Proteins from eight eukaryotic cytochrome P-450 families share a segmented region of sequence similarity
|
|
- Darrell Rich
- 5 years ago
- Views:
Transcription
1 Pro. NtI. Ad. Si. USA Vol. 85, pp , Otoer 1988 Biohemistry Proteins from eight eukryoti ytohrome P-450 fmilies shre segmented region of sequene similrity (ytohrome P450/onsensus sequene/evolution/p450m/superfmily) VERNON F. KALB AND J. C. LOPER Deprtment of Miroiology nd Moleulr Genetis, University of Cininnti College of Mediine, 231 Bethesd Avenue, Cininnti, OH Communited y M. J. Coon, July 5, 1988 (reeivedfor review Mrh 30, 1988) ABSTRACT Proteins from eight eukryoti fmilies in the ytohrome P-450 superfmily shre one region of sequene similrity. This region egins mino ids from the mino terminus of eh P-450, ontinues for =170 residues, nd ends mino ids efore the roxyl terminus. The region n e divided into four domins of sequene similrity, eh possessing its own pttern of invrint, onserved, nd vrile mino ids. The four domins re 56, 20, 59, nd 28 residues long nd re onneted y three shorter segments of limited sequene similrity. The numer of residues in these short segments vries with the P-450 protein ut rnges from 0 to 20 residues. Consensus sequenes sed on these similrities n e used to determine whether the sequene of n unidentified peptide resemles tht expeted for P-450. Sequene similrities etween proteins sometimes reflet onstrints imposed y the requirements of ommon funtion. The fourth domin of the P-450s, for exmple, ontins n invrint ysteine tht provides the xil thiolte lignd to the heme iron. Other reltionships etween the four domins nd P-450 funtion n e exmined y in vitro mutgeni proedures tht lter the onserved mino ids or modify the distne etween domins. The P-450 ytohromes re omponents in monooxygense systems tht tlyze wide vriety of oxidtive retions in prokryotes nd eukryotes. These retions inlude steps in the synthesis nd degrdtion of suh ompounds s holesterol, steroid hormones, nd prostglndins. P-450 proteins re lso involved in the metolism of drugs nd in the tivtion nd intivtion of rinogens. A reent nlysis of >60 P-450s from eukryotes nd one prokryote led to the orgniztion of the known P-450s into 10 different fmilies with totl of 15 sufmilies. Amino id sequenes within P-450 fmily re >36% similr, while sequenes within sufmily re :70% similr (1). Although sequene reltedness etween P-450 fmilies is low, these fmilies re still grouped into one P-450 superfmily ording to stndrd riteri (2). The eukryoti rnh of the ytohrome P-450 superfmily rose >0 million yers go (1, 3) nd sequene similrities mong these nient fmilies might identify onserved domins of struture or funtion. Sine omplete mino id sequenes hd een pulished for proteins from eight eukryoti P-450 fmilies, we used representtive sequene from eh fmily in series of sequene omprisons. A multiple lignment of the eight sequenes reveled one region of similrity shred y ll. Sequene similrities in this region reside in four domins onneted y short segments of vrile length. The region will provide fous for experiments tht proe the reltionship of mino id sequene to struture nd funtion in the P-450 superfmily. The pulition osts of this rtile were defryed in prt y pge hrge pyment. This rtile must therefore e herey mrked "dvertisement" in ordne with 18 U.S.C solely to indite this ft METHODS Amino Aid Sequenes. The soure for eh eukryoti P-450 sequene used in these omprisons ws s follows:, rt liver (4);, rt liver (5); 17, ovine drenl ortex (6); s, ovine drenl ortex (7); pnl, rt liver (8);, ovine drenl ortex (9);, rt liver (10);, Shromyes erevisie (11). The teril P-450 sequene ws P-450m from Pseudomons putid (12). Eh mino id sequene ws derived from the orresponding nulei id sequene with the N-terminl methionine ounted s residue 1. Some nlyses used mino id sequenes of the Protein Identifition Resoure Protein Sequene Dtse.* Constrution of the Multiple Alignment. The multiple lignment ws onstruted fter exmintion nd mnipultion of numer of different pirwise lignments for the eight P-450 proteins. We generted these lignments y using the Wilur nd Lipmn lgorithm (13) s implemented t Bionet in the IFIND progrm. The prmeters WORD-LENGTH, GAP- PENALTY, WINDOW, DENSITY, nd FAST were set t 1, 2, 30, LESS, nd NO. The sore for two ligned sequenes equls the numer of mthing residues minus the numer of gps multiplied y the GAP-PENALTY. Similrities shred y ll eight sequenes were pprent only in the roxylterminl portions of these proteins nd only these portions re displyed in the multiple lignment. The onstrution of the multiple lignment ws not strightforwrd sine different pirwise lignments sometimes yielded inonsistent results. One suh se involved the three pirwise lignments of P-450, P-450, nd P-450pnl. Although the lignment of P-450pnl with P- 450 required one gp nd the lignment of P-450 with P-450 required two gps, the lignment of P-450pnl with P-450 did not require gps. Suh inonsistenies were eliminted y mnully sliding or removing gps in eh pirwise lignment nd then heking the multiple sequene lignment to find onfigurtion tht yielded onsistent gp plement nd mximized the numer of mthing residues. This proess removed losely positioned gps, yielding multiple lignment of eight sequenes tht ontined only three gps. The suess of this pproh suggests tht pirwise lignment lgorithms might e improved y inorporting n djustle prmeter tht ould e used to penlize losely positioned gps. Consensus Sequenes. Sequene similrities re summrized y four tenttive onsensus sequenes. To onstrut these onsensus sequenes, we ssumed tht eh mino id would pper n verge of 1 time in 20 t ny position in ny of the eight ligned mino id sequenes. We then lulted (14) the expeted frequeny for every omintion of eight mino ids tht ould our t single position in the multiple lignment. The 22 possile omintions rnge from the se where ll eight mino ids re identil to the se *Protein Identifition Resoure (1987) Protein Sequene Dtse (Ntl. Biomed. Res. Found., Wshington, DC), Relese 12.
2 7222 Biohemistry: Kl nd Loper where ll eight re different. The 6 most ommon ptterns nd their expeted frequenies re s follows: (i) no pirs of identil mino ids, 0.198; (ii) one pir of identil mino ids, 0.427; (iii) two pirs of identil mino ids, 0.229; (iv) three pirs of identil mino ids, 0.031; (v) three identil mino ids, 0.061; nd (vi) three identil mino ids plus one pir of identil mino ids, When 1 of these ommon ptterns ourred, no onsensus mino id ws seleted. Eh of the remining 16 ptterns is expeted to our t frequeny <1%. When 1 of these less ommon ptterns ourred, we seleted the identil mino ids in tht pttern s the onsensus mino ids t tht position in the multiple lignment. We expeted tht typil eukryoti P-450 protein would mth these onsensus sequenes t mny ut not neessrily ll of the onsensus positions. Comprisons of Consensus Sequenes to Proteins. Using sliding window pproh, eh onsensus sequene ws ompred to trget protein or to rndomly permuted version of the trget protein. To omplish this omprison, the first position in the onsensus sequene ws pled ove the first mino id in the sequene of the protein nd the numer of positions t whih oth sequenes shred n identil mino id ws determined. The first position in the onsensus sequene ws then pled ove the seond mino id in the protein nd the numer of mthing residues ws gin determined. The stepwise movement of the onsensus sequene ws ontinued to the end of the protein. The highest numer of mthing residues found during this proess eme the sore for tht protein. When the trget protein ws P-450, the onsensus sequene ws lso ompred to rndomly permuted vrints of this P450 protein. A men nd stndrd devition were then lulted for the numer of mthing residues found during the steps in the omprisons to the rndomized P-450 sequenes. Using this men nd stndrd devition, z vlue ould e lulted tht quntitted the differene etween the sore