Supplemental Material for. Figure S1. Identification of TetR responsive promoters in F. novicida and E. coli.
|
|
- Leo Farmer
- 5 years ago
- Views:
Transcription
1 Supplemental Material for Synthetic promoters functional in Francisella novicida and Escherichia coli Ralph L. McWhinnie and Francis E. Nano Department of Biochemistry and Microbiology, University of Victoria, Victoria, B.C. Canada Figure S1. Identification of TetR responsive promoters in F. novicida and E. coli. Figure S2. Immunoblot detection of TetR controlled CAT expression in F. novicida clones with synthetic promoters. Figure S3. Immunoblot detection of TetR controlled CAT expression in F. novicida clones with synthetic promoters: overexposed to show non-specific bands. Table S1. Ratio of intensity of CAT band to the intensity of non-specific band in Figure S3. Figure S4. Immunoblot detection of VgrG and non-specific bands in F. novicida. Table S2. Ratio of intensity of CAT band to the intensity of non-specific band in Figure S4. Table S3. Ratio of intensity of VgrG band to the intensity of non-specific band in Figure S4. Figure S5. TetR control in F. novicida of virulence factor DotU associated with inducible promoter, P40, or constitutive promoter, P146. Figure S6. Partial restoration of intramacrophage growth of F. novicida vgrg mutant by expressing plasmid borne vgrg with promoter P40. Figure S7. Plasmid borne vgrg lacking a promoter does not rescue growth of F. novicida in macrophages. Figure S8. Sequences of five synthetic constitutive promoter regions that function in F. novicida. Figure S9. β-galactosidase expression of E. coli synthetic promoters in F. novicida expressing TetR. Figure S10. Sequences of synthetic teto-containing promoters selected for function in E. coli. Figure S11. Sequences of F. novicida minimal promoters. 1
2 A B C D 2
3 Supplemental Figure S1. Identification of TetR responsive promoters in F. novicida (Panels A and B) and E. coli (Panels C and D) through a screen of Cm R clones for approximate β- galactosidase levels as determined by X-gal hydrolysis. Panels A and B, synthetic F. novicida promoters. Top half of each image is with ATc, bottom is without ATc. Plates were grown overnight then overlaid with X-gal-soaked filter paper and color was allowed to develop for 12 h at 30 C. The filter paper was then removed and imaged. Panel A is plate 1, Panel B is plate 2. The DNA sequences of each of the promoters represented in these images are provided in Data set S1. The names of the promoters correspond to the plate number and grid location. For example, promoter 1-A2 corresponds to the promoter in the recombinant clone shown on plate 1, position A2. Note that some promoter regions appear to have resulted from the ligation of two synthetic oligonucleotides. Panels C and D. E. coli strains with synthetic promoters isolated in E. coli (separate experiment from promoter selection in F. novicida). X-gal was included in the agar plates and images are of plates. Panel C plate does not have ATc; Panel D plate includes ATC. The DNA sequences of each of the promoters represented in these images are provided in Data set S2. The names of the promoters correspond to the plate number and grid location. Figure S2. Immunoblot detection of TetR controlled CAT expression in F. novicida clones with synthetic promoters. Data corresponds to that presented in Figure 3. Samples here are heavily loaded, revealing some examples of leaky expression. The samples used are the same as those in Figures 3 and S3, but the blotting procedure was performed independently. 3
