Supporting Information

Size: px
Start display at page:

Download "Supporting Information"

Transcription

1 Supporting Information Shirazi et al /pnas SI Materials and Methods Brain Surgery: Rats. A lateral ventricle (LV) guide cannula was positioned and attached to the skull with dental acrylic and jeweler s screws and closed with an obturator, as described previously (1, 2). Briefly, a lateral ventricular guide cannula [26 gauge (Plastics One); coordinates: ±1.6 from the midline, 0.9 mm posterior to bregma, and 2.0 mm ventral to dura mater, with injector aimed 4.0 mm ventral to the dura) was implanted under ketamine/xylazine anesthesia. The cannula placement was verified before behavioral studies commenced with the angiotensin II (Tocris) drinking test (angiotensin II dose: 10 ng/1 μl, 2-μL injection bolus). Only the rats that passed the inclusion criteria were included in the study. Telemetric Transponder Surgery. For recording core body temperature and spontaneous physical activity, rats were implanted with telemetric transponders (G2 VitalView; Mini Mitter/Respironics) as described previously. Transponders were inserted into the abdominal cavity and secured to the abdominal muscles with sutures. The use of this telemetric system allows for continuous (every 5 min) measurements without any disturbance or stress to the animal. Interaction of Central GLP-1 Receptors Stimulation Effect on Food Intake, Body Weight, and Temperature with IL-6 and IL-1β. To determine whether signaling at the IL-1R or IL-6 (or the combination of the two) is mediating the anorexic, body weight-suppressing, and thermoregulatory effects of central glucagon-like peptide 1 (GLP-1) receptor (GLP-1R) stimulation, rats received four counterbalanced injection conditions over 4 experimental days: (i) vehicle for IL-1Ra artificial cerebrospinal fluid (acsf) + vehicle for exendin-4 (EX4) (acsf); (ii) vehicle for IL-1Ra + EX4 0.2 μg/ 1 μl; (iii) IL-1Ra 1 μg/1 μl + EX4 0.2 μg/1 μl; and (iv) IL-1Ra + vehicle for EX4. For the determination of IL-6 mediation, rats received the following four counterbalanced conditions: (i) vehicle for IL-6ab (acsf) + vehicle for EX4 (acsf); (ii) vehicle for IL-6ab + EX4 0.2 μg/1 μl; (iii) IL-6ab 0.05 μg/1 μl + EX4 0.2 μg/1 μl; and (iv) IL-6ab+ vehicle for EX4. Body temperature and spontaneous activity were measured telemetrically every 5 min and plotted for a period of 4 h. Food intake was measured at 1, 2, 4, and 22 h after injection. Body weight was measured just before injection and 22 h postinjection. The light cycle period was chosen for the temperature measurement because previous studies indicated that the hypothermic effect of EX4 can be best captured during this period for the rat (3, 4). IL-1Ra dose was previously shown to attenuate IL-1β induced fever in the preoptic area of the hypothalamus (5).The same dose and route of administration of IL-6ab used here were previously shown to reduce leptin s and insulin s effects on food intake (6). To determine whether cooperative action of IL-1 and IL-6 is required, the following conditions were used: (i) vehicle for IL-1Ra + vehicle for IL-6ab (acsf) + vehicle for EX4 (acsf); (ii) vehicle for IL-1Ra + vehicle for IL-6ab + EX4 0.2 μg/ 1 μl; (iii) IL-1Ra with IL-6ab + EX4 0.2 μg/1 μl; and (iv)il-1ra+ IL-6ab + vehicle for EX4. RNA Isolation and mrna Expression. Hypothalamic and hindbrain gene expression levels after lateral ventricle injection of the GLP-1 analog, EX4, or vehicle (acsf) in two separate groups of rats as previously described (2). One group was restricted to 10 g ( 50% of average overnight intake) of chow overnight, and the second was allowed to eat ad libitum. The cytokines measured were the following: IL-1β, IL-6, TNFα, and TGF-β1. The neuropeptides measured included Pomc, neuropeptide Y (Npy), choleocystokinin (Cck), melanocortin 4 receptor (Mc4r), and leptin receptor (Lepr). Ninety minutes after EX4 injection the brains were rapidly removed, and the hypothalamus, the hindbrain (cut just caudal to the ventral tegmental area), and the hippocampus were dissected using a brain matrix, frozen in liquid nitrogen and stored at 80 C for later determination of mrna expression. The extraction of the mrna, cdna synthesis, RT-PCR, and gene expression values were calculated as previously described (2). Individual brain samples were homogenized in Qiazol (Qiagen) using a TissueLyzer (Qiagen). Total RNA was extracted using RNeasy Lipid Tissue Mini Kit (Qiagen) with additional DNase treatment (Qiagen). RNA quality and quantity were assessed by spectrophotometric measurements (Nanodrop 1000, NanoDrop Technologies). For cdna synthesis, iscript cdna Synthesis kit (BioRad) was used. Real-time RT-PCR was performed using TaqMan probe, and primer sets for target genes were chosen from an on-line catalog (Applied Biosystems; reference numbers were as follows: Il1b- Rn _m1, Il6-Rn _m1, Tnf-Rn _g1, Tgfb1- Rn _m1). Gene expression values were calculated based on the ΔΔC t method (7), where the vehicle-injected group was designated as the calibrator. β-actin was used as the reference gene. Western Blot Analysis. Thirty minutes after EX4 injection the brains were rapidly removed, and the hypothalamus and a DVCenriched section of the hindbrain were dissected using a brain matrix, frozen in liquid nitrogen, and stored at 80 C. Wholetissue extracts for protein preparations and Western blot analyses were carried out as described (8). Protein concentrations were determined with the Bradford assay. Laemmli loading buffer (1 ) was added to the samples, which were boiled for 10 min and fractionated by gel electrophoresis on 4 12% (vol/vol) Bis Tris gels (Invitrogen). Nonspecific protein binding sites on the polyvinyldifluoride membranes (Amersham International) were blocked by incubating the membrane with 5% (wt/vol) nonfat milk in TBS Tween 20 buffer (10 mm Tris, 150 mm NaCl, and 0.1% Tween 20, ph 8.0) for 4 h. Blots generated with these extracts were probed with primary antibodies (Table S1) overnight at 4 C. The membranes were washed three times for 5 min each in TBS 0.05% Tween 20 and incubated with secondary antibodies (Table S1) for 2 h. Protein bands were visualized with SuperSignal West Dura Extended Duration Substrate (34076; Thermo Scientific, Pierce Biotechnology). To reprobe the blot with another antibody, the blot was rehydrated in methanol, rinsed in TBS, and incubated with stripping buffer (46430; Thermo Scientific) for 15 min. Immunoblotted signals were visualized with an LAS 1000 cooled charge-coupled device camera (Fuji Film). Individual bands were quantified directly from membranes by densitometry with Image Gauge software (Fuji Film). Proper loading was evaluated by staining the gels with Coomassie blue. All steps were carried out at room temperature unless otherwise stated. All targets chosen (Table S1, primary antibodies) were previously connected to IL-1β, IL-6, or both (9 11). Mouse Strains Used. All mice [IL-1 R1 KO, WT, and IL-6Ra fl/fl ] were purchased from The Jackson Laboratory. All mice used in the experiments were males. IL-1R KO Mice. The following IL-1R KO mice were used: strain name B6.129S7-Il1r1 tm1imx /J; stock no ; age at delivery 7 8 wk; and age at start of experiment 8 9 wk. 1of7

