Supporting Information
|
|
- Ashlee Spencer
- 5 years ago
- Views:
Transcription
1 Supporting Information Shirazi et al /pnas SI Materials and Methods Brain Surgery: Rats. A lateral ventricle (LV) guide cannula was positioned and attached to the skull with dental acrylic and jeweler s screws and closed with an obturator, as described previously (1, 2). Briefly, a lateral ventricular guide cannula [26 gauge (Plastics One); coordinates: ±1.6 from the midline, 0.9 mm posterior to bregma, and 2.0 mm ventral to dura mater, with injector aimed 4.0 mm ventral to the dura) was implanted under ketamine/xylazine anesthesia. The cannula placement was verified before behavioral studies commenced with the angiotensin II (Tocris) drinking test (angiotensin II dose: 10 ng/1 μl, 2-μL injection bolus). Only the rats that passed the inclusion criteria were included in the study. Telemetric Transponder Surgery. For recording core body temperature and spontaneous physical activity, rats were implanted with telemetric transponders (G2 VitalView; Mini Mitter/Respironics) as described previously. Transponders were inserted into the abdominal cavity and secured to the abdominal muscles with sutures. The use of this telemetric system allows for continuous (every 5 min) measurements without any disturbance or stress to the animal. Interaction of Central GLP-1 Receptors Stimulation Effect on Food Intake, Body Weight, and Temperature with IL-6 and IL-1β. To determine whether signaling at the IL-1R or IL-6 (or the combination of the two) is mediating the anorexic, body weight-suppressing, and thermoregulatory effects of central glucagon-like peptide 1 (GLP-1) receptor (GLP-1R) stimulation, rats received four counterbalanced injection conditions over 4 experimental days: (i) vehicle for IL-1Ra artificial cerebrospinal fluid (acsf) + vehicle for exendin-4 (EX4) (acsf); (ii) vehicle for IL-1Ra + EX4 0.2 μg/ 1 μl; (iii) IL-1Ra 1 μg/1 μl + EX4 0.2 μg/1 μl; and (iv) IL-1Ra + vehicle for EX4. For the determination of IL-6 mediation, rats received the following four counterbalanced conditions: (i) vehicle for IL-6ab (acsf) + vehicle for EX4 (acsf); (ii) vehicle for IL-6ab + EX4 0.2 μg/1 μl; (iii) IL-6ab 0.05 μg/1 μl + EX4 0.2 μg/1 μl; and (iv) IL-6ab+ vehicle for EX4. Body temperature and spontaneous activity were measured telemetrically every 5 min and plotted for a period of 4 h. Food intake was measured at 1, 2, 4, and 22 h after injection. Body weight was measured just before injection and 22 h postinjection. The light cycle period was chosen for the temperature measurement because previous studies indicated that the hypothermic effect of EX4 can be best captured during this period for the rat (3, 4). IL-1Ra dose was previously shown to attenuate IL-1β induced fever in the preoptic area of the hypothalamus (5).The same dose and route of administration of IL-6ab used here were previously shown to reduce leptin s and insulin s effects on food intake (6). To determine whether cooperative action of IL-1 and IL-6 is required, the following conditions were used: (i) vehicle for IL-1Ra + vehicle for IL-6ab (acsf) + vehicle for EX4 (acsf); (ii) vehicle for IL-1Ra + vehicle for IL-6ab + EX4 0.2 μg/ 1 μl; (iii) IL-1Ra with IL-6ab + EX4 0.2 μg/1 μl; and (iv)il-1ra+ IL-6ab + vehicle for EX4. RNA Isolation and mrna Expression. Hypothalamic and hindbrain gene expression levels after lateral ventricle injection of the GLP-1 analog, EX4, or vehicle (acsf) in two separate groups of rats as previously described (2). One group was restricted to 10 g ( 50% of average overnight intake) of chow overnight, and the second was allowed to eat ad libitum. The cytokines measured were the following: IL-1β, IL-6, TNFα, and TGF-β1. The neuropeptides measured included Pomc, neuropeptide Y (Npy), choleocystokinin (Cck), melanocortin 4 receptor (Mc4r), and leptin receptor (Lepr). Ninety minutes after EX4 injection the brains were rapidly removed, and the hypothalamus, the hindbrain (cut just caudal to the ventral tegmental area), and the hippocampus were dissected using a brain matrix, frozen in liquid nitrogen and stored at 80 C for later determination of mrna expression. The extraction of the mrna, cdna synthesis, RT-PCR, and gene expression values were calculated as previously described (2). Individual brain samples were homogenized in Qiazol (Qiagen) using a TissueLyzer (Qiagen). Total RNA was extracted using RNeasy Lipid Tissue Mini Kit (Qiagen) with additional DNase treatment (Qiagen). RNA quality and quantity were assessed by spectrophotometric measurements (Nanodrop 1000, NanoDrop Technologies). For cdna synthesis, iscript cdna Synthesis kit (BioRad) was used. Real-time RT-PCR was performed using TaqMan probe, and primer sets for target genes were chosen from an on-line catalog (Applied Biosystems; reference numbers were as follows: Il1b- Rn _m1, Il6-Rn _m1, Tnf-Rn _g1, Tgfb1- Rn _m1). Gene expression values were calculated based on the ΔΔC t method (7), where the vehicle-injected group was designated as the calibrator. β-actin was used as the reference gene. Western Blot Analysis. Thirty minutes