4 Figure S3. Immunoblot detection of TetR controlled CAT expression in F. novicida clones with synthetic promoters: overexposed to show non-specific bands. Digital over-exposure of immunoblots shown in Figure 3 reveals reactivity of antibody with non-specific bands in all of the lanes containing bacterial cell extract; reactivity with CAT appears in some lanes. The relatively even intensity of the non-specific bands in all of the lanes with bacterial extract show that the amount of protein loaded was approximately equal for all of these lanes. See ratio of band intensities (CAT/non-specific band) in Table S1. 4
5 Table S1. Ratio of intensity of CAT band to the intensity of non-specific band in Figure S3. Band intensity was determined using Image Studio Lite software (Li-Cor). pmp829-cat/lacz + ATc was defined as zero intensity and P40-cat + ATc as 100 with the others reported as a percentage of P40-cat + ATc Strain (all are TetR + ) CAT intensity Non-specific intensity pmp pmp829-cat/lacz + ATc Pbfr-cat P40-cat P40-cat + ATc P94-cat P94-cat + ATc P135-cat P135-cat + ATc PZ P39-cat P39-cat + ATc P20-cat P20-cat + ATc P142-cat P142-cat + ATc P146-cat P165-cat CAT relative intensity normalized to non-specific intensity* *Band intensity was determined using Image Studio Lite software (Li-Cor). To find relative intensity normalized to non-specific band the intensity of the CAT band was divided by the intensity of the non-specific band. Background was then subtracted out by defining the promoterless control pmp829-cat/lacz with ATc as zero CAT/non-specific intensity and subtracting this value from that of each other strain. The values where then scaled to be presented as a percentage of P40-cat + ATc 5
6 Figure S4. Immunoblot detection of CAT (upper panel), VgrG (lower panel) and non-specific bands. Digital over-exposure of immunoblots shown in Figure 4 reveals reactivity of antibody with non-specific bands in all of the lanes containing bacterial cell extract; reactivity with CAT or VgrG appears in some lanes. The relatively even intensity of the nonspecific bands in all of the lanes with bacterial extract show that the amount of protein loaded was approximately equal for all of these lanes. See ratio of band intensities (CAT or VgrG/non-specific band) in Tables S2 and S3. 6
7 Table S2. Ratio of intensity of CAT band to the intensity of non-specific band in Figure S4. CAT relative intensity CAT Non-specific normalized to nonspecific intensity* Strain intensity intensity WT (pmp829) ΔvgrG tetr + (pmp829) ΔvgrG tetr + (829::cat/vgrG) ΔvgrG (829::P40-cat/vgrG) ΔvgrG tetr + (829::P40-cat/vgrG) ΔvgrG tetr + (829::P40-cat/vgrG) + ATc ΔvgrG (829::P18-cat/vgrG) ΔvgrG tetr + (829::P18-cat/vgrG) ΔvgrG tetr + (829::P18-cat/vgrG) + ATc *Band intensity was determined using Image Studio Lite software (Li-Cor). To find relative intensity normalized to non-specific band the intensity of the CAT band was divided by the intensity of the nonspecific band. Background was then subtracted out by defining the promoterless control ΔvgrG tetr + (829::cat/vgrG) as zero CAT/non-specific intensity and subtracting this value from that of each other strain. The values where then scaled to be presented as a percentage of ΔvgrG tetr + (829::P40-cat/vgrG) + ATc. Table S3. Ratio of intensity of VgrG band to the intensity of non-specific band in Figure S4. Nonspecific intensity VgrG relative intensity normalized to nonspecific intensity* Strain VgrG intensity WT (pmp829) ΔvgrG tetr+ (pmp829) ΔvgrG tetr + (829::cat/vgrG) ΔvgrG (829::P40-cat/vgrG) ΔvgrG tetr + (829::P40-cat/vgrG) ΔvgrG tetr + (829::P40-cat/vgrG) + ATc ΔvgrG (829::P18-cat/vgrG) ΔvgrG tetr + (829::P18-cat/vgrG) ΔvgrG tetr + (829::P18-cat/vgrG) + ATc *Band intensity was determined using Image Studio Lite software (Li-Cor). To find relative intensity normalized to non-specific band the intensity of the VgrG