stem Cells Is Necessary for Normal Adult Myogenesis Andrew S. Brack, Irina M. Conboy, Michael J. Conboy,
More informationACTIVE.LITE. Patent-Pending Technology + Visibly Perceivable Results in Less than 14 Days. Tomorrow s Vision Today!
ACTIVE.LITE Patent-Pending Technology + Visibly Perceivable Results in Less than 14 Days Tomorrow s Vision Today! AESTHETIC PERFECTION IS THE STANDARD Aesthetic skin perfection is now the consumer standard
More informationMelanocytes (MC) originate from the neural crest
Review: Melanocyte Migration and Survival Controlled by SCF/c-kit Expression Hisahiro Yoshida, Takahiro Kunisada,* Thomas Grimm, Emi K. Nishimura, Eri Nishioka, and Shin-Ichi Nishikawa Department of Molecular
More informationSupporting Information
Supporting Information CD200 Expressing Human Basal Cell Carcinoma Cells Initiate Tumor Growth Chantal S Colmont 1, Antisar BenKetah 1, Simon H Reed 2, Nga Voong 3, William Telford 3, Manabu Ohyama 4,
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationMelanin 6/22/2009. Group of compounds that serves predominantly as pigment.
Tessa Sinnige Liliana Joachín-Rodríguez Directed by: David Egan Melanin Group of compounds that serves predominantly as pigment. Pheomelanin (red/yellow) * Eumelanin (brown/black) * Neuromelanin (dark
More informationHCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation
SUPPLEMENTARY INFORMATION Materials and Methods Human cell lines and culture conditions HCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation in exon 20 of BRCA1
More informationLuisant Mela X Free from AGEs-Induced Epidermal Pigmentation
Free from -Induced Epidermal Pigmentation Find plant extract solution with NEW APPROACH TO FIGHT AGAINST MELANOGENESIS Skin Pigmentation Many people have been striving to obtain lighter, brighter and healthier-looking
More informationTo determine the effect of over-expression and/or ligand activation of. PPAR / on cell cycle, cell lines were cultured as described above until ~80%
Supplementary Materials and Methods Cell cycle analysis To determine the effect of over-expression and/or ligand activation of PPAR / on cell cycle, cell lines were cultured as described above until ~80%
More informationSupplementary Figure 1. Identification of tumorous sphere-forming CSCs and CAF feeder cells. The LEAP (Laser-Enabled Analysis and Processing)
Supplementary Figure 1. Identification of tumorous sphere-forming CSCs and CAF feeder cells. The LEAP (Laser-Enabled Analysis and Processing) platform with laser manipulation to efficiently purify lung
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationThe Beauty of the Skin
The Beauty of the Skin Rose-Anne Romano, Ph.D Assistant Professor Department of Oral Biology School of Dental Medicine State University of New York at Buffalo The Big Question How do approximately 50 trillion
More informationImmature organoids appear after hours.
THE ESSENTIALS OF LIFE SCIENCE RESEARCH GLOBALLY DELIVERED Allison Ruchinskas, B.S., and James Clinton, Ph.D. ATCC Cell Systems, Gaithersburg, MD INTRODUCTION Figure 1. Mouse small intestinal organoid
More informationSUPPLEMENTARY INFORMATION. Involvement of IL-21 in the epidermal hyperplasia of psoriasis
SUPPLEMENTARY INFORMATION Involvement of IL-21 in the epidermal hyperplasia of psoriasis Roberta Caruso 1, Elisabetta Botti 2, Massimiliano Sarra 1, Maria Esposito 2, Carmine Stolfi 1, Laura Diluvio 2,
More informationSUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences.