after EX4 injection the brains were rapidly removed, and the hypothalamus and a DVCenriched section of the hindbrain were dissected using a brain matrix, frozen in liquid nitrogen, and stored at 80 C. Wholetissue extracts for protein preparations and Western blot analyses were carried out as described (8). Protein concentrations were determined with the Bradford assay. Laemmli loading buffer (1 ) was added to the samples, which were boiled for 10 min and fractionated by gel electrophoresis on 4 12% (vol/vol) Bis Tris gels (Invitrogen). Nonspecific protein binding sites on the polyvinyldifluoride membranes (Amersham International) were blocked by incubating the membrane with 5% (wt/vol) nonfat milk in TBS Tween 20 buffer (10 mm Tris, 150 mm NaCl, and 0.1% Tween 20, ph 8.0) for 4 h. Blots generated with these extracts were probed with primary antibodies (Table S1) overnight at 4 C. The membranes were washed three times for 5 min each in TBS 0.05% Tween 20 and incubated with secondary antibodies (Table S1) for 2 h. Protein bands were visualized with SuperSignal West Dura Extended Duration Substrate (34076; Thermo Scientific, Pierce Biotechnology). To reprobe the blot with another antibody, the blot was rehydrated in methanol, rinsed in TBS, and incubated with stripping buffer (46430; Thermo Scientific) for 15 min. Immunoblotted signals were visualized with an LAS 1000 cooled charge-coupled device camera (Fuji Film). Individual bands were quantified directly from membranes by densitometry with Image Gauge software (Fuji Film). Proper loading was evaluated by staining the gels with Coomassie blue. All steps were carried out at room temperature unless otherwise stated. All targets chosen (Table S1, primary antibodies) were previously connected to IL-1β, IL-6, or both (9 11). Mouse Strains Used. All mice [IL-1 R1 KO, WT, and IL-6Ra fl/fl ] were purchased from The Jackson Laboratory. All mice used in the experiments were males. IL-1R KO Mice. The following IL-1R KO mice were used: strain name B6.129S7-Il1r1 tm1imx /J; stock no ; age at delivery 7 8 wk; and age at start of experiment 8 9 wk. 1of7
2 WT Mice. The following WT mice were used: strain name C57BL/6J; stock no: ; age at delivery 8 wk; and age at start of experiment 9 wk. IL-6Rα fl/fl Mice. The following IL-6Rα fl/fl mice were used: strain name B6;SJL-Il6ra tm1.1drew /J and stock no Brain IL-6R Knockdown. The IL-6Rα fl/fl mice were purchased from The Jackson Laboratory in October 2011 and were bred for five generations in the animal facility of the University of Gothenburg. At the time of the Tat-cre injection in the lateral ventricle, they were 5 mo (body weight: g). A Tat-Cre fusion protein, synthesized as described (12), was stereotaxically infused to the lateral ventricle (1.5 μl over 5 min, 2.1 mg/ml; anteroposterior, 0.3 mm bregma, 1.0 mm lateral, 2.5 mm dorsal ventral) according to a previously described protocol (13) to 5-mo-old male isoflurane anesthetized mice that were homozygously floxed for IL-6Rα (strain B6; SJL-Il6ra tm1.1drew ) (14) and purchased from The Jackson Laboratory. Control mice (also B6; SJL-Il6ra tm1.1drew ) were infused with vehicle (saline). Tomato expression was decreased in cells surrounding the ventricles following treatment with Tat-cre according to a similar protocol in dttomato loxp/+ mice (Fig. S4). In Vitro Treatment of Neuro2A Cells. Neuro2A neuroblastoma cells (American Type Culture Collection no. CCL-131) that express the GLP-1R were maintained at 37 C in 5% CO 2 and cultured in DMEM with 1 mg/ml glucose (Biochrom AG), 10% (vol/vol) FBS (Biochrom AG), and 1% nonessential amino acids (Biochrom AG). Cells were treated with EX4 (0 or 10 nm) for 15 or 45 min, respectively. At the end of the incubation RNA was isolated for quantitative real-time PCR to detect IL-6, whereas a β-actin expression assay (15) was used as endogenous control. SI Results Additional Statistical Analysis Details for Fig. 3 in Main Text. IL-6 antibody (ab) attenuates food intake and weight loss responses to intracerebroventricular injection of EX4. Anorexic response to central EX4 after 4 h of food access was not altered by IL-6 blockade (Fig. 3A). Two-way ANOVA revealed no interaction but one-way ANOVA [F(3,45) = 42.06, P < ] showed a significant effect of treatment. Post hoc Tukey test revealed a significant effect of EX4 alone (P < 0.005) and of EX4/IL-6ab (P < 0.005) combination to reduce 4-h chow intake. In contrast, the 22-h (overnight) food intake was abolished by the IL-6ab treatment (Fig. 3B). The IL-6ab administration led to a complete reversal of the EX4-induced anorexia (one-way ANOVA [F (3,45) = 15.85, P < ; P < for EX4 alone and P = not significant (ns) for EX4/IL-6ab combination]. Comparison of the EX4 alone and EX4/IL-6ab groups indicated a significant difference (P < 0.05). Two-way ANOVA indicated a strong trend for an interaction [F(1,60) = 3.00, P = 0.08]. Similarly, the EX4- induced weight loss was significantly attenuated by IL-6ab (Fig. 3C). One-way ANOVA was F(3,45) = 17.65, P < ; P < for EX4 alone; and P < 0.01 for EX4/IL-6ab combination. Further