band was divided by the intensity of the nonspecific band. Background was then subtracted out by defining the no VrgG control ΔvgrG tetr + (pmp829) as zero CAT/non-specific intensity and subtracting this value from that of each other strain. The values where then scaled to be presented as a percentage of ΔvgrG tetr + (829::P40-cat/vgrG) + ATc. Strain ΔvgrG tetr + (pmp829) was defined as zero rather than the promoterless control strain, ΔvgrG tetr + (829::cat/vgrG). This was done because ΔvgrG tetr + (829::cat/vgrG) has high background intensity in this blot resulting from what appears to be spill-over of signal from the neighboring lane. 7
8 Figure S5. TetR control in F. novicida of virulence factor DotU associated with inducible promoter, P40, or constitutive promoter, P146. The absence of any promoter (lanes 2 and 3) results in no DotU being produced. In the absence of TetR the P40 promoter drives DotU expression (lane4). With P40 in front of DotU, and in the presence of TetR, the addition of ATc greatly increases the expression of DotU (lanes 5 and 6). Figure S6. Partial restoration of intramacrophage growth of F. novicida vgrg mutant by expressing plasmid borne vgrg with promoter P40. Nearly full recovery of the intramacrophage growth phenotype is dependent on relieving repression of P40 by the addition of ATc (uninduced versus induced, p<0.0001; induced versus WT, p=0.08). Partial intramacrophage growth is seen in a TetR + strain with P40 driving vgrg even in the absence of ATc (growth versus growth of ΔvgrG, p=0.008). Comparisons were done by two-way ANOVA. Figure S7. Plasmid borne vgrg lacking a promoter does not rescue growth of F. novicida in macrophages. This control demonstrates that there are no plasmid sequences found in pmp329 acting as a promoter to drive the expression of vgrg. The data for the wild type and the ΔvgrG strain are the same as that shown in Figure 5. Error bars represent S.E.M. The ΔvgrG tetr + (829::vgrG) growth is not statistically different from the growth of the ΔvgrG strain (p=0.67). Comparisons were done by two-way ANOVA. 8
9 Figure S8. Sequences of five synthetic constitutive promoters regions that function in F. novicida. All of these promoters had the same organization of teto relative to the -10 and -35 regions. The promoters P142, 143, 146, 139, and 165 had 11, 12, 10, 10, and 19 bp between the - 35 region and teto, respectively. 9
10 Figure S9. β-galactosidase expression of E. coli synthetic promoters in F. novicida expressing TetR. Plasmids containing promoters selected in E. coli ( PE ) were introduced into F. novicida and their activity was measured by assaying β-galactosidase activity. For comparison, the LacZ activity driven by promoters isolated in F. novicida, P20, P40 and P146, or the natural promoter, Pbfr, are shown. Values on the y-axis are arbitrary luminosity units. Error bars represent S.E.M. Figure S10. Organization of synthetic teto-containing promoters selected for function in E. coli. The format is as in Fig. 6. All promoters presented here are tightly controlled by TetR in E. coli, with exception of P132 which generates reduced, but significant, expression in the absence of ATc. Flanking regions for each promoter can be found in the corresponding GenBank files (see Materials and Methods). The DNA sequences of 88 synthetic E. coli promoters are available in Supplemental Data Set 2. 10
11 Figure S11. Sequences of F. novicida minimal promoters. A. Sequences of minimal-length promoters derived from constitutive promoters isolated in F. novicida. B. The upstream randomly generated sequence and the downstream plasmid sequences the flank the minimal promoters. The same flanking sequences are present in all three promoters. 11