Supplementary Table 2. Antibodies used for Immunofluoresence. Antibody Dilution Source Goat anti-pdx1 1:100 R&D Systems Rabbit anti-hnf6 1:100 Santa Cruz Biotechnology Mouse anti-nkx6.1 1:200 Developmental
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationPBMC from each patient were suspended in AIM V medium (Invitrogen) with 5% human
Anti-CD19-CAR transduced T-cell preparation PBMC from each patient were suspended in AIM V medium (Invitrogen) with 5% human AB serum (Gemini) and 300 international units/ml IL-2 (Novartis). T cell proliferation
More informationMeeting Report. From December 8 to 11, 2012 at Atlanta, GA, U.S.A
Meeting Report Affiliation Department of Transfusion Medicine and Cell Therapy Name Hisayuki Yao Name of the meeting Period and venue Type of your presentation Title of your presentation The 54 th Annual
More informationSupplementary Information
Supplementary Information Figure S1: Follicular melanocytes in the wound peripheral area migrate to the epidermis in response to wounding stimuli. Dorsal skin of Trp2-LacZ mice stained with X-gal and analyzed
More informationRabbit Polyclonal antibody to NFkB p65 (v-rel reticuloendotheliosis viral oncogene homolog A (avian))
Datasheet GeneTex, Inc : Toll Free 1-877-GeneTex (1-877-436-3839) Fax:1-949-309-2888 info@genetex.com GeneTex International Corporation : Tel:886-3-6208988 Fax:886-3-6208989 infoasia@genetex.com Date :
More informationV. 1 STEP BY STEP TO PERFECTLY EVEN SKIN TONE
V. 1 STEP BY STEP TO PERFECTLY EVEN SKIN TONE BRIGHT AND EVEN SKIN TONE NEED Aesthetic models of most cultures involve presenting an even skin tone. Hyperpigmented areas or dark spots appear as signs of
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2535 Figure S1 SOX10 is expressed in human giant congenital nevi and its expression in human melanoma samples suggests that SOX10 functions in a MITF-independent manner. a, b, Representative
More informationSupplementary Information Supplementary Fig. 1. Elevated Usp9x in melanoma and NRAS mutant melanoma cells are dependent on NRAS for 3D growth.
Supplementary Information Supplementary Fig. 1. Elevated Usp9x in melanoma and NRAS mutant melanoma cells are dependent on NRAS for 3D growth. a. Immunoblot for Usp9x protein in NRAS mutant melanoma cells
More informationSupplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts
Supplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts (TIG-3 cells) were rendered senescent by either serial passage
More informationSupplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.
More informationSupplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION
Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION X. Shawn Liu 1, 3, Bing Song 2, 3, Bennett D. Elzey 3, 4, Timothy L. Ratliff 3, 4, Stephen F. Konieczny
More information(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment
SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationDifferentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell
Differentiation-induced Changes of Mediterranean Fever Gene (MEFV) Expression in HL-60 Cell Wenxin Li Department of Biological Sciences Fordham University Abstract MEFV is a human gene that codes for an
More informationSupplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway
Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.
More informationExosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway
Exosomes/tricalcium phosphate combination scaffolds can enhance bone regeneration by activating the PI3K/Akt signalling pathway Jieyuan Zhang, Xiaolin Liu, Haiyan Li, Chunyuan Chen, Bin Hu, Xin Niu, Qing
More information:1c.c :& Preliminary and Short Report GRANULE FORMATION IN THE LANGERHANS CELL* structure with rounded ends and a striated lamella
THE JOURNAL OF INVESTIGATIVE DERMATOLOGY Copyright 1566 by The Williams & Wilkins Co. Vol. 7, No. 5 Printed in U.S.A. Preliminary and Short Report GRANULE FORMATION IN THE LANGERHANS CELL* ALVIN S. ZELICKSON,
More informationSUPPLEMENTARY INFORMATION
b 350 300 250 200 150 100 50 0 E0 E10 E50 E0 E10 E50 E0 E10 E50 E0 E10 E50 Number of organoids per well 350 300 250 200 150 100 50 0 R0 R50 R100 R500 1st 2nd 3rd Noggin 100 ng/ml Noggin 10 ng/ml Noggin
More informationEffective activity of cytokine-induced killer cells against autologous metastatic melanoma including cells with stemness features
Effective activity of cytokine-induced killer cells against autologous metastatic melanoma including cells with stemness features Loretta Gammaitoni, Lidia Giraudo, Valeria Leuci, et al. Clin Cancer Res
More informationNature Immunology: doi: /ni Supplementary Figure 1. Huwe1 has high expression in HSCs and is necessary for quiescence.
Supplementary Figure 1 Huwe1 has high expression in HSCs and is necessary for quiescence. (a) Heat map visualizing expression of genes with a known function in ubiquitin-mediated proteolysis (KEGG: Ubiquitin
More informationThawing MEFs (Mouse Embryonic Fibroblasts (MEFs)
1 FEEDER CULTURES The function of feeder cultures is to support the undifferentiated growth of hpsc. Typically primary fibroblasts are used for this purpose. We prepare our mouse feeder cells from ICR
More informationMTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)
Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum
More informationFigure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.