for n unrndomized P-450 nd the men numer of mthing residues ourring in rndom vrints of the P-450: z = (sore - men)/stndrd devition. An lgorithm (15) ws used to generte the rndom numers tht were required to permute (16) the mino id sequenes. Consensus sequenes were lso ompred to the proteins in the Protein Identifition Resoure dtse. The distriution of sores ws plotted nd the men nd stndrd devition of these sores were determined. RESULTS AND DISCUSSION We performed pirwise lignments of eight eukryoti ytohrome P-450 sequenes to exmine sequene similrities t the level of individul mino id residues. Eh of the eight hosen sequenes ws from different P-450 fmily sine we wished to find similrities ommon to ll eukryoti P-450s. These pirwise lignments were mnully djusted s desried in Methods to onstrut multiple sequene lignment. The multiple lignment (Fig. 1) revels the detils of region of sequene similrity found in ll eight sequenes. This shred region egins mino ids from the mino terminus of eh P-450 nd ontinues to within mino ids of the roxyl terminus. Sequene similrities in this region reside in four domins tht ontin 56, 20, 59, nd 28 mino id residues. These domins re joined y short segments of dissimilr mino id sequene tht vry in size mong the individul P-450 sequenes. The four domins (A, B, C, nd D in Fig. 1) define the region of sequene similrity found in ll eight eukryoti P-450 fmilies. The oundries of this region re mrked y deresed sequene Pro. Ntl. Ad. Si. USA 85 (1988) similrity. No onsensus mino id ours in the 30 positions immeditely efore the strt of the region. The yest nd mmmlin sequenes diverge t the end of the region. Three of the four domins inlude elements desried y previous workers. In the A domin, residues A-11 through A-27 orrespond to segment in the prokryoti P-450m tht ws demonstrted y x-ry rystllogrphy to spn the heme distl surfe nd to ontin residues tht ontt the sustrte mphor (17). In ddition, ntiodies direted ginst the dodepeptide, whih orresponds to residues A-8 through A-19 of P-450, were shown to ross-ret with P-450 (21). In the B domin, residues B-8 through B-20 orrespond to onserved tridepeptide (18). The sequene D-7 through D-27 is the onserved peptide (19) tht ontins the thiolte lignd to the heme (22, 23). These previously identified peptides ontin numer of invrint or nerly invrint residues; the multiple lignment hs identified dditionl highly onserved residues, whih inlude those t A-36, A-44, A-45, C-24, C-29, C-43, C-46, C-49, C-51, C-53, nd C-54. Four onsensus sequenes were derived from the ligned mino id sequenes nd eh ontins its own pttern of onserved nd invrint mino ids. These hrteristi ptterns do not rise merely euse of some is in the mino id omposition of P-450s s is shown y the dt in Tle 1. This tle lists the sores otined when the four onsensus sequenes were ompred to eight eukryoti P-450s nd one teril P-450. For the eukryoti P-450s, eh sore ws lwys more thn 8 stndrd devitions ove the men numer of mthing residues oserved in rndomized P450 sequenes. On the other hnd, sores for the teril P-450m were lower, espeilly the sore of 5 otined with the B onsensus sequene. Results of the rndomiztion experiments indited tht n verge rndomized vrint of P-450m ontins out three segments with five mthes to the B onsensus sequene. Furthermore, the segment in P-450m tht est mthed the B onsensus sequene did not lie etween the A nd D domins. The highest soring segment etween these two domins hd only four mthes with the B onsensus. This numer of mthes is expeted to our =13 times in n verge "shuffled" P-450m sequene. Thus, no segment in P-450m mthes the B onsensus sequene to signifint extent. The four onsensus sequenes were lso tested for speifiity y omprison ginst the proteins in the Protein Identifition Resoure dtse. A imodl distriution of sores ws oserved (Fig. 2). Sores for ll full-length eukryoti P-450s fell into the high group while non-p-450 sores did not. These results indite tht the onsensus sequenes ould e used to determine whether the sequene of n unidentified peptide resemled tht expeted for eukryoti P-450. Sores for the teril P-450m were not s esy to tegorize s those for the eukryoti P-450s. Using the D onsensus sequene, the sore for P-450m ws higher thn tht for ny non-p-450 protein. When either the A or C onsensus sequene ws ompred to P-450m, the sores were higher thn the sores for ll ut few of the non-p-450 proteins, nd the sum of the A nd C sores for P-450m exeeded the sum for ny non-p-450 sequene. However, for the B onsensus sequene, lmost 60% of the non-p-450 proteins hd sores tht equled or exeeded tht of P- 450m. Consequently, s ws lso indited y the results of the shuffling experiments desried ove, P-450m does not ontin peptide tht resemles the B onsensus sequene to signifint degree. All P450 proteins shre some properties, while other properties re speifi to susets of these proteins. For exmple, they ll ind heme in mnner tht yields
3 Biohemistry: Kl nd Loper 17 pnl sc m A E I I A F K I LL L L F A D SSS I L LA QKIR V Al MSD V A V L6IG1ETTVLSW V ML1HP QRRLQEELD VLG P LLEGHVHMSVVDLFIGGTETTASTLSWAVAFLLHHPEIQRRLQEELDRELGPGASC LSDKDLRAEVDTFMFEGHD1TASGVSWIFYALATHPKHQQRCREEVQSVLGDGSSI LSNRHMLATIGDIFGAGVEMSVIKWIVAYLLHHPSLKKRIQDDIDQIIGFNRTP LSDI4EITAQSIIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPP LSDDKVITIVFDLFGAGFDTITTAISWSLxYLVTNPRIQRKIQEELDTVIGRDRQP FHHENLMISLLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIIDQVIGSHRLP MLLEDVKANITEMLAGGvNTTSMTLQWHLYEMARSLNVQEMLREEVLNARRQAEGD MTDQEIANLLIGVLmGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKE ITSDEAKRMCGLLLVGGLDTVVNFLSFSMEFLAKSPEHRQELI ERPERIPAACEEL Pro. Ntl. Ad. Si. USA 85 (1988) 7223 [SRVi I C L I S H 0 A PIP L R T D I A P L E F N F G *PVVS*-VPH * DV * GY*LPKG- V*V. HRDP W P -FRPERWL... K B D K L L LL A T T-SDR- MPYT-M-I*EVLR TYKDRARLPLLNATIAEVLR TwDHLDQIPYTTMCIKEALR TISDRNRLvLLEATIREVLR TYDTVEMNEYLDMVLNETLR I RLSDRPQLPYLEAFILETFR [ TLDDRSKMPYTDAvIHEIQR I ISKMLQIEvPLLKAsIKETLR L TYDLLQEMPLLNQTIKETLR [ I 17 pnl s m 1 LI RPVVPLALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPYEFRPDRFLEPGA [ I LI YPPVPGIVRELSTSVTFPDGRSLPKGIQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSP [RH 1 I] RPVAPTLIPHKAVIDSSIGDLTIDKGTDVVVNLWALHHSEKEWQHPDLFMPERFLDPTG [TQLISP I LYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSKENK [GSID I HI SSFVPFTIPHSTIRDTSLNGFYIPKGHCVFVNQWQVNHDQELWGDPNEFRPERFLTSSG [TLDKHL F] SDLVPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDSFNPEHFLDANG [ALKK [ LHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDK [DLI ] [MH ] HPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSA [SSYSVGEEVDYGFGAISKGVI [ LI RRFSLVADGRILTSDYEFHGVQLKKGDQILLPQMLSGLDERENACPmHVDFSRQ D I F G L I LFL L S * LPFS-G6R-CVGE-LAR-EMKVFM 17 pnl s m NPSALAFGCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRLQPRGVEAGAWESASAQ-COOH SHSFLPFSGGARNCIGKQFAKSEMKVIVALTLLRFELLPDPTKVPIPLPRLVLKSKNGIYLYLKKLH-COOH SLSYLPFGAGPRSCVGEMLARQELFLFMSRLLQRFNLEIPDDGKLPSLEGHASLVLQIKPFKVKIEVRQAWKEAQAEGSTP-COOH PYvYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQI PLKLSRQGLLQPTKPI ILKWPRDEI ITGS-COOH SEKVILFGLGKRKCIGETIGRLEVFLFLAILLQQMEFNVSPGEKVDMTPAYGLTLKHARCEHFQVQmRSSGPQHLQA-COOH SEAFMPFSTGKRICLGEGIARNELFLFFTT ILQNFSVSSHLAPKDIDLTPKESGIGKIPPTYQ ICFSAR-COOH HFRNLGFGWGVRQCVGRRIAELEMTLFLIHI LENFKVEMQHIGDVDTIFNLILTPDKPIFLVFRPFNQDPPQA-COOH SSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTS4VTLPTGPAKI IWEKRNPEQKI -COOH KVSHTTFGHGSHLCLGQHLARREI IVTLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKAV-COOH FIG. 1. Sequene lignment of the roxyl-terminl portion of nine P-450s. These prtil P-450 sequenes egin mino ids from the mino terminus of the prent P-450 ut re otherwise omplete from their eginning in the A domin on through the roxyl terminus of the prent protein. Squre rkets enlose residues tht lie etween domins. A horizontl line, positioned eneth the onsensus sequene, spns eh domin. A period in these