comparison of the EX4 alone and EX4/IL-6ab groups indicated a significant difference between these two treatments (P < 0.05). Two-way ANOVA indicated a significant interaction [F(1,60) = 3.68, P = 0.05]. Also, IL-1Ra attenuates food intake and weight loss responses to i.c.v. injection of EX4. Anorexic response to central EX4 after 4 h of food access was not altered by IL-1R blockade (Fig. 3D). Two-way ANOVA revealed no interaction, and post hoc Tukey test after a one-way ANOVA [F (3,33) = 12.82, P < ] showed a significant reduction in food intake after both EX4 (P < 0.005) and EX4/ IL-1Ra (P < 0.05) combination. In contrast, the 22-h (overnight) food intake was abolished by the IL-1Ra treatment (Fig. 3E), and blockade of IL-1R led to a complete reversal of the EX4-induced anorexia [one-way ANOVA: F(3,33) = 10.26, P < ; P < for EX4 alone and P = ns for EX4/IL-1Ra combination compared with vehicle-treated rats]. Comparison of the EX4 alone and EX4/IL-1βRa groups indicated a significant difference (P < 0.05). Two-way ANOVA revealed a significant interaction of EX4 with the antagonist [F(1,44) = 3.73, P = 0.05]. Similarly, the EX4-induced weight loss was significantly attenuated by IL-1Ra (Fig. 3F). Blockade of the IL-1R also led to a complete reversal of the EX4-induced weight loss [one-way ANOVA: F(3,33) = 19.20, P < ; P < for EX4 alone and P = ns for EX4/ IL-1Ra combination compared with vehicle-treated rats]. Further comparison of the body weight changes after the EX4 alone and EX4/IL-1Ra groups indicated a significant difference (P < 0.005). Two-way ANOVA indicated a significant interaction [F (1,44) = 7.15, P < 0.05]. Data are expressed as mean ± SEM. n = 12 16/treatment condition. *P < 0.05, **P < 0.01, ***P < Additional Statistical Analysis Details for Fig. 4 in Main Text. Simultaneous IL-1R and IL-6 blockade synergistically attenuates food intake and weight loss responses to i.c.v. injection of EX4. Anorexic response to central EX4 after 1 h (Fig. 4A), 4 h (Fig. 4B), and 22 h (Fig. 4C) were significantly attenuated by the combination of IL-1Ra and IL-6ab treatment. Similarly, the EX4-induced weight loss was significantly attenuated by this combination treatment (Fig. 4D). Two-way ANOVA revealed a significant interaction: F(1,40) = 5.37, P < 0.05 for 1-h intake, F(1,40) = 3.78, P < 0.05 for 4-h intake, and F(1,40) = 6.77, P < 0.05 for 22-h intake. Also one-way ANOVA [F(3,30) = 83.94, P < , F (3,30) = 82.05, P < and F(3,30) = 33.77, P < for 1-, 4-, and 22-h intake, respectively] showed a significant effect of treatment. Post hoc tests revealed a significant effect of EX4 alone (P < for all: 1, 4, and 22 h) and the EX4/(IL-1Ra+IL-6ab) combination (P < for both 1 and 4 h and P < 0.05 for 22 h) to reduce chow intake. Importantly, however, the comparison of the EX4 alone and the EX4/(IL-1Ra+IL-6ab) groups indicated a significant difference (P < 0.05 for 1-h intake, P < 0.01 for 4-h intake, and P < for 22-h intake). The combined interleukin blockade was successful at attenuating the EX4-induced weight loss [one-way ANOVA: F(3,30) = 36.18, P < ; P < for EX4 alone; and P < 0.05 for EX4/(IL-1βRant+IL-6ab) combination). The comparison of the EX4 alone and EX4/(IL-1βRa+ IL-6ab) groups indicated a significant difference (P < 0.005), and two-way ANOVA indicated a significant interaction [F(1,40) = 16.86, P < ]. Data are expressed as mean ± SEM. n = 11/ treatment condition. *P < 0.05, **P < 0.01, ***P < Skibicka KP, Hansson C, Alvarez-Crespo M, Friberg PA, Dickson SL (2011) Ghrelin directly targets the ventral tegmental area to increase food motivation. Neuroscience 180: Skibicka KP, Hansson C, Egecioglu E, Dickson SL (2012) Role of ghrelin in food reward: Impact of ghrelin on sucrose self-administration and mesolimbic dopamine and acetylcholine receptor gene expression. Addict Biol 17(1): Skibicka KP, Alhadeff AL, Grill HJ (2009) Hindbrain cocaine- and amphetamineregulated transcript induces hypothermia mediated by GLP-1 receptors. J Neurosci 29(21): Hayes MR, Skibicka KP, Grill HJ (2008) Caudal brainstem processing is sufficient for behavioral, sympathetic, and parasympathetic responses driven by peripheral and hindbrain glucagon-like-peptide-1 receptor stimulation. Endocrinology 149(8): Fabricio AS, et al. (2006) Interleukin-1 mediates endothelin-1-induced fever and prostaglandin production in the preoptic area of rats. Am J Physiol Regul Integr Comp Physiol 290(6):R1515 R Flores MB, et al. (2006) Exercise improves insulin and leptin sensitivity in hypothalamus of Wistar rats. Diabetes 55(9): Livak KJ, Schmittgen TD (2001) Analysis of relative gene expression data using realtime quantitative PCR and the 2(-Delta Delta C(T)) method. Methods 25(4): Shao R, et al. (2012) Coordinate regulation of heterogeneous nuclear ribonucleoprotein dynamics by steroid hormones in the human fallopian tube and endometrium in vivo and in vitro. Am J Physiol Endocrinol Metab 302(10):E1269 E Wang J, Campbell IL (2002) Cytokine signaling in the brain: Putting a SOCS in it? J Neurosci Res 67(4): of7