Figure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.129-Gt(ROSA)26Sor tm1(cre/ert2)tyj /J mice. To induce deletion of the Pten locus,
More informationData Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538
Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538 Background: TIGIT is a co-inhibitory receptor that is highly expressed in Natural Killer (NK) cells, activated CD4+, CD8+ and regulatory
More informationResident cardiac stem cells: how to find and use them
Resident cardiac stem cells: how to find and use them G. Hasenfuß Cardiology and Pneumology Heart Research Center Göttingen Georg-August-University Göttingen Definition: Stem cell Selfrenewal Stem cell
More informationImpact of hyper-o-glcnacylation on apoptosis and NF-κB activity SUPPLEMENTARY METHODS
SUPPLEMENTARY METHODS 3D culture and cell proliferation- MiaPaCa-2 cell culture in 3D was performed as described previously (1). Briefly, 8-well glass chamber slides were evenly coated with 50 µl/well
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationFurther studies on the melanophores of periodic albino mutant of Xenopus laevis
J. Embryol. exp. Morph. 91, 65-78 (1986) 65 Printed in Great Britain The Company of Biologists Limited 1986 Further studies on the melanophores of periodic albino mutant of Xenopus laevis T. FUKUZAWA AND
More informationSerafino et al. Thymosin α1 activates complement receptor-mediated phagocytosis in human monocyte-derived macrophages. SUPPLEMENTARY FIGURES
Supplementary Fig. S1. Evaluation of the purity and maturation of macrophage cultures tested by flow cytometry. The lymphocytic/monocytic cellular fraction was isolated from buffy coats of healthy donors
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationSUPPLEMENTAL INFORMATION FOR. PAX7 expression defines germline stem cells in the adult testis
SUPPLEMENTAL INFORMATION FOR PAX7 expression defines germline stem cells in the adult testis Gina M. Aloisio, Yuji Nakada, Hatice D. Saatcioglu, Christopher G. Peña, Michael D. Baker, Edward D. Tarnawa,
More informationFig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4
Fig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4 (n=3 independent differentiation experiments for each
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationRNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using
Supplementary Information Materials and Methods RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Trizol reagent (Invitrogen,Carlsbad, CA) according to the manufacturer's instructions.
More informationHepatogenesis I Liver development
Hepatogenesis I Liver development HB 308 George Yeoh Room 2.59 MCS Building yeoh@cyllene.uwa.edu.au Topics Early liver development Tissue interaction - role of morphogens and cytokines Liver enriched transcription
More informationSupplemental Data. Wnt/β-Catenin Signaling in Mesenchymal Progenitors. Controls Osteoblast and Chondrocyte
Supplemental Data Wnt/β-Catenin Signaling in Mesenchymal Progenitors Controls Osteoblast and Chondrocyte Differentiation during Vertebrate Skeletogenesis Timothy F. Day, Xizhi Guo, Lisa Garrett-Beal, and
More informationstem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products
stem cell products Basement Membrane Matrix Products Rat Mesenchymal Stem Cell Growth and Differentiation Products Stem Cell Qualified Extracellular Matrix Proteins Stem cell research requires the finest
More informationFigure 1. Growth characteristics of GLI2 expressing cells in monolayer culture (A) Expression of GLI2 and downstream targets GLI1 and PTCH in control
Figure 1. Growth characteristics of GLI2 expressing cells in monolayer culture (A) Expression of GLI2 and downstream targets GLI1 and PTCH in control HaCaT Tet, uninduced HaCaT GLI2 and induced HaCaT GLI2
More informationSupplemental Figure 1 ELISA scheme to measure plasma total, mature and furin-cleaved
1 Supplemental Figure Legends Supplemental Figure 1 ELISA scheme to measure plasma total, mature and furin-cleaved PCSK9 concentrations. 4 Plasma mature and furin-cleaved PCSK9s were measured by a sandwich
More informationSupplemental Information. Tissue Myeloid Progenitors Differentiate. into Pericytes through TGF-b Signaling. in Developing Skin Vasculature
Cell Reports, Volume 18 Supplemental Information Tissue Myeloid Progenitors Differentiate into Pericytes through TGF-b Signaling in Developing Skin Vasculature Tomoko Yamazaki, Ani Nalbandian, Yutaka Uchida,
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationPhospho-AKT Sampler Kit