onsensus sequenes identifies position tht lks onsensus mino ids. Boldfe type indites mino ids tht mth the onsensus sequene. Vertil lines on the horizontl lines mrk every 10th mino id within eh domin. The horizontl line tht spns eh domin thikens to mrk previously reported regions of sequene similrity. These regions inlude segment in P-450m tht trverses the heme distl surfe (17) in the A domin; onserved tridepeptide (18) in the B domin; nd onserved ysteinyl peptide (19) in the D domin. The lignment for P-450m ws guided y the eukryoti multiple lignment. The mino id residue in eh protein tht egins the A domin is s follows:, Leu-275;, Leu-305; 17, Leu-287; pnl, Leu-291;, Leu-306;, Phe-283; SCC, Met-310;, Met-299; nd m, Ile-234. The N-terminl methionine in the dedued mino id sequene of eh protein is residue 1 in this numering system. The stndrd single letter nottion is used (20). The I helix in P-450m orresponds to residues A-2 through A-35, the J helix orresponds to residues A-36 through A-44, while the L helix strts t D-16 nd ontinues for 20 residues (17). The highest perentge of invrint positions mong the P-450s ours in the first hlf of the onserved ysteinyl peptide in the D domin. This high density of invrint residues llows the peptide to e deteted with reltive ese in vrious P-450 sequenes. Ptterns for the A nd C domins re less pprent sine the density of invrint nd highly onserved residues is reltively low in these domins. hrteristi differene spetrum in the presene of ron monoxide nd reduing gents (24). On the other hnd, mitohondril P-450s reeive eletrons from n iron-sulfur redoxin, while the mirosoml P-450s reeive eletrons from P-450 redutse. The mirosoml P-450 redutse from one speies n donte eletrons to P-450 from nother speies oth in vitro (25) nd in vivo (26). These ommon properties might e refleted in the sequene similrities identified in the multiple lignment displyed in Fig. 1. These sequene similrities n e ltered in vitro to exmine the effets on struture nd funtion. Highly onserved residues, suh s the phenyllnines t C-63 nd D-7, re ttrtive trgets for site-direted mutgenesis. This pproh llowed Ling et l. (27) to show tht the phylogenetilly onserved Phe-87 in the yest iso-1-ytohrome is involved in the trnsfer of eletrons etween hemoproteins. Eh of the four domins identified in the lignment might ply speifi role in P-450 struture or funtion. A series of himeri P-450 proteins ould e onstruted y swpping DNA sequenes tht enode these domins etween different P-450 proteins. These onstruts, when expressed in vivo, might llow the mpping of speifi funtions to speifi domins nd might lso nswer questions onerning the funtionl independene of the domins. The joints tht onnet the heterologous mino id sequenes in these himers would lie etween the domins. Sine segments etween the domins vry in oth size nd sequene mong the P-450s, ny perturtion in tertiry struture used y these joints is likely to e tolerted. Furthermore, sine the sping etween domins vries from one P-450 to nother, it seems likely tht hnges to this sping in single P-450 would not severely disrupt t lest some of the hrteristi P-450 properties. It would e
4 7224 Biohemistry: Kl nd Loper Tle 1. Sores from omprisons of the four onsensus sequenes to nine P-450s Gene Consensus sequene fmily P450 A B C D XXI 32 (14.1) 14 (10.6) 28 (14.6) 17 (11.1) IV 29 (13.3) 11 ( 8.7) 22 (11.4) 16 (10.9) XVII (12.3) 13 (10.1) 26 (13.9) 20 (13.7) III pnl 31 (14.5) 10 ( 7.6) 24 (12.5) 15 (10.1) I 31 (14.2) 12 ( 9.5) 26 (13.9) 16 (10.9) II 26 (11.4) 12 ( 9.2) 27 (14.3) 18 (11.8) XI SCC 25 (11.3) 11 ( 8.6) 25 (13.1) 15 (10.1) LI 23 (10.3) 12 ( 9.6) 19 ( 9.7) 15 (10.4) CI m 13 ( 4.7) 5 ( 3.3) 12 ( 5.3) 12 ( 8.0) The sore nd z vlue (in prentheses) were lulted s desried. Gene fmily designtions re those of Neert nd Gonzlez (3). informtive to lter the distne etween the domins nd determine the effets on heme inding, the differene spetrum, nd the intertion with ytohrome P-450 redutse. Even though lrge vritions in the distne etween the four onserved domins might e tolerted for some P-450 properties, the three vrile segments might hve some funtionl signifine with respet to nother property suh s sustrte speifiity nd this ould e tested. The lignment my lso id in the design of syntheti polypeptides for ntiody prodution. Polylonl ntiodies to syntheti dodepeptide in P-450 (orresponding to residues A-8 through A-19) ross-reted with oth P-450 nd P-450 (21), lthough these two proteins shre only five identil mino ids in this segment. A smll pnel of polylonl ntiodies tht ross-rets with mny different P-450s might e used, for exmple, to isolte dditionl P-450 genes from expression lirries. As dditionl P-450 sequenes eome ville, it will e interesting to see how they further define the four linked domins of sequene similrity tht we hve found in ll eight eukryoti P-450 sequenes. The prokryoti P-450m shres three of these domins. Additionl prokryoti sequenes should help deide whether or not the differenes ~A- Pro. Ntl. Ad. Si. USA 85 (1988) seen in P-450m re speifi to tht P-450 or result from the divergene etween prokryoti nd eukryoti P-450s. We expet tht sequene dt from new eukryoti P-450 fmilies my result in hnges to the pttern. Suh hnges might inlude (i) minor modifitions in onsensus mino id residues nd (ii) resolution of the onserved domins into sudomins. Indeed, prtil dedued mino id sequene for romtse, the first known memer of newly disovered P-450 fmily (28), suggests tht the C domin n e divided into two sudomins with the oundry ourring immeditely fter residue C-40. Detiled informtion out the tertiry struture of the P-450 proteins will id in understnding struture nd funtion for this diverse protein superfmily. Poulos nd his ollegues (17) hve determined the rystl struture of P-450m nd hve shown tht the heme in this teril protein is sndwihed etween two helies. Eh helix ontins segment exhiiting sequene similrity to similrly positioned segments in mmmlin P-450s. Poulos hs suggested tht the rystl struture of P-450m might e useful in modeling the tertiry struture of eukryoti P-450s. Suh modeling requires the orret lignment of the two sequenes (29) sine inorret lignments n led to flwed three-dimensionl strutures (30). The multiple lignment presented in this work my e useful in this ontext even though P-450m lks segment tht resemles the B onsensus sequene. In their work on P-450 evolution nd memrne topology, Nelson nd Stroel (31, 32) reently presented n lignment of P-450 sequenes tht inluded the teril P-450m nd memers from seven of the eight eukryoti P-450 fmilies tht we hve nlyzed. They inluded lrge numer of sequenes from the P-4501 nd P-450II fmilies in their lignment, nd the resultnt intrfmily similrities tend to osure similrities ommon to ll P-450 fmilies. Beuse their lignment ws not hrterized y using rndomiztions or onsensus sequenes, speifi differenes with our lignment re hrd to evlute. In ny event, their lignment ontins gps nd insertions in the roxyl-terminl portion of the P-450 sequenes tht re not neessry y our nlysis B 0~.0 16 z p 10I 5i =- =.. 0 *1 * Im. 0 m m _ I * I I. ȧd FIG. 2. Distriution of sores for pro- * teins in the Protein Identifition Resoure dtse. Eh onsensus sequene ws ompred to eh of the proteins in the dtse. Results of these omprisons us- ing the A, B, C, nd D onsensus sequenes._,.._,,. * l. - re plotted in their respetive pnels. (Bottom) Numer of proteins versus the sum of the A nd C sores for these proteins. In A+C - eh pnel, vertil r mrks the point orresponding to the highest sore for - non-p-450 protein nd n rrow mrks the point orresponding to P-450m. The ver-. ~~~~~~~~~~~~~~til xis swithes from rithmeti to logrithmi for vlues lrger thn 10. Men _ sores (with stndrd devitions in pren- *./_1 _ * "_"19,- _"" _t - theses) using the A, B,C, D, nd A + C onsensus sequenes were 8.9 (2.9), 4.7 (1.2), 7.2 (2.5), 5.4 (1.6), nd 16.1 (5.1), Sore respetively.