2 WT Mice. The following WT mice were used: strain name C57BL/6J; stock no: ; age at delivery 8 wk; and age at start of experiment 9 wk. IL-6Rα fl/fl Mice. The following IL-6Rα fl/fl mice were used: strain name B6;SJL-Il6ra tm1.1drew /J and stock no Brain IL-6R Knockdown. The IL-6Rα fl/fl mice were purchased from The Jackson Laboratory in October 2011 and were bred for five generations in the animal facility of the University of Gothenburg. At the time of the Tat-cre injection in the lateral ventricle, they were 5 mo (body weight: g). A Tat-Cre fusion protein, synthesized as described (12), was stereotaxically infused to the lateral ventricle (1.5 μl over 5 min, 2.1 mg/ml; anteroposterior, 0.3 mm bregma, 1.0 mm lateral, 2.5 mm dorsal ventral) according to a previously described protocol (13) to 5-mo-old male isoflurane anesthetized mice that were homozygously floxed for IL-6Rα (strain B6; SJL-Il6ra tm1.1drew ) (14) and purchased from The Jackson Laboratory. Control mice (also B6; SJL-Il6ra tm1.1drew ) were infused with vehicle (saline). Tomato expression was decreased in cells surrounding the ventricles following treatment with Tat-cre according to a similar protocol in dttomato loxp/+ mice (Fig. S4). In Vitro Treatment of Neuro2A Cells. Neuro2A neuroblastoma cells (American Type Culture Collection no. CCL-131) that express the GLP-1R were maintained at 37 C in 5% CO 2 and cultured in DMEM with 1 mg/ml glucose (Biochrom AG), 10% (vol/vol) FBS (Biochrom AG), and 1% nonessential amino acids (Biochrom AG). Cells were treated with EX4 (0 or 10 nm) for 15 or 45 min, respectively. At the end of the incubation RNA was isolated for quantitative real-time PCR to detect IL-6, whereas a β-actin expression assay (15) was used as endogenous control. SI Results Additional Statistical Analysis Details for Fig. 3 in Main Text. IL-6 antibody (ab) attenuates food intake and weight loss responses to intracerebroventricular injection of EX4. Anorexic response to central EX4 after 4 h of food access was not altered by IL-6 blockade (Fig. 3A). Two-way ANOVA revealed no interaction but one-way ANOVA [F(3,45) = 42.06, P < ] showed a significant effect of treatment. Post hoc Tukey test revealed a significant effect of EX4 alone (P < 0.005) and of EX4/IL-6ab (P < 0.005) combination to reduce 4-h chow intake. In contrast, the 22-h (overnight) food intake was abolished by the IL-6ab treatment (Fig. 3B). The IL-6ab administration led to a complete reversal of the EX4-induced anorexia (one-way ANOVA [F (3,45) = 15.85, P < ; P < for EX4 alone and P = not significant (ns) for EX4/IL-6ab combination]. Comparison of the EX4 alone and EX4/IL-6ab groups indicated a significant difference (P < 0.05). Two-way ANOVA indicated a strong trend for an interaction [F(1,60) = 3.00, P = 0.08]. Similarly, the EX4- induced weight loss was significantly attenuated by IL-6ab (Fig. 3C). One-way ANOVA was F(3,45) = 17.65, P < ; P < for EX4 alone; and P < 0.01 for EX4/IL-6ab combination. Further comparison of the EX4 alone and EX4/IL-6ab groups indicated a significant difference between these two treatments (P < 0.05). Two-way ANOVA indicated a significant interaction [F(1,60) = 3.68, P = 0.05]. Also, IL-1Ra attenuates food intake and weight loss responses to i.c.v. injection of EX4. Anorexic response to central EX4 after 4 h of food access was not altered by IL-1R blockade (Fig. 3D). Two-way ANOVA revealed no interaction, and post hoc Tukey test after a one-way ANOVA [F (3,33) = 12.82, P < ] showed a significant reduction in food intake after both EX4 (P < 0.005) and EX4/ IL-1Ra (P < 0.05) combination. In contrast, the 22-h (overnight) food intake was abolished by the IL-1Ra treatment (Fig. 3E), and blockade of IL-1R led to a complete reversal of the EX4-induced anorexia [one-way ANOVA: F(3,33) = 10.26, P < ; P < for EX4 alone and P = ns for EX4/IL-1Ra combination compared with vehicle-treated rats]. Comparison of the EX4 alone and EX4/IL-1βRa groups indicated a significant difference (P < 0.05). Two-way ANOVA revealed a significant interaction of EX4 with the antagonist [F(1,44) = 3.73, P = 0.05]. Similarly, the EX4-induced weight loss was significantly attenuated by IL-1Ra (Fig. 3F). Blockade of the IL-1R also led to a complete reversal of the EX4-induced weight loss [one-way ANOVA: F(3,33) = 19.20, P < ; P < for EX4 alone and P = ns for EX4/ IL-1Ra combination compared with vehicle-treated rats]. Further comparison of the body weight changes after the EX4 alone and EX4/IL-1Ra groups indicated a significant difference (P < 0.005). Two-way ANOVA indicated a significant interaction [F (1,44) = 7.15, P < 0.05]. Data are expressed as mean ± SEM. n = 12 16/treatment condition. *P < 0.05, **P < 0.01, ***P < Additional Statistical Analysis Details for Fig. 4 in Main Text. Simultaneous IL-1R and IL-6 blockade synergistically attenuates food intake and weight loss responses to i.c.v. injection of EX4. Anorexic response to central EX4 after 1 h (Fig. 4A), 4 h (Fig. 4B), and 22 h (Fig. 4C) were significantly attenuated by the combination of IL-1Ra and IL-6ab treatment. Similarly, the EX4-induced weight loss was significantly attenuated by this combination treatment (Fig. 4D). Two-way ANOVA revealed a significant interaction: F(1,40) = 5.37, P < 0.05 for 1-h intake, F(1,40) = 3.78, P < 0.05 for 4-h intake, and F(1,40) = 6.77, P < 0.05 for 22-h intake. Also one-way ANOVA [F(3,30) = 83.94, P < , F (3,30) = 82.05, P < and F(3,30) = 33.77, P < for 1-, 4-, and 22-h intake, respectively] showed a significant effect of treatment. Post hoc tests revealed a significant effect of EX4 alone (P < for all: 1, 4, and 22 h) and the EX4/(IL-1Ra+IL-6ab) combination (P < for both 1 and 4 h and P < 0.05 for 22 h) to reduce chow intake. Importantly, however, the comparison of the EX4 alone and the EX4/(IL-1Ra+IL-6ab) groups indicated a significant difference (P < 0.05 for 1-h intake, P < 0.01 for 4-h intake, and P < for 22-h intake). The combined interleukin blockade was successful at attenuating the EX4-induced weight loss [one-way ANOVA: F(3,30) = 36.18, P < ; P < for EX4 alone; and P < 0.05 for EX4/(IL-1βRant+IL-6ab) combination). The comparison of the EX4 alone and EX4/(IL-1βRa+ IL-6ab) groups indicated a significant difference (P < 0.005), and two-way ANOVA indicated a significant interaction [F(1,40) = 16.86, P < ]. Data are expressed as mean ± SEM. n = 11/ treatment condition. *P < 0.05, **P < 0.01, ***P < Skibicka KP, Hansson C, Alvarez-Crespo M, Friberg PA, Dickson SL (2011) Ghrelin directly targets the ventral tegmental area to increase food motivation. Neuroscience 180: Skibicka KP, Hansson C, Egecioglu E, Dickson SL (2012) Role of ghrelin in food reward: Impact of ghrelin on sucrose self-administration and mesolimbic dopamine and acetylcholine receptor gene expression. Addict Biol 17(1): Skibicka KP, Alhadeff AL, Grill HJ (2009) Hindbrain cocaine- and amphetamineregulated transcript induces hypothermia mediated by GLP-1 receptors. J Neurosci 29(21): Hayes MR, Skibicka KP, Grill HJ (2008) Caudal brainstem processing is sufficient for behavioral, sympathetic, and parasympathetic responses driven by peripheral and hindbrain glucagon-like-peptide-1 receptor stimulation. Endocrinology 149(8): Fabricio AS, et al. (2006) Interleukin-1 mediates endothelin-1-induced fever and prostaglandin production in the preoptic area of rats. Am J Physiol Regul Integr Comp Physiol 290(6):R1515 R Flores MB, et al. (2006) Exercise improves insulin and leptin sensitivity in hypothalamus of Wistar rats. Diabetes 55(9): Livak KJ, Schmittgen TD (2001) Analysis of relative gene expression data using realtime quantitative PCR and the 2(-Delta Delta C(T)) method. Methods 25(4): Shao R, et al. (2012) Coordinate regulation of heterogeneous nuclear ribonucleoprotein dynamics by steroid hormones in the human fallopian tube and endometrium in vivo and in vitro. Am J Physiol Endocrinol Metab 302(10):E1269 E Wang J, Campbell IL (2002) Cytokine signaling in the brain: Putting a SOCS in it? J Neurosci Res 67(4): of7