3 10. Linossi EM, Babon JJ, Hilton DJ, Nicholson SE (2013) Suppression of cytokine signaling: The SOCS perspective. Cytokine Growth Factor Rev 24(3): Venieratos PD, Drossopoulou GI, Kapodistria KD, Tsilibary EC, Kitsiou PV (2010) High glucose induces suppression of insulin signalling and apoptosis via upregulation of endogenous IL-1beta and suppressor of cytokine signalling-1 in mouse pancreatic beta cells. Cell Signal 22(5): Peitz M, Pfannkuche K, Rajewsky K, Edenhofer F (2002) Ability of the hydrophobic FGF and basic TAT peptides to promote cellular uptake of recombinant Cre recombinase: A tool for efficient genetic engineering of mammalian genomes. Proc Natl Acad Sci USA 99(7): Langlet F, et al. (2013) Tanycytic VEGF-A boosts blood-hypothalamus barrier plasticity and access of metabolic signals to the arcuate nucleus in response to fasting. Cell Metab 17(4): McFarland-Mancini MM, et al. (2010) Differences in wound healing in mice with deficiency of IL-6 versus IL-6 receptor. J Immunol 184(12): Hesse D, et al. (2010) Altered GLUT4 trafficking in adipocytes in the absence of the GTPase Arfrp1. Biochem Biophys Res Commun 394(4): Fig. S1. EX4 did not change the hippocampal IL-1 expression. The histograms represent the mrna levels of cytokines in ad-libitum fed and food-restricted rats following i.c.v. EX4 treatment. Data are normalized to β-actin and expressed as relative quantity compared with vehicle treatment. n = 9 11/treatment condition. Data are expressed as mean ± SEM. 3of7
4 Fig. S2. Activity is expressed here on a line graph as a group average for each treatment (A, C, ande). In the IL-6 blockade experiment a small but significant elevation in activity was observed when the data were expressed as 2.5-h postinjection sums [one-way ANOVA F(3,45) = 4.15, P < 0.05; two-way ANOVA: F(1,60) = 7.06, P < 0.05]. This hyperactivity seemed to be blocked by the IL-6ab (B). None of the treatments changed the activity expressed here on a line graph as a group average for each treatment (C and E) or histogram of 2.5-h postinjection sum (D and F) in the IL-1 or combination blockade experiments. Data are expressed as mean ± SEM. n = 16 (A and B), n = 12 (C and D), and n = 11 (E and F)/treatment condition. *P < of7
5 Fig. S3. Core temperature after central EX4 alone and in combination with IL-6ab or IL-1βRa. Fast onset and long-lasting hypothermia was observed after i.c.v. injection of EX4 and IL-6 or IL-1β blockade did not change this response (A and C). Body temperature differed significantly across the four treatments [F(3, 45) = P < (Fig. 4B), F(3, 33) = 24.41, P < ]. Post hoc Tukey comparisons of the four groups indicated that both EX4 (P < 0.005) and EX4/IL-6ab (P < 0.005) produced a significant hypothermia (B). Similarly, Tukey post hoc comparisons of the four groups indicated that both the EX4 (P < 0.005) and EX4/IL-1βRa (P < 0.01) produced a significant hypothermia (D). Meanwhile, comparison of the EX4 alone and EX4/IL-6ab or EX4 alone and EX4/ IL-1βRa groups did not indicate any significant differences. Furthermore, a two-way ANOVA did not indicate any significant interaction. In contrast to single interleukin blockade, the hypothermia was attenuated by the concurrent IL1R/IL-6 blockade (E and F). Body temperature differed significantly across the four treatments [F(3, 30) = 19.46, P < ] (E and F). Post hoc comparisons of the four groups indicated that both EX4 (P < 0.005) and EX4/(IL-1βRa+IL-6ab) (P < 0.05) produced hypothermia. Comparison of the EX4 alone and EX4/(IL-1a+IL-6ab) groups indicated a significant difference between the two treatments (P < 0.05). Furthermore, a two-way ANOVA indicated a trend for a significant interaction [F(1,40) = 3.69, P = 0.06]. The arrows indicate the injection timing of the antagonist or respective vehicle (first arrow) and the EX4 or respective vehicle (second arrow). The histograms (B, D, and F) represent 2.5-h postinjection averages of core temperature. Data are expressed as mean ± SEM. n = 16 (A and B), n = 12 (C and D), and n = 11 (E and F)/treatment condition. *P < 0.05, **P < 0.01, ***P < of7
6 Fig. S4. Representative images showing tomato expression (red) in cells in dttomatoloxp/+ mice in which the Tat-cre recombinant protein has been infused to the right lateral ventricle to indicate the CNS distribution of cre-mediated knockdown. A general view of the third ventricle (3V) at the level of the praventricular nucleus of the hypothalamus (PVH) (A) and a zoom on the ependymal layer bordering the PVH (B). Hoechst (white) DNA staining and tomato (red) as a marker of tat-cre induced recombination are shown in A and B. RCH, retrochiasmatic area. 6of7
7 Table S1. Antibodies used for Western blot experiments Name Name MW (kda) Dilution (method) Source Primary antibodies Stat3 (catalog #8768) Rabbit monoclonal antibody (IgG) 86 1:1,000 (WB) Cell Signaling Technology Phospho-Stat3 (catalog #9145) Rabbit monoclonal antibody (IgG) 79/86 1:1,000 (WB) Cell Signaling Technology SOCS1 (sc-9021) Rabbit polyclonal antibody (IgG) 24 1:500 (WB) Santa Cruz Biotechnology SOCS2 (sc-9022) Rabbit polyclonal antibody (IgG) 33 1:500 (WB) Santa Cruz Biotechnology β-actin (AC-74) Mouse monoclonal antibody (IgG) 42 1:1,000 (WB) Sigma-Aldrich Secondary antibodies Anti-rabbit IgG HRP-linked antibody (catalog #7074) 1:10,000 (WB) Cell Signaling Technology Anti-mouse IgG HRP-linked antibody (catalog #7076) 1:10,000 (WB) Cell Signaling Technology MW, molecular weight; WB, Western blot analysis. 7of7