Phospho-AKT Sampler Kit E 0 5 1 0 0 3 Kits Includes Cat. Quantity Application Reactivity Source Akt (Ab-473) Antibody E021054-1 50μg/50μl IHC, WB Human, Mouse, Rat Rabbit Akt (Phospho-Ser473) Antibody
More informationGeneral Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:
General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems
More informationHematopoiesis. - Process of generation of mature blood cells. - Daily turnover of blood cells (70 kg human)
Hematopoiesis - Process of generation of mature blood cells - Daily turnover of blood cells (70 kg human) 1,000,000,000,000 total cells 200,000,000,000 red blood cells 70,000,000,000 neutrophils Hematopoiesis
More informationExperience The Magic of Science. DermaPep UL. Multi-functional whitening active. Experience the magic of science
Experience The Magic of Science Multi-functional whitening active DermaP ep Experience the magic of science Anti-aging DermaPep A35 DermaPep A42 DermaPep A44 DermaPep A53 Whitening DermaPep A35 DermaPep
More informationNSCs), broblast growth factor, bfgf) ( Peprotech ) ; NSCs
Chinese Journal of Pathophysiology 2003,19 (3) :289-292 289 [ ] 1000-4718 (2003) 03-0289 - 04 3 1, 1, 2, 1, 1, 1, 1, 2 ( 1, 2, 510060) [ ] :( ESCs) (NSCs) : ESCs, m ller,nscs 7 d,, RT - PCR nestin glutaminase
More informationMATERIALS AND METHODS. Neutralizing antibodies specific to mouse Dll1, Dll4, J1 and J2 were prepared as described. 1,2 All
MATERIALS AND METHODS Antibodies (Abs), flow cytometry analysis and cell lines Neutralizing antibodies specific to mouse Dll1, Dll4, J1 and J2 were prepared as described. 1,2 All other antibodies used
More information(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
More information(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC,
Supplemental Figure Legends Figure S1. Cell line characterization (A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, green) and co-stained with DAPI to visualize the nuclei.
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Human cerebral cortex development from pluripotent stem cells to functional excitatory synapses Yichen Shi 1,2, Peter Kirwan 1,2, James Smith 1,2, Hugh P.C. Robinson 3 and Frederick
More informationThe site of action of the ichthyosis locus (ic) in the mouse, as determined by dermal-epidermal recombinations
/. Embryol. exp. Morph. Vol. 32, 3, pp. 715-721, 1974 715 Printed in Great Britain The site of action of the ichthyosis locus (ic) in the mouse, as determined by dermal-epidermal recombinations BY MARGARET
More informationEML Erythroid and Neutrophil Differentiation Protocols Cristina Pina 1*, Cristina Fugazza 2 and Tariq Enver 3
EML Erythroid and Neutrophil Differentiation Protocols Cristina Pina 1*, Cristina Fugazza 2 and Tariq Enver 3 1 Department of Haematology, University of Cambridge, Cambridge, UK; 2 Dipartimento de Biotecnologie
More informationSoft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v)
SUPPLEMENTARY MATERIAL AND METHODS Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v) top agar (LONZA, SeaKem LE Agarose cat.5004) and plated onto 0.5% (w/v) basal agar.
More informationAnti-ceramide Antibody Prevents the Radiation GI Syndrome in Mice
Anti-ceramide Antibody Prevents the Radiation GI Syndrome in Mice Jimmy A. Rotolo 1, Branka Stancevic 1, Jianjun Zhang 1, Guoqiang Hua 1, John Fuller 1, Xianglei Yin 1, Adriana Haimovitz-Friedman 2, Kisu
More informationANAT3231: lectures overview
ANAT3231: lectures overview Stem Cell Biology Stem Cell Technology Resources: http://php.med.unsw.edu.au/cell biology/ Essential Cell Biology 3 rd edition Alberts Dr Annemiek Beverdam School of Medical
More informationEdinburgh Research Explorer
Edinburgh Research Explorer MGF (KIT ligand) is a chemokinetic factor for melanoblast migration into hair follicles Citation for published version: Jordan, SA & Jackson, IJ 2000, 'MGF (KIT ligand) is a
More informationNotch Signaling Pathway Notch CSL Reporter HEK293 Cell line Catalog #: 60652
Notch Signaling Pathway Notch CSL Reporter HEK293 Cell line Catalog #: 60652 Background The Notch signaling pathway controls cell fate decisions in vertebrate and invertebrate tissues. Notch signaling
More informationData Sheet. NFAT Reporter (Luc) Jurkat Cell line Catalog #: 60621
Data Sheet NFAT Reporter (Luc) Jurkat Cell line Catalog #: 60621 Background The nuclear factor of activator T cells (NFAT) family of transcription factors plays an important role in immune response. T
More informationPer Fessé, a,b,1 Fredrik Qvarnström, b Jan Nyman, c Ingegerd Hermansson, c Johan Ahlgren d and Ingela Turesson b