3 10. Linossi EM, Babon JJ, Hilton DJ, Nicholson SE (2013) Suppression of cytokine signaling: The SOCS perspective. Cytokine Growth Factor Rev 24(3): Venieratos PD, Drossopoulou GI, Kapodistria KD, Tsilibary EC, Kitsiou PV (2010) High glucose induces suppression of insulin signalling and apoptosis via upregulation of endogenous IL-1beta and suppressor of cytokine signalling-1 in mouse pancreatic beta cells. Cell Signal 22(5): Peitz M, Pfannkuche K, Rajewsky K, Edenhofer F (2002) Ability of the hydrophobic FGF and basic TAT peptides to promote cellular uptake of recombinant Cre recombinase: A tool for efficient genetic engineering of mammalian genomes. Proc Natl Acad Sci USA 99(7): Langlet F, et al. (2013) Tanycytic VEGF-A boosts blood-hypothalamus barrier plasticity and access of metabolic signals to the arcuate nucleus in response to fasting. Cell Metab 17(4): McFarland-Mancini MM, et al. (2010) Differences in wound healing in mice with deficiency of IL-6 versus IL-6 receptor. J Immunol 184(12): Hesse D, et al. (2010) Altered GLUT4 trafficking in adipocytes in the absence of the GTPase Arfrp1. Biochem Biophys Res Commun 394(4): Fig. S1. EX4 did not change the hippocampal IL-1 expression. The histograms represent the mrna levels of cytokines in ad-libitum fed and food-restricted rats following i.c.v. EX4 treatment. Data are normalized to β-actin and expressed as relative quantity compared with vehicle treatment. n = 9 11/treatment condition. Data are expressed as mean ± SEM. 3of7