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES
More informationGeneral Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:
General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems
More informationIslet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot
Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter
More informationSupplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
More informationGPR120 *** * * Liver BAT iwat ewat mwat Ileum Colon. UCP1 mrna ***
a GPR120 GPR120 mrna/ppia mrna Arbitrary Units 150 100 50 Liver BAT iwat ewat mwat Ileum Colon b UCP1 mrna Fold induction 20 15 10 5 - camp camp SB202190 - - - H89 - - - - - GW7647 Supplementary Figure
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSupporting Information
Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)
More informationExtended therapeutic validation of an anti-mc4 receptor antibody in an animal model of anorexia nervosa
Extended therapeutic validation of an anti-mc4 receptor antibody in an animal model of anorexia nervosa (project no. 04-12B) Authors Guus Akkermans, Martien Kas Preliminary data report Introduction In
More informationAAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination
AAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination Supplementary Figure 1. Generation of the adult-onset, liver-specific GH receptor knock-down (alivghrkd, Kd) mouse
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationRat Leptin-HS ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN
YK051 Rat Leptin-HS ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN 418 0011 Contents Introduction 2 Characteristics 3 Composition 4 Method 5-6 Notes
More informationSupplementary Materials and Methods
Supplementary Materials and Methods Immunoblotting Immunoblot analysis was performed as described previously (1). Due to high-molecular weight of MUC4 (~ 950 kda) and MUC1 (~ 250 kda) proteins, electrophoresis
More informationRat Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN
YK050 Rat Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA - SHI SHIZUOKA, JAPAN 418-0011 Contents Introduction 2 Characteristics 3 Composition 4 Method 5-6 Notes
More informationNeurophysiology of the Regulation of Food Intake and the Common Reward Pathways of Obesity and Addiction. Laura Gunter
Neurophysiology of the Regulation of Food Intake and the Common Reward Pathways of Obesity and Addiction Laura Gunter The Brain as the Regulatory Center for Appetite The brain is the integration center
More informationRNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using
Supplementary Information Materials and Methods RNA extraction, RT-PCR and real-time PCR. Total RNA were extracted using Trizol reagent (Invitrogen,Carlsbad, CA) according to the manufacturer's instructions.
More informationOnline Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2
Online Data Supplement Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Yi Lin and Zhongjie Sun Department of physiology, college of
More informationThe Schedule and the Manual of Basic Techniques for Cell Culture
The Schedule and the Manual of Basic Techniques for Cell Culture 1 Materials Calcium Phosphate Transfection Kit: Invitrogen Cat.No.K2780-01 Falcon tube (Cat No.35-2054:12 x 75 mm, 5 ml tube) Cell: 293
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationProtein MultiColor Stable, Low Range
Product Name: DynaMarker Protein MultiColor Stable, Low Range Code No: DM670L Lot No: ******* Size: 200 μl x 3 (DM670 x 3) (120 mini-gel lanes) Storage: 4 C Stability: 12 months at 4 C Storage Buffer:
More informationFigure S1 Time-dependent down-modulation of HER3 by EZN No Treatment. EZN-3920, 2 μm. Time, h
Figure S1 Time-dependent down-modulation of HER3 by EZN-392 HE ER3 mrna A, %Contr rol 12 No Treatment EZN-392, 2 μm 1 8 6 4 2 2 8 24 Time, h Figure S2. Specific target down-modulation by HER3 (EZN-392)
More informationProtocol for Gene Transfection & Western Blotting
The schedule and the manual of basic techniques for cell culture Advanced Protocol for Gene Transfection & Western Blotting Schedule Day 1 26/07/2008 Transfection Day 3 28/07/2008 Cell lysis Immunoprecipitation
More informationSupplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression
Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan
More information2.5. AMPK activity
Supplement Fig. A 3 B phos-ampk 2.5 * Control AICAR AMPK AMPK activity (Absorbance at 45 nm) 2.5.5 Control AICAR Supplement Fig. Effects of AICAR on AMPK activation in macrophages. J774. macrophages were
More informationSupplementary Figure 1
Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains
More informationSupplementary Figure S1. Effect of stress during withdrawal on expression of sensitization to repeated cocaine exposure in WT and D2R / mice.