ERK1/2/MAPK pathway-dependent regulation of the telomeric factor TRF2
ERK1/2/MAPK pathway-dependent regulation of the telomeric factor TRF2 SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Conservation of the D domain throughout evolution. Alignment of TRF2 sequences
More informationINTEGRATION OF GENERAL AMINO ACID CONTROL AND TOR REGULATORY PATHWAYS IN NITROGEN ASSIMILATION IN YEAST
INTEGRATION OF GENERAL AMINO ACID CONTROL AND TOR REGULATORY PATHWAYS IN NITROGEN ASSIMILATION IN YEAST Kirk A. Staschke 1, Souvik Dey 1, John M. Zaborske 2, Lakshmi Reddy Palam 1, Jeanette N. McClintick
More informationSupplemental Figure 1
1 Supplemental Figure 1 Effects of DATE shortening on HGF promoter activity. The HGF promoter region (-1037 to +56) containing wild-type (30As) or truncated DATE (26As, 27As, 28A, 29As) from breast cancer
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationA programmable NOR-based device for transcription profile analyses
A programmable NOR-based device for transcription profile analyses Tom Ran 1,2, Yehonatan Douek 1, Lilach Milo 1 & Ehud Shapiro 1,2 1 Department of Computer Science and Applied Mathematics 2 Department
More informationSupplementary Information and Figure legends
Supplementary Information and Figure legends Table S1. Primers for quantitative RT-PCR Target Sequence (5 -> 3 ) Target Sequence (5 -> 3 ) DAB2IP F:TGGACGATGTGCTCTATGCC R:GGATGGTGATGGTTTGGTAG Snail F:CCTCCCTGTCAGATGAGGAC
More informationLack of cadherins Celsr2 and Celsr3 impairs ependymal ciliogenesis, leading to fatal
Lack of cadherins Celsr2 and Celsr3 impairs ependymal ciliogenesis, leading to fatal hydrocephalus Fadel TISSIR, Yibo QU, Mireille MONTCOUQUIOL, Libing ZHOU, Kouji KOMATSU, Dongbo SHI, Toshihiko FUJIMORI,
More informationCrl and RpoS May Not Be Involved in Cross Protection against Tetracycline in Escherichia coli in Response to Heat Stress
rl and RpoS May Not Be Involved in ross Protection against Tetracycline in Escherichia coli in Response to Heat Stress Irina han, hi Wing heng, Jasmine hin, and Veronica how Department of Microbiology
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11429 S1a 6 7 8 9 Nlrc4 allele S1b Nlrc4 +/+ Nlrc4 +/F Nlrc4 F/F 9 Targeting construct 422 bp 273 bp FRT-neo-gb-PGK-FRT 3x.STOP S1c Nlrc4 +/+ Nlrc4 F/F casp1
More informationJumpstart your research with ViraPower Lentiviral Expression Systems
ViraPower Lentiviral Expression Systems Jumpstart your research with ViraPower Lentiviral Expression Systems With ViraPower Lentiviral Systems you can: Efficiently transduce both dividing and non-dividing
More informationreads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced to express
Supplementary Figure 1. VapC-mt4 cleaves trna Ala2 in E. coli. Histograms representing the fold change in reads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced
More informationSupplementary Information
Supplementary Information HBV maintains electrostatic homeostasis by modulating negative charges from phosphoserine and encapsidated nucleic acids Authors: Pei-Yi Su 1,2,3, Ching-Jen Yang 2, Tien-Hua Chu
More informationSupplementary Information
Supplementary Information mediates STAT3 activation at retromer-positive structures to promote colitis and colitis-associated carcinogenesis Zhang et al. a b d e g h Rel. Luc. Act. Rel. mrna Rel. mrna
More informationSupplementary Figure 1 Madm is not required in GSCs and hub cells. (a,b) Act-Gal4-UAS-GFP (a), Act-Gal4-UAS- GFP.nls (b,c) is ubiquitously expressed
Supplementary Figure 1 Madm is not required in GSCs and hub cells. (a,b) Act-Gal4-UAS-GFP (a), Act-Gal4-UAS- GFP.nls (b,c) is ubiquitously expressed in the testes. The testes were immunostained with GFP
More informationSupplementary Table 1. List of primers used in this study