4 Fig. S2. Activity is expressed here on a line graph as a group average for each treatment (A, C, ande). In the IL-6 blockade experiment a small but significant elevation in activity was observed when the data were expressed as 2.5-h postinjection sums [one-way ANOVA F(3,45) = 4.15, P < 0.05; two-way ANOVA: F(1,60) = 7.06, P < 0.05]. This hyperactivity seemed to be blocked by the IL-6ab (B). None of the treatments changed the activity expressed here on a line graph as a group average for each treatment (C and E) or histogram of 2.5-h postinjection sum (D and F) in the IL-1 or combination blockade experiments. Data are expressed as mean ± SEM. n = 16 (A and B), n = 12 (C and D), and n = 11 (E and F)/treatment condition. *P < of7

5 Fig. S3. Core temperature after central EX4 alone and in combination with IL-6ab or IL-1βRa. Fast onset and long-lasting hypothermia was observed after i.c.v. injection of EX4 and IL-6 or IL-1β blockade did not change this response (A and C). Body temperature differed significantly across the four treatments [F(3, 45) = P < (Fig. 4B), F(3, 33) = 24.41, P < ]. Post hoc Tukey comparisons of the four groups indicated that both EX4 (P < 0.005) and EX4/IL-6ab (P < 0.005) produced a significant hypothermia (B). Similarly, Tukey post hoc comparisons of the four groups indicated that both the EX4 (P < 0.005) and EX4/IL-1βRa (P < 0.01) produced a significant hypothermia (D). Meanwhile, comparison of the EX4 alone and EX4/IL-6ab or EX4 alone and EX4/ IL-1βRa groups did not indicate any significant differences. Furthermore, a two-way ANOVA did not indicate any significant interaction. In contrast to single interleukin blockade, the hypothermia was attenuated by the concurrent IL1R/IL-6 blockade (E and F). Body temperature differed significantly across the four treatments [F(3, 30) = 19.46, P < ] (E and F). Post hoc comparisons of the four groups indicated that both EX4 (P < 0.005) and EX4/(IL-1βRa+IL-6ab) (P < 0.05) produced hypothermia. Comparison of the EX4 alone and EX4/(IL-1a+IL-6ab) groups indicated a significant difference between the two treatments (P < 0.05). Furthermore, a two-way ANOVA indicated a trend for a significant interaction [F(1,40) = 3.69, P = 0.06]. The arrows indicate the injection timing of the antagonist or respective vehicle (first arrow) and the EX4 or respective vehicle (second arrow). The histograms (B, D, and F) represent 2.5-h postinjection averages of core temperature. Data are expressed as mean ± SEM. n = 16 (A and B), n = 12 (C and D), and n = 11 (E and F)/treatment condition. *P < 0.05, **P < 0.01, ***P < of7

6 Fig. S4. Representative images showing tomato expression (red) in cells in dttomatoloxp/+ mice in which the Tat-cre recombinant protein has been infused to the right lateral ventricle to indicate the CNS distribution of cre-mediated knockdown. A general view of the third ventricle (3V) at the level of the praventricular nucleus of the hypothalamus (PVH) (A) and a zoom on the ependymal layer bordering the PVH (B). Hoechst (white) DNA staining and tomato (red) as a marker of tat-cre induced recombination are shown in A and B. RCH, retrochiasmatic area. 6of7

7 Table S1. Antibodies used for Western blot experiments Name Name MW (kda) Dilution (method) Source Primary antibodies Stat3 (catalog #8768) Rabbit monoclonal antibody (IgG) 86 1:1,000 (WB) Cell Signaling Technology Phospho-Stat3 (catalog #9145) Rabbit monoclonal antibody (IgG) 79/86 1:1,000 (WB) Cell Signaling Technology SOCS1 (sc-9021) Rabbit polyclonal antibody (IgG) 24 1:500 (WB) Santa Cruz Biotechnology SOCS2 (sc-9022) Rabbit polyclonal antibody (IgG) 33 1:500 (WB) Santa Cruz Biotechnology β-actin (AC-74) Mouse monoclonal antibody (IgG) 42 1:1,000 (WB) Sigma-Aldrich Secondary antibodies Anti-rabbit IgG HRP-linked antibody (catalog #7074) 1:10,000 (WB) Cell Signaling Technology Anti-mouse IgG HRP-linked antibody (catalog #7076) 1:10,000 (WB) Cell Signaling Technology MW, molecular weight; WB, Western blot analysis. 7of7

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry: General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage

More information

GPR120 *** * * Liver BAT iwat ewat mwat Ileum Colon. UCP1 mrna ***

GPR120 *** * * Liver BAT iwat ewat mwat Ileum Colon. UCP1 mrna *** a GPR120 GPR120 mrna/ppia mrna Arbitrary Units 150 100 50 Liver BAT iwat ewat mwat Ileum Colon b UCP1 mrna Fold induction 20 15 10 5 - camp camp SB202190 - - - H89 - - - - - GW7647 Supplementary Figure

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Supporting Information

Supporting Information Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)

More information

Extended therapeutic validation of an anti-mc4 receptor antibody in an animal model of anorexia nervosa

Extended therapeutic validation of an anti-mc4 receptor antibody in an animal model of anorexia nervosa Extended therapeutic validation of an anti-mc4 receptor antibody in an animal model of anorexia nervosa (project no. 04-12B) Authors Guus Akkermans, Martien Kas Preliminary data report Introduction In

More information

AAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination

AAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination AAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination Supplementary Figure 1. Generation of the adult-onset, liver-specific GH receptor knock-down (alivghrkd, Kd) mouse

More information

Supporting Information

Supporting Information Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween

More information

Rat Leptin-HS ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN

Rat Leptin-HS ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN YK051 Rat Leptin-HS ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN 418 0011 Contents Introduction 2 Characteristics 3 Composition 4 Method 5-6 Notes