Supplementary Figure S1. Effect of stress during withdrawal on expression of sensitization to repeated cocaine exposure in WT and D2R / mice. The time course of locomotor activity for WT (a, b) or D2R
More informationBMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice
SUPPLEMENTARY MATERIALS BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice Elena Corradini, Paul J. Schmidt, Delphine Meynard, Cinzia Garuti, Giuliana
More informationInternal Regulation II Energy
Internal Regulation II Energy Reading: BCP Chapter 16 lookfordiagnosis.com Homeostasis Biologically, what is necessary for life is a coordinated set of chemical reactions. These reactions take place in
More informationSUPPLEMENTARY INFORMATION
Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with
More informationSupplemental Information. Inhibition of the Proteasome b2 Site Sensitizes. Triple-Negative Breast Cancer Cells
Cell Chemical Biology, Volume 24 Supplemental Information Inhibition of the Proteasome b2 Site Sensitizes Triple-Negative Breast Cancer Cells to b5 Inhibitors and Suppresses Nrf1 Activation Emily S. Weyburne,
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationSupplementary Information. Glycogen shortage during fasting triggers liver-brain-adipose. neurocircuitry to facilitate fat utilization
Supplementary Information Glycogen shortage during fasting triggers liver-brain-adipose neurocircuitry to facilitate fat utilization Supplementary Figure S1. Liver-Brain-Adipose neurocircuitry Starvation
More informationYK052 Mouse Leptin ELISA
YK052 Mouse Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA-SHI SHIZUOKA, JAPAN 418-0011 Contents Ⅰ. Introduction 2 Ⅱ. Characteristics 3 Ⅲ. Composition 4 Ⅳ. Method
More informationTanycytes as gatekeepers of the Metabolic Brain
Tanycytes as gatekeepers of the Metabolic Brain Vincent Prevot Inserm team Development and Plasticity of the Postnatal Brain Jean-Pierre Aubert Research Centre, U837, Lille France Metabolic signals and
More informationSUPPLEMENTAL MATERIAL. Supplementary Methods
SUPPLEMENTAL MATERIAL Supplementary Methods Culture of cardiomyocytes, fibroblasts and cardiac microvascular endothelial cells The isolation and culturing of neonatal rat ventricular cardiomyocytes was
More informationMTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)
Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum
More informationA Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS
A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism Arlee Fafalios, Jihong Ma, Xinping Tan, John Stoops, Jianhua Luo, Marie C. DeFrances and Reza Zarnegar
More informationCNS Control of Food Intake. Adena Zadourian & Andrea Shelton
CNS Control of Food Intake Adena Zadourian & Andrea Shelton Controlling Food Intake Energy Homeostasis (Change in body adiposity + compensatory changes in food intake) Background Information/Review Insulin
More informationMethod of leptin dosing, strain, and group housing influence leptin sensitivity in high-fat-fed weanling mice
Am J Physiol Regul Integr Comp Physiol 284: R87 R100, 2003; 10.1152/ajpregu.00431.2002. Method of leptin dosing, strain, and group housing influence leptin sensitivity in high-fat-fed weanling mice HEATHER
More informationSupplementary Materials for
immunology.sciencemag.org/cgi/content/full/2/16/eaan6049/dc1 Supplementary Materials for Enzymatic synthesis of core 2 O-glycans governs the tissue-trafficking potential of memory CD8 + T cells Jossef
More informationCentral injection of fibroblast growth factor 1 induces sustained remission of diabetic hyperglycemia in rodents
Central injection of fibroblast growth factor 1 induces sustained remission of diabetic hyperglycemia in rodents Jarrad M Scarlett 1,,1, Jennifer M Rojas 1,1, Miles E Matsen 1, Karl J Kaiyala 3, Darko
More informationMicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells
MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on
More informationSupplementary data Supplementary Figure 1 Supplementary Figure 2
Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna
More informationSupplementary Figure 1.
Supplementary Figure 1. FGF21 does not exert direct effects on hepatic glucose production. The liver explants from C57BL/6J mice (A, B) or primary rat hepatocytes (C, D) were incubated with rmfgf21 (2
More informationSupplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO
Supplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO Mice. WT mice and KHK-A/C KO mice were provided drinking water containing 10% glucose or tap water with normal chow ad
More informationData Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538
Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538 Background: TIGIT is a co-inhibitory receptor that is highly expressed in Natural Killer (NK) cells, activated CD4+, CD8+ and regulatory
More informationTFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry
TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi
More informationSubjects. Thirty-five adult male Lister Hooded rats (Charles River, Kent, UK),
Supplemental Material: Subjects. Thirty-five adult male Lister Hooded rats (Charles River, Kent, UK), weighing between 280 300 g at the beginning of the experiment, were housed singly in holding rooms
More informationProtocol for Western Blo
Protocol for Western Blo ng SDS-PAGE separa on 1. Make appropriate percentage of separa on gel according to the MW of target proteins. Related recommenda ons and rou ne recipes of separa on/stacking gels
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1 Schematic depiction of the tandem Fc GDF15. Supplementary Figure 2 Supplementary Figure 2 Gfral mrna levels in the brains of both wild-type and knockout Gfral
More informationNF-κB p65 (Phospho-Thr254)
Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 NF-κB p65 (Phospho-Thr254) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02015 Please read the provided manual
More informationLuminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplementary material: Materials and suppliers
Supplementary material: Materials and suppliers Electrophoresis consumables including tris-glycine, acrylamide, SDS buffer and Coomassie Brilliant Blue G-2 dye (CBB) were purchased from Ameresco (Solon,
More informationI. Introduction. II. Characteristics
YK050 Rat Leptin ELISA I. Introduction Leptin, which is a product of ob gene, is a protein consisting of 167 amino acids and it is secreted from white adipose tissue. It is known that leptin acts on hypothalamus
More informationName Animal source Vendor Cat # Dilutions
Supplementary data Table S1. Primary and Secondary antibody sources Devi et al, TXNIP in mitophagy A. Primary Antibodies Name Animal source Vendor Cat # Dilutions 1. TXNIP mouse MBL KO205-2 1:2000 (WB)
More informationFor pair feeding, mice were fed 2.7g of HFD containing tofogliflozin
Materials and Methods Pair Feeding Experiment For pair feeding, mice were fed 2.7g of HFD containing tofogliflozin (0.005%), which is average daily food intake of mice fed control HFD ad libitum at week
More informationGraveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document
Graveley Lab shrna knockdown followed by RNA-seq Biosample Preparation and Characterization Document Wet Lab: Sara Olson and Lijun Zhan Computational Lab: Xintao Wei and Michael Duff PI: Brenton Graveley
More informationGFP/Iba1/GFAP. Brain. Liver. Kidney. Lung. Hoechst/Iba1/TLR9!