5 Biohemistry: Kl nd Loper Furthermore, we detet sequene similrity ommon to ll eight eukryoti P-450 fmilies only in the roxyl-terminl portion. One proposed mehnism for gene evolution suggests tht exons enode funtionl domins tht ssort to form new genes vi reomintion within flnking introns (33). These domins re short mino id segments tht rry out limited funtion, suh s the inding of heme y the peptide enoded in the entrl exon of the 0-gloin gene (34). Although the pttern of exon orgniztion vries from one P-450 gene fmily to nother (23), there re exmples of introns interrupting eh of the four domins. At lest two of these introns interrupt eukryoti P-450 genes in regions tht orrespond to known funtionl domins in the teril P-45Qm. One intron splie position interrupts the odon for residue A-17 in memers of the P-450I fmily (35). In P-450m, this residue is thought to e one of the two residues in the oxygen inding site tht ontts moleulr oxygen (36). Another intron splie position interrupts the odon for residue D-10 in memers of the P-45011B sufmily (37). In P-450m, this odon lies etween residues D-7 nd D-15, whih provide hydrophoi ontts to the heme proximl surfe (17). A segmented pttern of sequene similrity lso ours in the gloin superfmily. Bshford et l. (38) ligned nd nlyzed ll known gloin sequenes. The 226 sequenes inluded not only the hemogloins nd myogloins of higher nimls ut lso gloins from insets, invertertes, nd plnts. Sequene similrities in these gloins n e found in six domins tht re residues long. Thus, in oth the P-450 nd gloin superfmilies, evolution hs onserved short domins tht ontin speifi ptterns of invrint, onserved, nd vrile mino id residues. The sene of smller domins in these superfmilies my imply tht there is lower size limit for heritle elements of protein struture or funtion. We thnk Dvid J. Lipmn nd F. Peter Guengerih for helpful disussions while the mnusript ws in preprtion. Prts of this work were supported y grnts from the U.S. Environmentl Protetion Ageny nd the University of Cininnti, Groundwter Reserh Institute. Computer resoures were provided y BIONET Ntionl Computer Resoure for Moleulr Biology. 1. Neert, D. W., Adesnik, M., Coon, M. J., Estrook, R. W., Gonzlez, F. J., Guengerih, F. P., Gunslus, I. C., Johnson, E. F., Kemper, B., Levin, W., Phillips, I. R., Sto, R. & Wtermn, M. R. (1987) DNA 6, Dyhoff, M. O., Brker, W. C. & Hunt, L. T. (1983) Methods Enzymol. 91, Neert, D. W. & Gonzlez, F. J. (1987) Annu. Rev. Biohem. 56, Hrdwik, J. P., Song, B.-J., Huermn, E. & Gonzlez, F. J. (1987) J. Biol. Chem. 262, Sogw, K., Gotoh, O., Kwjiri, K. & Fujii-Kuriym, Y. (1984) Pro. Nti. Ad. Si. USA 81, Zuer, M. X., John, M. E., Okmur, T., Simpson, E. R. & Wtermn, M. R. (1986) J. Biol. Chem. 261, Morohshi, K., Fujii-Kuriym, Y., Okd, Y., Sogw, K., Pro. Ntl. Ad. Si. USA 85 (1988) 7225 Hirose, T., Inym, S. & Omur, T. (1984) Pro. Ntl. Ad. Si. USA 81, Gonzlez, F. J., Neert, D. W., Hrdwik, J. P. & Ksper, C. B. (1985) J. Biol. Chem. 260, Yoshiok, H., Morohshi, K., Sogw, K., Ymne, M., Kominmi, S., Tkemori, S., Okd, Y., Omur, T. & Fujii- Kuriym, Y. (1986) J. Biol. Chem. 261, Fujii-Kuriym, Y., Mizukmi, Y., Kwjiri, K., Sogw, K. & Murmtsu, M. (1982) Pro. Ntl. Ad. Si. USA 79, Kl, V. F., Woods, C. W., Turi, T. G., Dey, C. R., Sutter, T. R. & Loper, J. C. (1987) DNA 6, Unger, B. P., Gunslus, l. C. & Sligr, S. G. (1986) J. Biol. Chem. 261, Wilur, W. J. & Lipmn, D. J. (1983) Pro. Ntl. Ad. Si. USA 80, Snedeor, W. W. & Cohrn, W. G. (1980) Sttistil Methods (Iow Stte Univ. Press, Ames), pp Wihmnn, B. & Hill, D. (1987) Byte 12, MLhln, A. D. & Boswell, D. R. (1985) J. Mol. Biol. 185, Poulos, T. L., Finzel, B. C., Gunslus, I. C., Wgner, G. C. & Krut, J. (1985) J. Biol. Chem. 260, Ozols, J., Heinemnn, F. S. & Johnson, E. F. (1981) J. Biol. Chem. 256, Gotoh, O., Tgshir, Y., lizuk, T. & Fujii-Kuriym, Y. (1983) J. Biohem. 93, IUPAC-IUB Commission on Biohemil Nomenlture (1968) Eur. J. Biohem. 5, Frey, A. B., Wxmn, D. J. & Kreiih, G. (1985) J. Biol. Chem. 260, Blk, S. D. & Coon, M. J. (1986) in Cytohrome P450, ed. Oritz de Montellno, P. R. (Plenum, New York), pp Morohshi, K., Sogw, K., Omur, T. & Fujii-Kuriym, Y. (1987) J. Biohem. 101, Omur, T. & Sto, R. (1964) J. Biol. Chem. 239, Aoym, Y., Yoshid, Y., Kuot, S., Kumok, H. & Furumihi, A. (1978) Arh. Biohem. Biophys. 185, Oed, K., Skki, T. & Ohkw, H. (1985) DNA 4, Ling, N., Pielk, G. J., Muk, A. G., Smith, M. & Hoffmn, B. M. (1987) Pro. Ntl. Ad. Si. USA 84, Simpson, E. R., Evns, C. T., Corin, C. J., Powell, F. E., Ledesm, D. B. & Mendelson, C. R. (1987) Mol. Cell. Endorinol. 52, Brlow, D. J., Blundell, T. L., Edwrds, M. S., Sind, B. L., Sternerg, M. J. E., Tylor, W. R. & Thorton, J. M. (1986) in Protein Engineering, eds. Inouye, M. & Srm, R. (Ademi, New York), pp Blundell, T. L., Sind, B. L., Sternerg, M. J. E. & Thornton, J. M. (1987) Nture (London) 326, Nelson, D. R. & Stroel, H. W. (1987) Mol. Biol. Evol. 4, Nelson, D. R. & Stroel, H. W. (1988) J. Biol. Chem. 263, Gilert, W. (1978) Nture (London) 271, Crik, C. S., Buhmn, S. R. & Beyhok, S. (1981) Nture (London) 291, Gonzlez, F. J., Kimur, S. & Neert, D. W. (1985) J. Biol. Chem. 260, Poulos, T. L., Finzel, B. C. & Howrd, A. J. (1987) J. Mol. Biol. 195, Suw, Y., Mizukmi, Y., Sogw, K. & Fujii-Kuriym, Y. (1985) J. Biol. Chem. 260, Bshford, D., Chothi, C. & Lesk, A. M. (1987) J. Mol. Biol. 196,
EFFECT OF DIETARY ENZYME ON PERFORMANCE OF WEANLING PIGS
EFFECT OF DIETARY ENZYME ON PERFORMANCE OF WEANLING PIGS Finl report sumitted to Dniso Animl Nutrition E. vn Heugten nd B. Frederik North Crolin Stte University, Deprtment of Animl Siene Summry The urrent
More informationLHb VTA. VTA-projecting RMTg-projecting overlay. Supplemental Figure 2. Retrograde labeling of LHb neurons. a. VTA-projecting LHb
SUPPLEMENTARY INFORMATION Supplementl Figure 1 doi:10.1038/nture09742 Lterl 1.0 mm from midline mpfc BNST mpfc BNST Lterl 2.1 mm from midline LHA LHA Lterl 2.7 mm from midline SUPPLEMENTAL INFORMATION
More informationP AND K IN POTATOES. Donald A Horneck Oregon State University Extension Service
P AND K IN POTATOES Donld A Hornek Oregon Stte University Extension Servie INTRODUCTION Phosphorous nd potssium re importnt to grow high yielding nd qulity pottoes. Muh of the northwest hs hd trditionlly
More informationPoultry No The replacement value of betaine for DL-methionine and Choline in broiler diets
Poultry No. 1573 The replement vlue of etine for DL-methionine nd Choline in roiler diets Key Informtion In roiler diets defiient in sulfur mino ids ut dequtely supplemented with methyl groups vi dded
More informationSupplementary Figure 1. Scheme of unilateral pyramidotomy used for detecting compensatory sprouting of intact CST axons.