More information

Supplementary Materials and Methods

Supplementary Materials and Methods Supplementary Materials and Methods Immunoblotting Immunoblot analysis was performed as described previously (1). Due to high-molecular weight of MUC4 (~ 950 kda) and MUC1 (~ 250 kda) proteins, electrophoresis

More information

Rat Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN

Rat Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN YK050 Rat Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN 418-0011 Contents Introduction 2 Characteristics 3 Composition 4 Method 5-6 Notes

More information

Neurophysiology of the Regulation of Food Intake and the Common Reward Pathways of Obesity and Addiction. Laura Gunter

Neurophysiology of the Regulation of Food Intake and the Common Reward Pathways of Obesity and Addiction. Laura Gunter Neurophysiology of the Regulation of Food Intake and the Common Reward Pathways of Obesity and Addiction Laura Gunter The Brain as the Regulatory Center for Appetite The brain is the integration center

More information

RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using

RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Supplementary Information Materials and Methods RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Trizol reagent (Invitrogen,Carlsbad, CA) according to the manufacturer's instructions.

More information

Online Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2

Online Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Online Data Supplement Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Yi Lin and Zhongjie Sun Department of physiology, college of

More information

The Schedule and the Manual of Basic Techniques for Cell Culture

The Schedule and the Manual of Basic Techniques for Cell Culture The Schedule and the Manual of Basic Techniques for Cell Culture 1 Materials Calcium Phosphate Transfection Kit: Invitrogen Cat.No.K2780-01 Falcon tube (Cat No.35-2054:12 x 75 mm, 5 ml tube) Cell: 293

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

Protein MultiColor Stable, Low Range

Protein MultiColor Stable, Low Range Product Name: DynaMarker Protein MultiColor Stable, Low Range Code No: DM670L Lot No: ******* Size: 200 μl x 3 (DM670 x 3) (120 mini-gel lanes) Storage: 4 C Stability: 12 months at 4 C Storage Buffer:

More information

Figure S1 Time-dependent down-modulation of HER3 by EZN No Treatment. EZN-3920, 2 μm. Time, h

Figure S1 Time-dependent down-modulation of HER3 by EZN No Treatment. EZN-3920, 2 μm. Time, h Figure S1 Time-dependent down-modulation of HER3 by EZN-392 HE ER3 mrna A, %Contr rol 12 No Treatment EZN-392, 2 μm 1 8 6 4 2 2 8 24 Time, h Figure S2. Specific target down-modulation by HER3 (EZN-392)

More information

Protocol for Gene Transfection & Western Blotting

Protocol for Gene Transfection & Western Blotting The schedule and the manual of basic techniques for cell culture Advanced Protocol for Gene Transfection & Western Blotting Schedule Day 1 26/07/2008 Transfection Day 3 28/07/2008 Cell lysis Immunoprecipitation

More information

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan

More information

2.5. AMPK activity

2.5. AMPK activity Supplement Fig. A 3 B phos-ampk 2.5 * Control AICAR AMPK AMPK activity (Absorbance at 45 nm) 2.5.5 Control AICAR Supplement Fig. Effects of AICAR on AMPK activation in macrophages. J774. macrophages were

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains

More information

Supplementary Figure S1. Effect of stress during withdrawal on expression of sensitization to repeated cocaine exposure in WT and D2R / mice.

Supplementary Figure S1. Effect of stress during withdrawal on expression of sensitization to repeated cocaine exposure in WT and D2R / mice. Supplementary Figure S1. Effect of stress during withdrawal on expression of sensitization to repeated cocaine exposure in WT and D2R / mice. The time course of locomotor activity for WT (a, b) or D2R

More information

BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice

BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice SUPPLEMENTARY MATERIALS BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice Elena Corradini, Paul J. Schmidt, Delphine Meynard, Cinzia Garuti, Giuliana

More information

Internal Regulation II Energy

Internal Regulation II Energy Internal Regulation II Energy Reading: BCP Chapter 16 lookfordiagnosis.com Homeostasis Biologically, what is necessary for life is a coordinated set of chemical reactions. These reactions take place in

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with

More information

Supplemental Information. Inhibition of the Proteasome b2 Site Sensitizes. Triple-Negative Breast Cancer Cells

Supplemental Information. Inhibition of the Proteasome b2 Site Sensitizes. Triple-Negative Breast Cancer Cells Cell Chemical Biology, Volume 24 Supplemental Information Inhibition of the Proteasome b2 Site Sensitizes Triple-Negative Breast Cancer Cells to b5 Inhibitors and Suppresses Nrf1 Activation Emily S. Weyburne,

More information

Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein

Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian

More information

Supplementary Information. Glycogen shortage during fasting triggers liver-brain-adipose. neurocircuitry to facilitate fat utilization

Supplementary Information. Glycogen shortage during fasting triggers liver-brain-adipose. neurocircuitry to facilitate fat utilization Supplementary Information Glycogen shortage during fasting triggers liver-brain-adipose neurocircuitry to facilitate fat utilization Supplementary Figure S1. Liver-Brain-Adipose neurocircuitry Starvation

More information

YK052 Mouse Leptin ELISA

YK052 Mouse Leptin ELISA YK052 Mouse Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA-SHI SHIZUOKA, JAPAN 418-0011 Contents Ⅰ. Introduction 2 Ⅱ. Characteristics 3 Ⅲ. Composition 4 Ⅳ. Method

More information

Tanycytes as gatekeepers of the Metabolic Brain

Tanycytes as gatekeepers of the Metabolic Brain Tanycytes as gatekeepers of the Metabolic Brain Vincent Prevot Inserm team Development and Plasticity of the Postnatal Brain Jean-Pierre Aubert Research Centre, U837, Lille France Metabolic signals and

More information

SUPPLEMENTAL MATERIAL. Supplementary Methods

SUPPLEMENTAL MATERIAL. Supplementary Methods SUPPLEMENTAL MATERIAL Supplementary Methods Culture of cardiomyocytes, fibroblasts and cardiac microvascular endothelial cells The isolation and culturing of neonatal rat ventricular cardiomyocytes was