RADIATION RESEARCH 191, 93 106 (2019) 0033-7587/19 $15.00 Ó2019 by Radiation Research Society. All rights of reproduction in any form reserved. DOI: 10.1667/RR15078.1 UV-Radiation Response Proteins Reveal
More informationCellular Physiology and Biochemistry
Original Paper 2015 The Author(s). 2015 Published The Author(s) by S. Karger AG, Basel Published online: November 27, 2015 www.karger.com/cpb Published by S. Karger AG, Basel 2194 1421-9778/15/0376-2194$39.50/0
More informationSupplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right
More informationSupplemental Data Macrophage Migration Inhibitory Factor MIF Interferes with the Rb-E2F Pathway
Supplemental Data Macrophage Migration Inhibitory Factor MIF Interferes with the Rb-E2F Pathway S1 Oleksi Petrenko and Ute M. Moll Figure S1. MIF-Deficient Cells Have Reduced Transforming Ability (A) Soft
More informationSupplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse
Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:1.138/nature11463 %Sox17(+) 9 8 7 6 5 4 3 2 1 %Sox17(+) #Sox17(+) d2 d4 d6 d8 d1 d12 d14 d18 25 2 15 1 5 Number of Sox17(+) cells X 1 Supplementary Figure 1: Expression of
More informationSupplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression
Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan
More informationSupplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated,
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated, embedded in matrigel and exposed
More informationANAT3231: lectures overview
ANAT3231: lectures overview Stem Cell Biology Stem Cell Technology Resources: http://php.med.unsw.edu.au/cell biology/ Essential Cell Biology 3 rd edition Alberts Dr Annemiek Beverdam School of Medical
More information3-O-Ethyl Ascorbic Acid: A Stable, Vitamin C-Derived Agent for Skin Whitening
Formulating http://www.cosmeticsandtoiletries.com/formulating/function/active/ premium-3-o-ethyl-ascorbic-acid-a-stable-vitamin-c-derived- Agent-for-Skin-Whitening-225540872.html?c=n 3-O-Ethyl Ascorbic
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES
More informationFluorescence Microscopy
Fluorescence Microscopy Imaging Organelles Mitochondria Lysosomes Nuclei Endoplasmic Reticulum Plasma Membrane F-Actin AAT Bioquest Introduction: Organelle-Selective Stains Organelles are tiny, specialized
More informationp47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO
Supplementary Information p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO Yuri Shibata, Masaaki Oyama, Hiroko Kozuka-Hata, Xiao Han, Yuetsu Tanaka,
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationProduction of Exosomes in a Hollow Fiber Bioreactor
Production of Exosomes in a Hollow Fiber Bioreactor John J S Cadwell, President and CEO, FiberCell Systems Inc INTRODUCTION Exosomes are small lipid membrane vesicles (80-120 nm) of endocytic origin generated
More informationProcaspase-3. Cleaved caspase-3. actin. Cytochrome C (10 M) Z-VAD-fmk. Procaspase-3. Cleaved caspase-3. actin. Z-VAD-fmk
A HeLa actin - + + - - + Cytochrome C (1 M) Z-VAD-fmk PMN - + + - - + actin Cytochrome C (1 M) Z-VAD-fmk Figure S1. (A) Pan-caspase inhibitor z-vad-fmk inhibits cytochrome c- mediated procaspase-3 cleavage.
More informationab Adipogenesis Assay Kit (Cell-Based)
ab133102 Adipogenesis Assay Kit (Cell-Based) Instructions for Use For the study of induction and inhibition of adipogenesis in adherent cells. This product is for research use only and is not intended
More informationInternational Graduate Research Programme in Cardiovascular Science
1 International Graduate Research Programme in Cardiovascular Science This work has been supported by the European Community s Sixth Framework Programme under grant agreement n LSHM-CT-2005-01883 EUGeneHeart.
More informationSupplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were
Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were isolated from wild type (PKC-θ- WT) or PKC-θ null (PKC-θ-KO)
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationCell Lysis Buffer. Catalog number: AR0103
Cell Lysis Buffer Catalog number: AR0103 Boster s Cell Lysis Buffer is a ready-to-use Western blot related reagent solution used for efficient extraction of total soluble protein in nondenatured state
More informationSupplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each
Supplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each species observed. Data show a binary response to a 4 mm
More information