Supplementary Table 1. List of primers used in this study Gene Forward primer Reverse primer Rat Met 5 -aggtcgcttcatgcaggt-3 5 -tccggagacacaggatgg-3 Rat Runx1 5 -cctccttgaaccactccact-3 5 -ctggatctgcctggcatc-3
More information7.012 Quiz 3 Answers
MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert A. Weinberg, Dr. Claudette Gardel Friday 11/12/04 7.012 Quiz 3 Answers A > 85 B 72-84
More informationZhu et al, page 1. Supplementary Figures
Zhu et al, page 1 Supplementary Figures Supplementary Figure 1: Visual behavior and avoidance behavioral response in EPM trials. (a) Measures of visual behavior that performed the light avoidance behavior
More informationSupplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationExpression constructs
Gene expressed in bebe3 ZmBEa Expression constructs 35S ZmBEa Pnos:Hygromycin r 35S Pnos:Hygromycin r 35S ctp YFP Pnos:Hygromycin r B -1 Chl YFP- Merge Supplemental Figure S1: Constructs Used for the Expression
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Krenn et al., http://www.jcb.org/cgi/content/full/jcb.201110013/dc1 Figure S1. Levels of expressed proteins and demonstration that C-terminal
More information2.5. AMPK activity
Supplement Fig. A 3 B phos-ampk 2.5 * Control AICAR AMPK AMPK activity (Absorbance at 45 nm) 2.5.5 Control AICAR Supplement Fig. Effects of AICAR on AMPK activation in macrophages. J774. macrophages were
More informationMCB140: Second Midterm Spring 2010
MCB140: Second Midterm Spring 2010 Before you start, print your name and student identification number (S.I.D) at the top of each page. There are 11 pages including this page. You will have 150 minutes
More informationSupplementary Information
Supplementary Information Supplementary s Supplementary 1 All three types of foods suppress subsequent feeding in both sexes when the same food is used in the pre-feeding test feeding. (a) Adjusted pre-feeding
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationc) Macrophages and B cells present antigens to helper T_-cells. (Fill in blanks.) 2 points
Question 1 You are an immunologist who wants to make the big bucks. You decide to leave the world of science and get a job as a script-consultant on a new medical drama (ER-like) show. You test the writers
More informationInteraction of NPR1 with basic leucine zipper protein transcription factors that bind sequences required for salicylic acid induction of the PR-1 gene
Interaction of NPR1 with basic leucine zipper protein transcription factors that bind sequences required for salicylic acid induction of the PR-1 gene YUELIN ZHANG, WEIHUA FAN, MARK KINKEMA, XIN LI, AND
More informationSupplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.
Supplementary Information Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Various concentrations of Ent, DHBA or ABAH were pre-incubated for 10 min with LPO (50
More informationBIOL2005 WORKSHEET 2008
BIOL2005 WORKSHEET 2008 Answer all 6 questions in the space provided using additional sheets where necessary. Hand your completed answers in to the Biology office by 3 p.m. Friday 8th February. 1. Your
More informationSUPPLEMENTARY INFORMATION
doi: 10.1038/nature05732 SUPPLEMENTARY INFORMATION Supplemental Data Supplement Figure Legends Figure S1. RIG-I 2CARD undergo robust ubiquitination a, (top) At 48 h posttransfection with a GST, GST-RIG-I-2CARD
More informationSupplementary Figure 1. Procedures to independently control fly hunger and thirst states.
Supplementary Figure 1 Procedures to independently control fly hunger and thirst states. (a) Protocol to produce exclusively hungry or thirsty flies for 6 h water memory retrieval. (b) Consumption assays
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM.