More information

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum

More information

A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS

A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism Arlee Fafalios, Jihong Ma, Xinping Tan, John Stoops, Jianhua Luo, Marie C. DeFrances and Reza Zarnegar

More information

CNS Control of Food Intake. Adena Zadourian & Andrea Shelton

CNS Control of Food Intake. Adena Zadourian & Andrea Shelton CNS Control of Food Intake Adena Zadourian & Andrea Shelton Controlling Food Intake Energy Homeostasis (Change in body adiposity + compensatory changes in food intake) Background Information/Review Insulin

More information

Method of leptin dosing, strain, and group housing influence leptin sensitivity in high-fat-fed weanling mice

Method of leptin dosing, strain, and group housing influence leptin sensitivity in high-fat-fed weanling mice Am J Physiol Regul Integr Comp Physiol 284: R87 R100, 2003; 10.1152/ajpregu.00431.2002. Method of leptin dosing, strain, and group housing influence leptin sensitivity in high-fat-fed weanling mice HEATHER

More information

Supplementary Materials for

Supplementary Materials for immunology.sciencemag.org/cgi/content/full/2/16/eaan6049/dc1 Supplementary Materials for Enzymatic synthesis of core 2 O-glycans governs the tissue-trafficking potential of memory CD8 + T cells Jossef

More information

Central injection of fibroblast growth factor 1 induces sustained remission of diabetic hyperglycemia in rodents

Central injection of fibroblast growth factor 1 induces sustained remission of diabetic hyperglycemia in rodents Central injection of fibroblast growth factor 1 induces sustained remission of diabetic hyperglycemia in rodents Jarrad M Scarlett 1,,1, Jennifer M Rojas 1,1, Miles E Matsen 1, Karl J Kaiyala 3, Darko

More information

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on

More information

Supplementary data Supplementary Figure 1 Supplementary Figure 2

Supplementary data Supplementary Figure 1 Supplementary Figure 2 Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna

More information

Supplementary Figure 1.

Supplementary Figure 1. Supplementary Figure 1. FGF21 does not exert direct effects on hepatic glucose production. The liver explants from C57BL/6J mice (A, B) or primary rat hepatocytes (C, D) were incubated with rmfgf21 (2

More information

Supplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO

Supplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO Supplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO Mice. WT mice and KHK-A/C KO mice were provided drinking water containing 10% glucose or tap water with normal chow ad

More information

Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538

Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538 Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538 Background: TIGIT is a co-inhibitory receptor that is highly expressed in Natural Killer (NK) cells, activated CD4+, CD8+ and regulatory

More information

TFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry

TFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi

More information

Subjects. Thirty-five adult male Lister Hooded rats (Charles River, Kent, UK),

Subjects. Thirty-five adult male Lister Hooded rats (Charles River, Kent, UK), Supplemental Material: Subjects. Thirty-five adult male Lister Hooded rats (Charles River, Kent, UK), weighing between 280 300 g at the beginning of the experiment, were housed singly in holding rooms

More information

Protocol for Western Blo

Protocol for Western Blo Protocol for Western Blo ng SDS-PAGE separa on 1. Make appropriate percentage of separa on gel according to the MW of target proteins. Related recommenda ons and rou ne recipes of separa on/stacking gels

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Supplementary Figure 1 Schematic depiction of the tandem Fc GDF15. Supplementary Figure 2 Supplementary Figure 2 Gfral mrna levels in the brains of both wild-type and knockout Gfral

More information

NF-κB p65 (Phospho-Thr254)

NF-κB p65 (Phospho-Thr254) Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 NF-κB p65 (Phospho-Thr254) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02015 Please read the provided manual

More information

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Supplementary material: Materials and suppliers

Supplementary material: Materials and suppliers Supplementary material: Materials and suppliers Electrophoresis consumables including tris-glycine, acrylamide, SDS buffer and Coomassie Brilliant Blue G-2 dye (CBB) were purchased from Ameresco (Solon,

More information

I. Introduction. II. Characteristics

I. Introduction. II. Characteristics YK050 Rat Leptin ELISA I. Introduction Leptin, which is a product of ob gene, is a protein consisting of 167 amino acids and it is secreted from white adipose tissue. It is known that leptin acts on hypothalamus

More information

Name Animal source Vendor Cat # Dilutions

Name Animal source Vendor Cat # Dilutions Supplementary data Table S1. Primary and Secondary antibody sources Devi et al, TXNIP in mitophagy A. Primary Antibodies Name Animal source Vendor Cat # Dilutions 1. TXNIP mouse MBL KO205-2 1:2000 (WB)

More information

For pair feeding, mice were fed 2.7g of HFD containing tofogliflozin

For pair feeding, mice were fed 2.7g of HFD containing tofogliflozin Materials and Methods Pair Feeding Experiment For pair feeding, mice were fed 2.7g of HFD containing tofogliflozin (0.005%), which is average daily food intake of mice fed control HFD ad libitum at week

More information

Graveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document

Graveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document Graveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document Wet Lab: Sara Olson and Lijun Zhan Computational Lab: Xintao Wei and Michael Duff PI: Brenton Graveley

More information

GFP/Iba1/GFAP. Brain. Liver. Kidney. Lung. Hoechst/Iba1/TLR9!