Supplementary information a +KA Relative expression d! Tlr9 5!! 5! NSC Neuron Astrocyte Microglia! 5! Tlr7!!!! NSC Neuron Astrocyte! GFP/Sβ/! Iba/Hoechst Microglia e Hoechst/Iba/TLR9! GFP/Iba/GFAP f Brain
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationOxiSelect Malondialdehyde (MDA) Immunoblot Kit
Product Manual OxiSelect Malondialdehyde (MDA) Immunoblot Kit Catalog Number STA- 331 10 blots FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipid peroxidation is a well-defined
More informationNature Medicine: doi: /nm.3922
Title: Glucocorticoid-induced tumor necrosis factor receptor-related protein co-stimulation facilitates tumor regression by inducing IL-9-producing helper T cells Authors: Il-Kyu Kim, Byung-Seok Kim, Choong-Hyun
More informationTSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet Details
More informationSUPPLEMENTARY INFORMATION
doi: 1.138/nature89 IFN- (ng ml ) 5 4 3 1 Splenocytes NS IFN- (ng ml ) 6 4 Lymph node cells NS Nfkbiz / Nfkbiz / Nfkbiz / Nfkbiz / IL- (ng ml ) 3 1 Splenocytes IL- (ng ml ) 1 8 6 4 *** ** Lymph node cells
More informationSupplementary Materials
Supplementary Materials 1 Supplementary Table 1. List of primers used for quantitative PCR analysis. Gene name Gene symbol Accession IDs Sequence range Product Primer sequences size (bp) β-actin Actb gi
More informationSUPPLEMENTARY INFORMATION
doi: 1.138/nature7221 Brown fat selective genes 12 1 Control Q-RT-PCR (% of Control) 8 6 4 2 Ntrk3 Cox7a1 Cox8b Cox5b ATPase b2 ATPase f1a1 Sirt3 ERRα Elovl3/Cig3 PPARα Zic1 Supplementary Figure S1. stimulates
More informationInfluenza A H1N1 HA ELISA Pair Set
Influenza A H1N1 HA ELISA Pair Set for H1N1 ( A/Puerto Rico/8/1934 ) HA Catalog Number : SEK11684 To achieve the best assay results, this manual must be read carefully before using this product and the
More informationSupplementary Information. Induction of human pancreatic beta cell replication by inhibitors of dual specificity tyrosine regulated kinase
Journal: Nature Medicine Supplementary Information Induction of human pancreatic beta cell replication by inhibitors of dual specificity tyrosine regulated kinase 1,2 Peng Wang PhD, 1,2 Juan-Carlos Alvarez-Perez
More informationThe Impact of Glucagon-Like Peptide-1 on the Brain-Reward System and Beyond
The Impact of Glucagon-Like Peptide-1 on the Brain-Reward System and Beyond Rozita Anderberg Department of Physiology/Metabolic physiology Institute of Neuroscience and Physiology Sahlgrenska Academy at
More informationSupplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were
Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl
More informationSupplemental Information
Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin
More informationDigestion: Endocrinology of Appetite
Digestion: Endocrinology of Dr. Ritamarie Loscalzo Medical Disclaimer: The information in this presentation is not intended to replace a one on one relationship with a qualified health care professional
More informationPrimer sequences Target Sequence F Sequence R TNF-α (Tnfa) TCAGCCGATTTGCTATCTCAT A
Supplementary Table 1. Q- and RT-PR primers used in this study. Primer sequences Target Sequence F Sequence R TNF-α (Tnfa) TGGTTTGTTTT GTTTGGGGTTG T hemokine (- motif) ligand 5 (cl5) GTGTTTGTTT TGGTGGTG
More informationSupplementary Figure 1. mrna targets were found in exosomes and absent in free-floating supernatant. Serum exosomes and exosome-free supernatant were
Supplementary Figure 1. mrna targets were found in exosomes and absent in free-floating supernatant. Serum exosomes and exosome-free supernatant were separated via ultracentrifugation and lysed to analyze
More informationGhrelin mediates stressinduced. behavior in mice. Chuang et al 2011 L3: Love, Lust, Labor
Ghrelin mediates stressinduced food-reward behavior in mice Chuang et al 2011 L3: Love, Lust, Labor Agenda Introduction What is Ghrelin? Previous Models New model Methods Results Discussion Conclusion
More informationAdvances in Computer Science Research, volume 59 7th International Conference on Education, Management, Computer and Medicine (EMCM 2016)
7th International Conference on Education, Management, Computer and Medicine (EMCM 2016) Expression of Beta-Adrenergic Receptor in Glioma LN229 Cells and Its Effect on Cell Proliferation Ping Wang1, Qingluan
More informationChemical Chaperones Mitigate Experimental Asthma By Attenuating Endoplasmic
Chemical Chaperones Mitigate Experimental Asthma By Attenuating Endoplasmic Reticulum Stress Lokesh Makhija, BE, Veda Krishnan, MSc, Rakhshinda Rehman, MTech, Samarpana Chakraborty, MSc, Shuvadeep Maity,
More informationSupplementary Figure 1
VO (ml kg - min - ) VCO (ml kg - min - ) Respiratory exchange ratio Energy expenditure (cal kg - min - ) Locomotor activity (x count) Body temperature ( C) Relative mrna expression TA Sol EDL PT Heart
More informationAnti-Lamin B1/LMNB1 Picoband Antibody
Anti-Lamin B1/LMNB1 Picoband Antibody Catalog Number:PB9611 About LMNB1 Lamin-B1 is a protein that in humans is encoded by the LMNB1 gene. The nuclear lamina consists of a two-dimensional matrix of proteins
More informationTRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
More informationSupplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.