() BDA 2 weeks fter Py () AAVs Cre or GFP t P1 BDA 2 weeks fter Py CSMN CST () Py t P7 or 2 months () Py t 2 months Supplementry Figure 1. Sheme of unilterl pyrmidotomy used for deteting ompenstory sprouting
More informationAlimonti_Supplementary Figure 1. Pten +/- Pten + Pten. Pten hy. β-actin. Pten - wt hy/+ +/- wt hy/+ +/- Pten. Pten. Relative Protein level (% )
Alimonti_Supplementry Figure 1 hy 3 4 5 3 Neo 4 5 5 Proe 5 Proe hy/ hy/ /- - 3 6 Neo β-tin d Reltive Protein level (% ) 15 1 5 hy/ /- Reltive Gene Expr. (% ) 15 1 5 hy/ /- Supplementry Figure 1 Chrteriztion
More informationOther Uses for Cluster Sampling
Other Uses for Cluster Smpling Mesure hnges in the level of n ttriute Hypothesis testing versus intervl estimtion Type I n 2 errors Power of the test Mesuring ttriute t sme time in ifferent sites Exmple:
More informationSUPPLEMENTARY INFORMATION
doi: 1.138/nture862 humn hr. 21q MRPL39 murine Chr.16 Mrpl39 Dyrk1A Runx1 murine Chr. 17 ZNF295 Ets2 Znf295 murine Chr. 1 COL18A1 -/- lot: nti-dscr1 IgG hevy hin DSCR1 DSCR1 expression reltive to hevy
More informationSUPPLEMENTARY INFORMATION
DOI: 1.138/n358 TLR2 nd MyD88 expression in murine mmmry epithelil supopultions. CD24 min plus MRU Myo-epithelil Luminl progenitor (CD61 pos ) Mture luminl (CD61 neg ) CD49f CD61 Reltive expression Krt5
More informationLesions of prefrontal cortex reduce attentional modulation of neuronal responses. and synchrony in V4
Lesions of prefrontl ortex reue ttentionl moultion of neuronl responses n synhrony in V4 Georgi G. Gregoriou,, Anrew F. Rossi, 3 Leslie G Ungerleier, 4 Roert Desimone 5 Deprtment of Bsi Sienes, Fulty of
More informationNeural population coding of sound level adapts to stimulus statistics
COMPUTATION AND SYSTEMS 25 Nture Pulishing Group http://www.nture.om/ntureneurosiene Neurl popultion oding of sound level dpts to stimulus sttistis Isel Den 1, Niol S Hrper 1,2 & Dvid MAlpine 1 Mmmls n
More informationSUPPLEMENTARY INFORMATION
{ OI: 1.138/n31 Srifie n nlyze APs on week 1 s of iet 1 4 6 High-ft iet BrU High-ft iet BrU 4 High-ft iet BrU 6 High-ft iet BrU Lin - Lin - : C34 + : C9 + 1 1 3 1 4 1 5 C45 1 C34 1 1 1 1 3 1 4 1 5 S-1
More informationSUPPLEMENTARY INFORMATION
DOI: 1.13/n7 Reltive Pprg mrna 3 1 1 Time (weeks) Interspulr Inguinl Epididyml Reltive undne..1.5. - 5 5-51 51-1 1-7 7 - - 1 1-1 Lipid droplet size ( m ) 1-3 3 - - - 1 1-1 1-1 1-175 175-3 3-31 31-5 >5
More informationLearning to see: experience and attention in primary visual cortex
2 Nture Pulishing Group http://neurosi.nture.om rtiles Lerning to see: experiene nd ttention in primry visul ortex 2 Nture Pulishing Group http://neurosi.nture.om Roy E. Crist, Wu Li nd Chrles D. Gilert
More informationCAUSES OF DIARRHEA, PNEUMONIA, AND ABORTION IN 1991 CATTLE SUBMISSIONS TO THE KSU VETERINARY DIAGNOSTIC LABORATORY
CAUSES OF DIARRHEA, PNEUMONIA, AND ABORTION IN 1991 CATTLE SUBMISSIONS TO THE KSU VETERINARY DIAGNOSTIC LABORATORY 1 1 2 R. K. Frnk, M. W. Vorhies, nd M. M. Chengpp Summry Cuses of dirrhe, pneumoni, nd
More informationNucleosome positioning as a determinant of exon recognition
Nuleosome positioning s determinnt of exon reognition Hgen Tilgner 1,3, Christoforos Nikolou 1,3, Sonj Althmmer 1, Mihel Smmeth 1, Miguel Beto 1, Jun Vlárel 1,2 & Roderi Guigó 1 200 Nture Ameri, In. All
More informationOperating Systems Principles. Page Replacement Algorithms
Operting Systems Priniples Pge Replement Algorithms Steve Gor gor@se.unl.eu http://www.se.unl.eu/~gor/courses/csce45 Virtul Memory Mngement Funmentl issues Plement strtegy Replement strtegies Lo ontrol
More informationThe Role of Background Statistics in Face Adaptation
The Journl of Neurosiene, Septemer 3, 29 29(39):235 244 235 Behviorl/Systems/Cognitive The Role of Bkground Sttistis in Fe Adpttion Jinhu Wu, * Hong Xu, * Peter Dyn, 2 nd Ning Qin Deprtments of Neurosiene
More informationstatic principle: output determined by a connection with strong node dynamic principle: output (sometimes) determined by a weak (floating) node
stti n ynmi priniple pmos network nmos network v out stti priniple: output etermine y onnetion with strong noe ynmi priniple: output (sometimes) etermine y wek (floting) noe hrging: C s is eing hrge up
More informationLaminar sources of synaptic input to cortical inhibitory interneurons and pyramidal neurons
rtiles Lminr soures of synpti input to ortil inhiitory interneurons nd pyrmidl neurons J. L. Dntzker nd E. M. Cllwy Systems Neuroiology Lortories, The Slk Institute for Biologil Studies, N. Torrey Pines
More informationGenome-wide nucleosome positioning during embryonic stem cell development
Genome-wide nuleosome positioning during emryoni stem ell development Vldimir B Teif 1,2, Yevhen Vinshtein 2,3, Mïwen Cudron-Herger 1,2, Jn-Philipp Mllm 1,2, Croline Mrth 1,2, Thoms Höfer 2,3 & Krsten
More informationSupplementary Figure S1
Supplementry Figure S1 - UTR m - 3HA - 2-1 hgh - 1 Uiquitin *! *! lk distl promoter m K3R/ K121R-3HA UTR hgh founder lines - HA - - founder lines TG- E1 L A2 B1 F9 G6 H4 H6 B C D2 G1 H3 J2 L - 7 IP: lk
More informationNeighbourhood Watch London
Neighbourhood Wth ondon Presenttion to Counity & Protetive ervies Coittee= Ot 25,24 Presented by: N. Wilson - 24 President Neighbourhood Wth ondon Prepred by: J.Andruhow- Progr Mnger Neighbouhood Wth ondon
More informationOpen Access RESEARCH ARTICLE. Genetics Selection Evolution
DOI 10.1186/s12711-016-0222-0 Genetis Seletion Evolution RESEARCH ARTICLE Open Aess Comprison of host geneti ftors influening pig response to infetion with two North Amerin isoltes of porine reprodutive
More informationProvider How To. Software Process Service Results
Softwre Proess Servie Results Provier How To Copyright Glenwoo Systems LLC 2010. The informtion herein remins the property of Glenwoo Systems LLC. This informtion my not e reprinte or uplite, n is governe
More informationWhangarei District Council Class 4 Gambling Venue Policy
Whngrei Distrit Counil Clss 4 Gmling Venue Poliy April 2013 Whngrei Distrit Counil Clss 4 Gmling Venue Poliy Tle of ontents Introdution... 3 1 Ojetives of the poliy in so fr s promoted y the Gmling At
More informationSUPPLEMENTARY INFORMATION
doi:.8/nture98 : hr NEMO :5 hr IKK IKK NF-κB p65 p5 p65/-rel NF-κB p65 p5 p65/-rel Cytoplsm Cytoplsm p65/p5 Nuleus Nuleus NEMO IKK IKK d : hr > : hr p65/-rel NF- p65 p5 Cytoplsm Cytoplsm p65/p5 p65/-rel
More informationMediating Multi-Party Negotiation Through Marker-Based Tracking of Mobile Phones
Mediting Multi-Prty Negotition Through Mrker-sed Trking of Moile Phones Mihel Rohs Deutshe Telekom Lortories TU erlin, Germny mihel.rohs@telekom.de hristin Kry Informtis Reserh Institute Newstle University,
More informationMinimum effective dose of chenic acid for gallstone patients: reduction with bedtime administration and
Gut, 1982, 23, 28-284 Minimum effetive dose of heni id for gllstone ptients: redution with bedtime dministrtion nd low holesterol diet D P MUDGL, R M KUPFER, ND T C NORTHFIELD* From the Normn Tnner Gstroenterology
More informationLipid Composition of Egg Yolk and Serum in Laying Hens Fed Diets Containing Black Cumin (Nigella sativa)
Interntionl Journl of Poultry Siene 5 (6): 574-578, 2006 ISSN 682-8356 Asin Network for Sientifi Informtion, 2006 Lipid Composition of Egg Yolk nd Serum in Lying Hens Fed Diets Contining Blk Cumin (Nigell
More informationCortical interference effects in the cocktail party problem
7 Nture Pulishing Group http://www.nture.om/ntureneurosiene Cortil interferene effets in the oktil prty prolem Rjiv Nryn 1,, Virgini Best 1,3, Erol Ozmerl 1,3, Elizeth MCline 1,, Mihel Dent, Brr Shinn-Cunninghm
More informationRESEARCH ARTICLE. Supplemental Figure 5
11.5 2 2 11. RESEARCH ARTICLE RBC ( 1 12 /L) 1.5 1. 9.5 PLT ( 1 9 /L) 1 16 14 HGB (g/l) 19 1 17 16 9. 12 4 4 46 Cellulr & Moleulr Immunology dvne online pulition, PCV (%) 44 MCV (fl) 46 44 ; doi:1.13/mi.214.16
More informationObjectives. R/S determination. R/S determination. Epoxidation. Last lecture Chirality