GFP/Iba1/GFAP. Brain. Liver. Kidney. Lung. Hoechst/Iba1/TLR9! Supplementary information a +KA Relative expression d! Tlr9 5!! 5! NSC Neuron Astrocyte Microglia! 5! Tlr7!!!! NSC Neuron Astrocyte! GFP/Sβ/! Iba/Hoechst Microglia e Hoechst/Iba/TLR9! GFP/Iba/GFAP f Brain

More information

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null

More information

OxiSelect Malondialdehyde (MDA) Immunoblot Kit

OxiSelect Malondialdehyde (MDA) Immunoblot Kit Product Manual OxiSelect Malondialdehyde (MDA) Immunoblot Kit Catalog Number STA- 331 10 blots FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipid peroxidation is a well-defined

More information

Nature Medicine: doi: /nm.3922

Nature Medicine: doi: /nm.3922 Title: Glucocorticoid-induced tumor necrosis factor receptor-related protein co-stimulation facilitates tumor regression by inducing IL-9-producing helper T cells Authors: Il-Kyu Kim, Byung-Seok Kim, Choong-Hyun

More information

TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet

TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet Details

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nature89 IFN- (ng ml ) 5 4 3 1 Splenocytes NS IFN- (ng ml ) 6 4 Lymph node cells NS Nfkbiz / Nfkbiz / Nfkbiz / Nfkbiz / IL- (ng ml ) 3 1 Splenocytes IL- (ng ml ) 1 8 6 4 *** ** Lymph node cells

More information

Supplementary Materials

Supplementary Materials Supplementary Materials 1 Supplementary Table 1. List of primers used for quantitative PCR analysis. Gene name Gene symbol Accession IDs Sequence range Product Primer sequences size (bp) β-actin Actb gi

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nature7221 Brown fat selective genes 12 1 Control Q-RT-PCR (% of Control) 8 6 4 2 Ntrk3 Cox7a1 Cox8b Cox5b ATPase b2 ATPase f1a1 Sirt3 ERRα Elovl3/Cig3 PPARα Zic1 Supplementary Figure S1. stimulates

More information

Influenza A H1N1 HA ELISA Pair Set

Influenza A H1N1 HA ELISA Pair Set Influenza A H1N1 HA ELISA Pair Set for H1N1 ( A/Puerto Rico/8/1934 ) HA Catalog Number : SEK11684 To achieve the best assay results, this manual must be read carefully before using this product and the

More information

Supplementary Information. Induction of human pancreatic beta cell replication by inhibitors of dual specificity tyrosine regulated kinase

Supplementary Information. Induction of human pancreatic beta cell replication by inhibitors of dual specificity tyrosine regulated kinase Journal: Nature Medicine Supplementary Information Induction of human pancreatic beta cell replication by inhibitors of dual specificity tyrosine regulated kinase 1,2 Peng Wang PhD, 1,2 Juan-Carlos Alvarez-Perez

More information

The Impact of Glucagon-Like Peptide-1 on the Brain-Reward System and Beyond

The Impact of Glucagon-Like Peptide-1 on the Brain-Reward System and Beyond The Impact of Glucagon-Like Peptide-1 on the Brain-Reward System and Beyond Rozita Anderberg Department of Physiology/Metabolic physiology Institute of Neuroscience and Physiology Sahlgrenska Academy at

More information

Supplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were

Supplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl

More information

Supplemental Information

Supplemental Information Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin

More information

Digestion: Endocrinology of Appetite

Digestion: Endocrinology of Appetite Digestion: Endocrinology of Dr. Ritamarie Loscalzo Medical Disclaimer: The information in this presentation is not intended to replace a one on one relationship with a qualified health care professional

More information

Primer sequences Target Sequence F Sequence R TNF-α (Tnfa) TCAGCCGATTTGCTATCTCAT A

Primer sequences Target Sequence F Sequence R TNF-α (Tnfa) TCAGCCGATTTGCTATCTCAT A Supplementary Table 1. Q- and RT-PR primers used in this study. Primer sequences Target Sequence F Sequence R TNF-α (Tnfa) TGGTTTGTTTT GTTTGGGGTTG T hemokine (- motif) ligand 5 (cl5) GTGTTTGTTT TGGTGGTG

More information

Supplementary Figure 1. mrna targets were found in exosomes and absent in free-floating supernatant. Serum exosomes and exosome-free supernatant were

Supplementary Figure 1. mrna targets were found in exosomes and absent in free-floating supernatant. Serum exosomes and exosome-free supernatant were Supplementary Figure 1. mrna targets were found in exosomes and absent in free-floating supernatant. Serum exosomes and exosome-free supernatant were separated via ultracentrifugation and lysed to analyze

More information

Ghrelin mediates stressinduced. behavior in mice. Chuang et al 2011 L3: Love, Lust, Labor

Ghrelin mediates stressinduced. behavior in mice. Chuang et al 2011 L3: Love, Lust, Labor Ghrelin mediates stressinduced food-reward behavior in mice Chuang et al 2011 L3: Love, Lust, Labor Agenda Introduction What is Ghrelin? Previous Models New model Methods Results Discussion Conclusion

More information

Advances in Computer Science Research, volume 59 7th International Conference on Education, Management, Computer and Medicine (EMCM 2016)

Advances in Computer Science Research, volume 59 7th International Conference on Education, Management, Computer and Medicine (EMCM 2016) 7th International Conference on Education, Management, Computer and Medicine (EMCM 2016) Expression of Beta-Adrenergic Receptor in Glioma LN229 Cells and Its Effect on Cell Proliferation Ping Wang1, Qingluan

More information

Chemical Chaperones Mitigate Experimental Asthma By Attenuating Endoplasmic

Chemical Chaperones Mitigate Experimental Asthma By Attenuating Endoplasmic Chemical Chaperones Mitigate Experimental Asthma By Attenuating Endoplasmic Reticulum Stress Lokesh Makhija, BE, Veda Krishnan, MSc, Rakhshinda Rehman, MTech, Samarpana Chakraborty, MSc, Shuvadeep Maity,

More information

Supplementary Figure 1

Supplementary Figure 1 VO (ml kg - min - ) VCO (ml kg - min - ) Respiratory exchange ratio Energy expenditure (cal kg - min - ) Locomotor activity (x count) Body temperature ( C) Relative mrna expression TA Sol EDL PT Heart

More information

Anti-Lamin B1/LMNB1 Picoband Antibody

Anti-Lamin B1/LMNB1 Picoband Antibody Anti-Lamin B1/LMNB1 Picoband Antibody Catalog Number:PB9611 About LMNB1 Lamin-B1 is a protein that in humans is encoded by the LMNB1 gene. The nuclear lamina consists of a two-dimensional matrix of proteins

More information

TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer

TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya

More information

Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.

Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12. Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.