More informationCentral Progesterone Involvement in Estrogen- Induced Prolactin and Luteinizing Hormone Secretion Surges in Female Rats
Southern Illinois University Carbondale OpenSIUC Honors Theses University Honors Program 5-10-2014 Central Progesterone Involvement in Estrogen- Induced Prolactin and Luteinizing Hormone Secretion Surges
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationSingle Cell Quantitative Polymer Chain Reaction (sc-qpcr)
Single Cell Quantitative Polymer Chain Reaction (sc-qpcr) Analyzing gene expression profiles from a bulk population of cells provides an average profile which may obscure important biological differences
More informationCell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice
Supplementary Methods: Cell isolation. Spleen and lymph nodes (axillary, inguinal) were removed from mice and gently meshed in DMEM containing 10% FBS to prepare for single cell suspensions. CD4 + CD25
More informationChapter 12. Ingestive Behavior
Chapter 12 Ingestive Behavior Drinking a. fluid compartments b. osmometric thirst c. volumetric thirst Eating a. energy sources b. starting a meal c. stopping a meal d. eating disordersd Drinking a. fluid
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationMouse GLP-2 EIA FOR LABORATORY USE ONLY
YK142 Mouse GLP-2 EIA FOR LABORATORY USE ONLY Kasumigaseki place, 3-6-7, Kasumigaseki, Chiyoda-ku, Tokyo 100-0013 Japan http://www.sceti.co.jp/english/export e-mail exp-pet@sceti.co.jp
More informationThe Glucagon-Like Peptide 1 (GLP-1) Analogue, Exendin-4, Decreases the Rewarding Value of Food: A New Role for Mesolimbic GLP-1 Receptors
4812 The Journal of Neuroscience, April 4, 2012 32(14):4812 4820 Behavioral/Systems/Cognitive The Glucagon-Like Peptide 1 (GLP-1) Analogue, Exendin-4, Decreases the Rewarding Value of Food: A New Role
More informationThe murine Resistin coding sequence was amplified from a fetal mouse cdna library and cloned
ESM METHODS Generation of Resistin transgenic mice The murine Resistin coding sequence was amplified from a fetal mouse cdna library and cloned into pcr4ta (Invitrogen). This was subcloned into a transgenic
More informationHuman Leptin ELISA Kit
Product Manual Human Leptin ELISA Kit Catalog Numbers MET-5057 MET-5057-5 96 assays 5 x 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Leptin is a polypeptide hormone
More informationGLP-2 (Rat) ELISA. For the quantitative determination of glucagon-like peptide 2 (GLP-2) in rat serum and plasma
GLP-2 (Rat) ELISA For the quantitative determination of glucagon-like peptide 2 (GLP-2) in rat serum and plasma For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 48-GP2RT-E01
More informationHIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates
HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates Department of Microbiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, USA
More informationDeficits in amygdaloid camp-responsive element binding protein signaling play a role in genetic predisposition to anxiety and alcoholism
Research article Related Commentary, page 2697 Deficits in amygdaloid camp-responsive element binding protein signaling play a role in genetic predisposition to anxiety and alcoholism Subhash C. Pandey,
More informationBone marrow-derived mesenchymal stem cells improve diabetes-induced cognitive impairment by
Nakano et al. Supplementary information 1. Supplementary Figure 2. Methods 3. References Bone marrow-derived mesenchymal stem cells improve diabetes-induced cognitive impairment by exosome transfer into
More informationHuman Urokinase / PLAU / UPA ELISA Pair Set
Human Urokinase / PLAU / UPA ELISA Pair Set Catalog Number : SEK10815 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized
More informationFigure S1. Body composition, energy homeostasis and substrate utilization in LRH-1 hep+/+ (white bars) and LRH-1 hep-/- (black bars) mice.
Figure S1. Body composition, energy homeostasis and substrate utilization in LRH-1 hep+/+ (white bars) and LRH-1 hep-/- (black bars) mice. (A) Lean and fat masses, determined by EchoMRI. (B) Food and water
More informationBoucher et al NCOMMS B
1 Supplementary Figure 1 (linked to Figure 1). mvegfr1 constitutively internalizes in endothelial cells. (a) Immunoblot of mflt1 from undifferentiated mouse embryonic stem (ES) cells with indicated genotypes;
More informationSupplementary Fig. 1. Identification of acetylation of K68 of SOD2
Supplementary Fig. 1. Identification of acetylation of K68 of SOD2 A B H. sapiens 54 KHHAAYVNNLNVTEEKYQEALAK 75 M. musculus 54 KHHAAYVNNLNATEEKYHEALAK 75 X. laevis 55 KHHATYVNNLNITEEKYAEALAK 77 D. rerio
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More information