Lst leture hirlity This leture enntiomers distereomers / nottion hirlity jetives optil & iologil properties hirl moleules ontining more thn one hirlity enter. retions tht rete stereoisomers 1 Dr. Ky nderg
More informationPTSE RATES IN PNNI NETWORKS
PTSE RATES IN PNNI NETWORKS Norert MERSCH 1 Siemens AG, Hofmnnstr. 51, D-81359 Münhen, Germny Peter JOCHER 2 LKN, Tehnishe Universität Münhen, Arisstr. 21, D-80290 Münhen, Germny Lrs BURGSTAHLER 3 IND,
More informationREVIEW Study of the Formation of trans Fatty Acids in Model Oils (triacylglycerols) and Edible Oils during the Heating Process
JARQ 46 (3), 215 220 (2012) http://www.jirs.ffr.go.jp REVIEW Study of the Formtion of trns Ftty Aids in Model Oils (triylglyerols) nd Edible Oils during the Heting Proess Wkko TSUZUKI* Food Resoure Division,
More informationEffects of Feeding Citrus Pulp or Corn Supplements With Increasing Levels of Added Undegraded Intake Protein on the Performance of Growing Cattle
Effets of Feeding Citrus Pulp or Corn Supplements With Inresing Levels of Added Undegrded Intke Protein on the Performne of Growing Cttle Deke Alkire Todd Thrift Willim Kunkle 1 Citrus pulp-sed supplements
More informationThebiotutor.com A2 Biology OCR Unit F215: Control, genomes and environment Module 1.2 Meiosis and variation Answers
Theiotutor.com A2 Biology OCR Unit F215: Control, genomes nd environment Module 1.2 Meiosis nd vrition Answers Andy Todd 1 1. () (i) gene length of DNA; codes for (specific), polypeptide / protein / RNA;
More informationSupplementary Information
Supplementry Informtion A new lss of plnt lipid is essentil for protetion ginst phosphorus depletion Yozo Okzki 1, Hitomi Otsuki 1, Tomoko Nrisw 1, Mkoto Koyshi 1, Storu Swi 2, Yukiko Kmide 1, Miyko Kusno
More informationSupplementary figure 1
Supplementry figure 1 Dy 8 post LCMV infection Vsculr Assoc. Prenchym Dy 3 post LCMV infection 1 5 6.7.29 1 4 1 3 1 2 88.9 4.16 1 2 1 3 1 4 1 5 1 5 1.59 5.97 1 4 1 3 1 2 21.4 71 1 2 1 3 1 4 1 5 1 5.59.22
More informationAdiabatic CMOS Circuit Design: Principles and Examples
Aditi CMOS Ciruit Design: Priniples nd Exmples X.Wu,G.Hng,ndM.Pedrm Astrt: In view of hnging the type of energy onversion in CMOS iruits nd therey hieving ultr-low-power design, this pper investigtes diti
More informationAJ PUTT. Hematology. Chemistry. Species: Canine Gender: Female Year of Birth: 2013 Client: PUTT
Speies: Cnine Gender: Femle Yer of Birth: 2013 Client: PUTT Requisition #: 9034-12 Aession #: W2152816 Aount Code: 72364 Veterinrin: CARTER Pnel/Profile: Tik Pnel Add-on Senior Profile with L 4Dx Plus
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nture10754 Supplementry note 1 To ompre our dt with previous studies, we mesured the width of spikes from identified dopminergi neurons nd unidentified neurons from DATCre mie. Previous studies
More informationUsing Paclobutrazol to Suppress Inflorescence Height of Potted Phalaenopsis Orchids
Using Pcloutrzol to Suppress Inflorescence Height of Potted Phlenopsis Orchids A REPORT SUBMITTED TO FINE AMERICAS Linsey Newton nd Erik Runkle Deprtment of Horticulture Spring 28 Using Pcloutrzol to Suppress
More informationMechanisms underlying cross-orientation suppression in cat visual cortex
Mehnisms underlying ross-orienttion suppression in t visul ortex 6 Nture Pulishing Group http://www.nture.om/ntureneurosiene Nihols J Priee & Dvid Ferster In simple ells of the t primry visul ortex, null-oriented
More informationAgilent G6825AA MassHunter Pathways to PCDL Software Quick Start Guide
Agilent G6825AA MssHunter Pthwys to PCDL Softwre Quick Strt Guide Wht is Agilent Pthwys to PCDL? Fetures of Pthwys to PCDL Agilent MssHunter Pthwys to PCDL converter is stnd-lone softwre designed to fcilitte
More informationSUPPLEMENTARY INFORMATION
Prentl doi:.8/nture57 Figure S HPMECs LM Cells Cell lines VEGF (ng/ml) Prentl 7. +/-. LM 7. +/-.99 LM 7. +/-.99 Fold COX induction 5 VEGF: - + + + Bevcizum: - - 5 (µg/ml) Reltive MMP LM mock COX MMP LM+
More informationSingle-Molecule Studies of Unlabelled Full-Length p53 Protein Binding to DNA
Single-Molecule Studies of Unlbelled Full-Length p53 Protein Binding to DNA Philipp Nuttll, 1 Kidn Lee, 2 Pietro Ciccrell, 3 Mrco Crminti, 3 Giorgio Ferrri, 3 Ki- Bum Kim, 2 Tim Albrecht 1* 1 Imperil College
More informationUniversity of Groningen
University of Groningen The prevlene of sesonl ffetive disorder in the Netherlnds Mersh, PPA; Middendorp, HM; Bouhuys, Antoinette; Beersm, DGM; vn den Hoofdkker, RH; Middendorp, Hermine M. Pulished in:
More informationEfficient sensory cortical coding optimizes pursuit eye movements
ARTICE Reeived Mr 26 Aepted 29 Jul 26 Pulished 9 Sep 26 Effiient sensory ortil oding optimizes pursuit eye movements Bing iu, Mtthew V. Mellio & eslie C. Osorne,2 DOI:.38/nomms2759 OPEN In the nturl world,
More informationFates-shifted is an F box protein that targets Bicoid for degradation and regulates developmental fate determination in Drosophila embryos
ARTICLES Ftes-shifted is n F ox protein tht trgets Bioid for degrdtion nd regultes developmentl fte determintion in Drosophil emryos Juno Liu 1 nd Jun M 1,2,3 Bioid (Bd) is morphogeneti protein tht instruts
More informationIntroduction to Study Designs II
Introdution to Study Designs II Commonly used study designs in publi helth & epidemiologi reserh Benjmin Rihrd H. Muthmbi, DrPH, MPH Stte HIV Epidemiologist HIV Epidemiology Investigtion Setion PA Deprtment
More informationAssociation between haloacetic acid degradation and heterotrophic bacteria in water distribution systems
wter reserh 43 (29) 971 978 Aville t www.sienediret.om journl homepge: www.elsevier.om/lote/wtres Assoition etween hloeti id degrdtion nd heterotrophi teri in wter distriution systems Hsin-hsin Tung, *,
More informationSUPPLEMENTARY INFORMATION
doi:.38/nture277 d 25 25 2 Time from sound onset (ms) 25 25 2 Time from sound onset (ms) Firing rte (spikes/s) Firing rte (spikes/s).8.6..2 e f g h.8.6..2 Frtion of neurons Frtion of neurons N = 53 2 2
More informationChow KD CR HFD. Fed Fast Refed
Supplementry Figure 1 Control d/d Chow KD CR Fed Fst Refed Supplementry Figure 1: Liver expression in diet nd disese models. () expression in the livers of ontrol nd d/d mie. () expression in the livers
More informationCopy Number ID2 MYCN ID2 MYCN. Copy Number MYCN DDX1 ID2 KIDINS220 MBOAT2 ID2
Copy Numer Copy Numer Copy Numer Copy Numer DIPG38 DIPG49 ID2 MYCN ID2 MYCN c DIPG01 d DIPG29 ID2 MYCN ID2 MYCN e STNG2 f MYCN DIPG01 Chr. 2 DIPG29 Chr. 1 MYCN DDX1 Chr. 2 ID2 KIDINS220 MBOAT2 ID2 Supplementry
More informationA savings procedure based construction heuristic for the offshore wind cable layout optimization problem
A svings proeure se onstrution heuristi for the offshore win le lyout optimiztion prolem Sunney Foter (B.Eng. Mehnil) MS. Cnite in Energy Deprtment of Informtis, University of Bergen, Norwy sunney.foter@stuent.ui.no
More informationAdaptive echolocation behavior in bats for the analysis of auditory scenes
9 The Journl of Experimentl Biology, 9- Pulished y The Compny of Biologists 9 doi:./je.7 Adptive eholotion ehvior in ts for the nlysis of uditory senes Chen Chiu*, Wei Xin nd Cynthi F. Moss Deprtment of
More informationSUPPLEMENTARY INFORMATION
. Norml Physiologicl Conditions. SIRT1 Loss-of-Function S1. Model for the role of SIRT1 in the regultion of memory nd plsticity. () Our findings suggest tht SIRT1 normlly functions in coopertion with YY1,
More informationMaintenance of protein synthesis reading frame by EF-P and m 1 G37-tRNA
Reeived 23 Nov 214 Aepted 2 Apr 215 Pulished 26 My 215 DOI: 1.138/nomms8226 Mintenne of protein synthesis reding frme y EF-P nd m 1 G37-tRNA Howrd B. Gmper 1, *, Iso Msud 1, *, Miln Frenkel-Morgenstern
More informationCheck your understanding 3
1 Wht is the difference etween pssive trnsport nd ctive trnsport? Pssive trnsport is the movement of prticles not requiring energy. Movement of prticles in ctive trnsport uses energy. 2 A gs tp in the
More informationA. B. C. Succiniclasticum. Paraprevotella. Control DPA EPA DHA Control DPA EPA DHA a b. a a. b c.