More information

Central Progesterone Involvement in Estrogen- Induced Prolactin and Luteinizing Hormone Secretion Surges in Female Rats

Central Progesterone Involvement in Estrogen- Induced Prolactin and Luteinizing Hormone Secretion Surges in Female Rats Southern Illinois University Carbondale OpenSIUC Honors Theses University Honors Program 5-10-2014 Central Progesterone Involvement in Estrogen- Induced Prolactin and Luteinizing Hormone Secretion Surges

More information

Supplementary Information Titles Journal: Nature Medicine

Supplementary Information Titles Journal: Nature Medicine Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11

More information

Single Cell Quantitative Polymer Chain Reaction (sc-qpcr)

Single Cell Quantitative Polymer Chain Reaction (sc-qpcr) Single Cell Quantitative Polymer Chain Reaction (sc-qpcr) Analyzing gene expression profiles from a bulk population of cells provides an average profile which may obscure important biological differences

More information

Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice

Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice Supplementary Methods: Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice and gently meshed in DMEM containing 10% FBS to prepare for single cell suspensions. CD4 + CD25

More information

Chapter 12. Ingestive Behavior

Chapter 12. Ingestive Behavior Chapter 12 Ingestive Behavior Drinking a. fluid compartments b. osmometric thirst c. volumetric thirst Eating a. energy sources b. starting a meal c. stopping a meal d. eating disordersd Drinking a. fluid

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis

More information

Mouse GLP-2 EIA FOR LABORATORY USE ONLY

Mouse GLP-2 EIA FOR LABORATORY USE ONLY YK142 Mouse GLP-2 EIA FOR LABORATORY USE ONLY Kasumigaseki place, 3-6-7, Kasumigaseki, Chiyoda-ku, Tokyo 100-0013 Japan http://www.sceti.co.jp/english/export e-mail exp-pet@sceti.co.jp

More information

The Glucagon-Like Peptide 1 (GLP-1) Analogue, Exendin-4, Decreases the Rewarding Value of Food: A New Role for Mesolimbic GLP-1 Receptors

The Glucagon-Like Peptide 1 (GLP-1) Analogue, Exendin-4, Decreases the Rewarding Value of Food: A New Role for Mesolimbic GLP-1 Receptors 4812 The Journal of Neuroscience, April 4, 2012 32(14):4812 4820 Behavioral/Systems/Cognitive The Glucagon-Like Peptide 1 (GLP-1) Analogue, Exendin-4, Decreases the Rewarding Value of Food: A New Role

More information

The murine Resistin coding sequence was amplified from a fetal mouse cdna library and cloned

The murine Resistin coding sequence was amplified from a fetal mouse cdna library and cloned ESM METHODS Generation of Resistin transgenic mice The murine Resistin coding sequence was amplified from a fetal mouse cdna library and cloned into pcr4ta (Invitrogen). This was subcloned into a transgenic

More information

Human Leptin ELISA Kit

Human Leptin ELISA Kit Product Manual Human Leptin ELISA Kit Catalog Numbers MET-5057 MET-5057-5 96 assays 5 x 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Leptin is a polypeptide hormone

More information

GLP-2 (Rat) ELISA. For the quantitative determination of glucagon-like peptide 2 (GLP-2) in rat serum and plasma

GLP-2 (Rat) ELISA. For the quantitative determination of glucagon-like peptide 2 (GLP-2) in rat serum and plasma GLP-2 (Rat) ELISA For the quantitative determination of glucagon-like peptide 2 (GLP-2) in rat serum and plasma For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 48-GP2RT-E01

More information

HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates

HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates Department of Microbiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, USA

More information

Deficits in amygdaloid camp-responsive element binding protein signaling play a role in genetic predisposition to anxiety and alcoholism

Deficits in amygdaloid camp-responsive element binding protein signaling play a role in genetic predisposition to anxiety and alcoholism Research article Related Commentary, page 2697 Deficits in amygdaloid camp-responsive element binding protein signaling play a role in genetic predisposition to anxiety and alcoholism Subhash C. Pandey,

More information

Bone marrow-derived mesenchymal stem cells improve diabetes-induced cognitive impairment by

Bone marrow-derived mesenchymal stem cells improve diabetes-induced cognitive impairment by Nakano et al. Supplementary information 1. Supplementary Figure 2. Methods 3. References Bone marrow-derived mesenchymal stem cells improve diabetes-induced cognitive impairment by exosome transfer into

More information

Human Urokinase / PLAU / UPA ELISA Pair Set

Human Urokinase / PLAU / UPA ELISA Pair Set Human Urokinase / PLAU / UPA ELISA Pair Set Catalog Number : SEK10815 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized

More information

Figure S1. Body composition, energy homeostasis and substrate utilization in LRH-1 hep+/+ (white bars) and LRH-1 hep-/- (black bars) mice.

Figure S1. Body composition, energy homeostasis and substrate utilization in LRH-1 hep+/+ (white bars) and LRH-1 hep-/- (black bars) mice. Figure S1. Body composition, energy homeostasis and substrate utilization in LRH-1 hep+/+ (white bars) and LRH-1 hep-/- (black bars) mice. (A) Lean and fat masses, determined by EchoMRI. (B) Food and water

More information

Boucher et al NCOMMS B

Boucher et al NCOMMS B 1 Supplementary Figure 1 (linked to Figure 1). mvegfr1 constitutively internalizes in endothelial cells. (a) Immunoblot of mflt1 from undifferentiated mouse embryonic stem (ES) cells with indicated genotypes;

More information

Supplementary Fig. 1. Identification of acetylation of K68 of SOD2

Supplementary Fig. 1. Identification of acetylation of K68 of SOD2 Supplementary Fig. 1. Identification of acetylation of K68 of SOD2 A B H. sapiens 54 KHHAAYVNNLNVTEEKYQEALAK 75 M. musculus 54 KHHAAYVNNLNATEEKYHEALAK 75 X. laevis 55 KHHATYVNNLNITEEKYAEALAK 77 D. rerio

More information

Supplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.

Supplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model. A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth

More information