389 Session 2: Miroil eosystem nd herivore nutrition Effet of dietry ddition of EPA, DPA nd DHA on rumen teril ommunity in ows nd ewes. An in vitro pproh Dvid Crreño 1, Álvro Belenguer 1, Eri Pinlohe 2,
More informationSupplementary information to accompany the manuscript entitled:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Supplementry informtion to ompny the mnusript entitled: A mternl junk food diet in pregnny nd lttion promotes n exerted tste for junk food nd greter propensity
More informationCSE 5311 Notes 2: Binary Search Trees
S Notes : inry Ser Trees (Lst upte /7/ 8:7 M) ROTTIONS Single left rottion t (K rotting ege ) Single rigt rottion t (K rotting ege ) F oule rigt rottion t F G F G Wt two single rottions re equivlent? (OTTOM-UP)
More informationEFFECT OF SOYBEAN CYST NEMATODE ON GROWTH OF DRY BEAN. Research Report to Northarvest Bean Growers, January 19, 2009
EFFECT OF SOYBEAN CYST NEMATODE ON GROWTH OF DRY BEAN Reserh Report to Northrvest Ben Growers, Jnury 19, 29 Berlin D. Nelson, Susilo Poromrto, n Ruell Goswmi, Dept. Plnt Pthology, NDSU Ojetive: Determine
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nture17 Men tumour dimeter (mm) 2 Rg2-/- 2 1 2 2 1 Control IgG!-CD8!-CD4 1 2 3 1 2 3 c Men tumour dimeter (mm) 2 2 1 d Ifnr1-/- Rg2-/- 2 2 1 Ifngr1-/- d42m1!ic 1 2 3 Dys post trnsplnt 1 2 3 Supplementry
More informationTHE EVALUATION OF DEHULLED CANOLA MEAL IN THE DIETS OF GROWING AND FINISHING PIGS
THE EVALUATION OF DEHULLED CANOLA MEAL IN THE DIETS OF GROWING AND FINISHING PIGS THE EVALUATION OF DEHULLED CANOLA MEAL IN THE DIETS OF GROWING AND FINISHING PIGS John F. Ptience nd Doug Gillis SUMMARY
More informationMeat and Food Safety. B.A. Crow, M.E. Dikeman, L.C. Hollis, R.A. Phebus, A.N. Ray, T.A. Houser, and J.P. Grobbel
Met nd Food Sfety Needle-Free Injection Enhncement of Beef Strip Loins with Phosphte nd Slt Hs Potentil to Improve Yield, Tenderness, nd Juiciness ut Hrm Texture nd Flvor B.A. Crow, M.E. Dikemn, L.C. Hollis,
More informationCONCENTATION OF MINERAL ELEMENTS IN CALLUS TISSUE CULTURE OF SOME SUNFLOWER INBRED LINES
CONCENTATION OF MINERAL ELEMENTS IN CALLUS TISSUE CULTURE OF SOME SUNFLOWER INBRED LINES M. Sri 1, Drgn Vsi, Lj. Vsiljevi, D. Skori, Snezn Mezei nd Sloodnk Pjevi 2 ABSTRACT Conentrtion of minerl elements
More informationEffects of Enzyme Inducers in Therapeutic Efficacy of Rosiglitazone: An Antidiabetic Drug in Albino Rats
Asin J. Exp. Si., Vol. 21, No. 2, 2007, 00-00 Effets of Enzyme Inuers in Therpeuti Effiy of Rosiglitzone: An Antiieti Drug in Alino Rts Ann Chursi,#* P.K. Krr** A. S. Mnn* & M.D. Khry* * Deprtment of Phrmeutil
More informationReward expectation differentially modulates attentional behavior and activity in visual area V4
Rewrd expettion differentilly modultes ttentionl ehvior nd tivity in visul re V4 Jll K Bruni 1,6, Brin Lu 1,5,6 & C Dniel Slzmn 1 4 npg 215 Nture Ameri, In. All rights reserved. Neurl tivity in visul re
More informationsupplementary information
DOI: 10.1038/nc2089 H3K4me1 H3K4me1 H3K4me1 H3K4me1 H3K4me1 H3K4me1 5 PN N1-2 PN H3K4me1 H3K4me1 H3K4me1 2-cell stge 2-c st cell ge Figure S1 Pttern of loclistion of H3K4me1 () nd () during zygotic development
More informationChloride Nutrition Regulates Water Balance in Plants
XII Portuguese-Spnish Symposium on Plnt Wter Reltions Chloride Nutrition Regultes Wter Blne in Plnts Frno-Nvrro JD 1, Brumós J, Rosles MA 1, Vázquez-Rodríguez A 1, Sñudo BJ 1, Díz- Rued P 1, Rivero C 1,
More information2. Hubs and authorities, a more detailed evaluation of the importance of Web pages using a variant of
5 Web Serch Outline: 1. Pge rnk, for discovering the most ëimportnt" pges on the Web, s used in Google. 2. Hubs nd uthorities, more detiled evlution of the importnce of Web pges using vrint of the eigenvector
More informationIranian Food Science and Technology Research Journal Vol. 6, No. 3, Fall, 2010.
Irnin Food Siene nd Tehnology Reserh Journl Vol. 6, No. 3, Fll, 2010. rvghi.mrym@gmil.om C ( AOAC 920.87 AOAC 942.05 AOAC 962.09 AOAC 922.06 AOAC 925.10 AACC 1- Extrusion-Expelling 2- Protein Dispersiility
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION CD169 + MACROPHAGES PRESENT LIPID ANTIGENS TO MEDIATE EARLY ACTIVATION OF INVARIANT NKT CELLS IN LYMPH NODES Ptrii Brrl, Polo Polzell, Andres Brukuer, Nio vn Rooijen, Gurdyl S.
More informationConsumer perceptions of meat quality and shelf-life in commercially raised broilers compared to organic free range broilers
Consumer perceptions of met qulity nd shelf-life in commercilly rised roilers compred to orgnic free rnge roilers C.Z. ALVARADO 1 *, E. WENGER 2 nd S. F. O KEEFE 3 1 Texs Tech University, Box 42141 Luock,
More informationReceptive field structure varies with layer in the primary visual cortex
2 Nture Pulishing Group http://www.nture.om/ntureneurosiene Reeptive field struture vries with lyer in the primry visul ortex Luis M Mrtinez, Qingo Wng 2, R Cly Reid 3, Cinthi Pilli 2, José-Mñuel Alonso
More informationGENERAL TOURNAMENT REGULATIONS OUTDOOR COMPETITIONS
GENERAL TOURNAMENT REGULATIONS OUTDOOR COMPETITIONS Otoer 2016 INTERNATIONAL HOCKEY FEDERATION CONTENTS 1 Rules of ompetition 2 Tournment Offiils 3 Tem entry 4 Pre-tournment riefing meetings 5 Composition
More informationTechnical Report GIT-CERCS The Sleepy Keeper Approach: Methodology, Layout and Power Results for a 4-bit Adder
Tehnil Report GIT-CERCS-06-03 The Sleepy Keeper Approh: Methodology, Lyout nd Power Results for 4-it Adder Se Hun Kim, Vinent J. Mooney III nd Jun Cheol Prk Center for Reserh on Emedded Systems nd Tehnology
More informationTOURNAMENT REGULATIONS INDOOR COMPETITIONS
TOURNAMENT REGULATIONS INDOOR COMPETITIONS Novemer 2017 INTERNATIONAL HOCKEY FEDERATION CONTENTS 1 Rules of ompetition 2 Tournment offiils 3 Tem entry 4 Pre-tournment riefing meetings 5 Composition of
More informationTitle. Author(s)Darwish, W. S.; Ikenaka, Y.; El-Ghareeb, W. R.; Ishi. CitationAnimal, 4(12): Issue Date
Title High expression of the mrna of ytohrome P450 nd p Author(s)Drwish, W. S.; Ikenk, Y.; El-Ghree, W. R.; Ishi CittionAniml, 4(12): 2023-2029 Issue Dte 2010-12-01 Do URL http://hdl.hndle.net/2115/47523
More informationA maternal junk food diet in pregnancy and lactation promotes an exacerbated taste for junk food and a greater propensity for obesity in rat offspring
British Journl of Nutrition (27), pge 1 of 9 q The uthors 27 doi: 1.117/S7114781237 mternl junk food diet in pregnny nd lttion promotes n exerted tste for junk food nd greter propensity for oesity in rt
More informationEFFECTS OF AN ACUTE ENTERIC DISEASE CHALLENGE ON IGF-1 AND IGFBP-3 GENE EXPRESSION IN PORCINE SKELETAL MUSCLE
Swine Dy 22 Contents EFFECTS OF AN ACUTE ENTERIC DISEASE CHALLENGE ON IGF-1 AND IGFBP-3 GENE EXPRESSION IN PORCINE SKELETAL MUSCLE B. J. Johnson, J. P. Kyser, J. D. Dunn, A. T. Wyln, S. S. Dritz 1, J.
More informationEFFECTS OF DIETARY CALCIUM LEVELS ON GROWTH-PERFORMANCE AND DIGESTIVE FUNCTION IN CATTLE FED A HIGH-FAT FINISHING DIET
EFFECTS OF DIETARY CALCIUM LEVELS ON GROWTH-PERFORMANCE AND DIGESTIVE FUNCTION IN CATTLE FED A HIGH-FAT FINISHING DIET R. A. Zinn, Y. Shen, R. Brjs, M. Montño, E. Alvrez, nd E. Rmirez Desert Reserh nd
More informationCrossing the Line A GIS investigation
GIS investigtion NAME rossing the Line A GIS investigtion Glol perspetive: rossing the Line DAE Answer ll questions on the stuent nswer sheet hnout Bounries re invisile lines on the erth s surfe. hey ivie
More informationRESEARCH ARTICLE Transport of selenium across the plasma membrane of primary hepatocytes and enterocytes of rainbow trout
191 The Journl of Experimentl iology 15, 191-151 1. Pulished y The ompny of iologists Ltd doi:1.1/je.37 RESERH RTILE Trnsport of selenium ross the plsm memrne of primry heptoytes nd enteroytes of rinow
More informationLALR Analysis. LALR Analysis. LALR Analysis. LALR Analysis
LLR nlysis Motivtion s eplined efore, in LR() prsers there re mny more sttes thn in the previous procedures, LR() nd LR(). This is ecuse there re sttes which contin the sme configurtions, ut with different
More informationChapter 7. Control and Coordination
Chpter 7 Control n Coorintion 1 Whih of the following sttements is orret out reeptors? Gusttory reeptors etet tste while olftory reeptors etet smell Both gusttory n olftory reeptors etet smell Auitory
More informationTOURNAMENT REGULATIONS HOCKEY INDIA SANCTIONED ALL INDIA TOURNAMENTS
TOURNAMENT REGULATIONS HOCKEY INDIA SANCTIONED ALL INDIA TOURNAMENTS Mrh 2015 INTERNATIONAL HOCKEY FEDERATION CONTENTS 1 Rules of ompetition 2 Tournment Offiils 3 Tem entry 4 Pre-tournment riefing meetings
More informationSławomir Borek Stanisława Pukacka Krzysztof Michalski. Introduction
At Physiol Plnt () 34:99 6 DOI.7/s738--96-4 ORIGINAL PAPER Regultion y surose of storge ompounds rekdown in germinting seeds of yellow lupine (Lupinus luteus L.), white lupine (Lupinus lus L.) nd Anden
More informationInfluence of Ad libitum or Control Feeding on the Performance of Broilers Fed Diets Low in Crude Protein 1
Interntionl Journl of Poultry Siene 4 (5): 74-79, 005 ISSN 168-8356 Asin Network for Sientifi Informtion, 005 Influene of Ad liitum or Control Feeding on the Performne of Broilers Fed Diets Low in Crude
More informationTOURNAMENT REGULATIONS INDOOR COMPETITIONS
TOURNAMENT REGULATIONS INDOOR COMPETITIONS Jnury 2015 INTERNATIONAL HOCKEY FEDERATION CONTENTS 1 Rules of ompetition 2 Tournment Offiils 3 Tem entry 4 Pre-tournment riefing meetings 5 Composition of tem
More informationRESEARCH ARTICLE Activity of intestinal carbohydrases responds to multiple dietary signals in nestling house sparrows
398 The Journl of Experimentl Biology 6, 398-3987 3. Pulished y The Compny of Biologists Ltd doi:.4/je.864 RESEARCH ARTICLE Ativity of intestinl rohydrses responds to multiple dietry signls in nestling
More informationClinical Study Report Synopsis Drug Substance Naloxegol Study Code D3820C00018 Edition Number 1 Date 01 February 2013 EudraCT Number
EudrCT Number 2012-001531-31 A Phse I, Rndomised, Open-lbel, 3-wy Cross-over Study in Helthy Volunteers to Demonstrte the Bioequivlence of the Nloxegol 25 mg Commercil nd Phse III Formultions nd to Assess
More informationPolypoidal choroidal vasculopathy associated with Doyne s familial choroiditis: treatment with thermal laser
E u ropen Journl of Ophthlmology / Vol. 14 no. 3, 2004 / pp. 2 6 4-2 6 8 S H O RT COMMUNICAT I O N Cse re p o r t Polypoidl horoidl vsulopthy ssoited with Doyne s fmilil horoiditis: tretment with therml
More informationXXI COMMONWEALTH GAMES
XXI COMMONWEALTH GAMES Gold Cost (AUS) 4 / 15 April 2018 COMPETITION REGULATIONS MEN S AND WOMEN S HOCKEY COMPETITIONS Pulished: 20 Ferury 2018 INTERNATIONAL HOCKEY FEDERATION CONTENTS 1 Interprettion
More informationCS Artificial Intelligence 2007 Semester 2. CompSci 366. Classical Planning: Regression Planning. Part II: Lecture 5 1 of 20
CS 367 - Artifiil Intelligene 2007 Semester 2 CompSi 366 Clssil Plnning: Regression Plnning Prt II: Leture 5 1 of 20 CS 367 - Artifiil Intelligene 2007 Semester 2 Outline Review of Progression Plnning(PP)
More informationInput from external experts and manufacturer on the 2 nd draft project plan Stool DNA testing for early detection of colorectal cancer
Input externl experts nd mnufcturer on the 2 nd drft project pln Stool DNA testing for erly detection of colorectl cncer (Project ID:OTJA10) All s nd uthor s replies on the 2nd drft project pln Stool DNA
More informationGlycemic Index: The Analytical Perspective
FEATURE Glyemi Index: The Anlytil Perspetive Jon W. DeVries Generl Mills, In. Minnepolis, MN The purpose of siene, nd thus, the role of the sientist, is generlly elieved to e to pursue the disovery, development,
More informationFRAMEstar. 2-Component PCR Plates
FRAMEstr -Component Pltes FrmeStr two-omponent tehnology redues evportion from pltes, improving results nd llowing for volume redutions to sve on expensive regents. FrmeStr pltes mximise therml stility
More information