Supplementary Figure 1 Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM. (a-c) Heterozygous c.216ga mice displayed normal hair bundle morphology at P18. (d-i) Disorganized hair bundles
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationExpanded View Figures
PEX13 functions in selective autophagy Ming Y Lee et al Expanded View Figures Figure EV1. PEX13 is required for Sindbis virophagy. A, B Quantification of mcherry-capsid puncta per cell (A) and GFP-LC3
More information/06/$15.00/0 Molecular Endocrinology 20(9): Copyright 2006 by The Endocrine Society doi: /me
0888-8809/06/$15.00/0 Molecular Endocrinology 20(9):2062 2079 Printed in U.S.A. Copyright 2006 by The Endocrine Society doi: 10.1210/me.2005-0316 Androgens, Progestins, and Glucocorticoids Induce Follicle-Stimulating
More informationAn Introduction to Carbohydrates
An Introduction to Carbohydrates Carbohydrates are a large class of naturally occurring polyhydroxy aldehydes and ketones. Monosaccharides also known as simple sugars, are the simplest carbohydrates containing
More informationPart-4. Cell cycle regulatory protein 5 (Cdk5) A novel target of ERK in Carb induced cell death
Part-4 Cell cycle regulatory protein 5 (Cdk5) A novel target of ERK in Carb induced cell death 95 1. Introduction The process of replicating DNA and dividing cells can be described as a series of coordinated
More informationLate assembly of the Vibrio cholerae cell division machinery postpones
2 Late assembly of the Vibrio cholerae cell division machinery postpones septation to the last % of the cell cycle 3 4 Elisa Galli, Evelyne Paly and François-Xavier Barre,# 5 6 7 Institute for Integrative
More informationS1a S1b S1c. S1d. S1f S1g S1h SUPPLEMENTARY FIGURE 1. - si sc Il17rd Il17ra bp. rig/s IL-17RD (ng) -100 IL-17RD
SUPPLEMENTARY FIGURE 1 0 20 50 80 100 IL-17RD (ng) S1a S1b S1c IL-17RD β-actin kda S1d - si sc Il17rd Il17ra rig/s15-574 - 458-361 bp S1f S1g S1h S1i S1j Supplementary Figure 1. Knockdown of IL-17RD enhances
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Choi YL, Soda M, Yamashita Y, et al. EML4-ALK mutations in
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. EBV-gB 23-431 mainly exists as trimer in HEK 293FT cells. (a) Western blotting analysis for DSS crosslinked FLAG-gB 23-431. HEK 293FT cells transfected
More informationConstruction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation
Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation J. Du 1, Z.H. Tao 2, J. Li 2, Y.K. Liu 3 and L. Gan 2 1 Department of Chemistry,
More informationProblem 2 (10 Points) The wild type sequence of the coding region of an mrna is shown below.
Problem 2 (10 Points) The wild type sequence of the coding region of an mrna is shown below. 5 AUG ACC UGG AAU AAA UGA 3 Use that sequence to answer each of the questions below. a) What is the sequence
More informationSupplementary Figures
Supplementary Figures a miel1-2 (SALK_41369).1kb miel1-1 (SALK_978) b TUB MIEL1 Supplementary Figure 1. MIEL1 expression in miel1 mutant and S:MIEL1-MYC transgenic plants. (a) Mapping of the T-DNA insertion
More informationeffects on organ development. a-f, Eye and wing discs with clones of ε j2b10 show no
Supplementary Figure 1. Loss of function clones of 14-3-3 or 14-3-3 show no significant effects on organ development. a-f, Eye and wing discs with clones of 14-3-3ε j2b10 show no obvious defects in Elav
More informationRescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al
Supplementary Material Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Figure 1. AICAR improves P23H rod opsin
More informationSupplementary Material
Supplementary Material accompanying the manuscript Interleukin 37 is a fundamental inhibitor of innate immunity Marcel F Nold, Claudia A Nold-Petry, Jarod A Zepp, Brent E Palmer, Philip Bufler & Charles
More informationBMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented
Supplemental Materials Figure S1. Cultured BMDCs express CD11c BMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented with 15 ng/ml GM-CSF. Media was changed and fresh
More informationSupplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-
More informationSupplementary Information. Supplementary Figure 1
Supplementary Information Supplementary Figure 1 1 Supplementary Figure 1. Functional assay of the hcas9-2a-mcherry construct (a) Gene correction of a mutant EGFP reporter cell line mediated by hcas9 or
More informationSupporting Information
Supporting Information Dauvillée et al. 10.1073/pnas.0907424106 Fig. S1. Iodine screening of the C. cohnii mutant bank. Each single colony was grown on rich-medium agar plates then vaporized with iodine.
More informationSupplemental Data. Short Article. ATF4-Mediated Induction of 4E-BP1. Contributes to Pancreatic β Cell Survival. under Endoplasmic Reticulum Stress
Cell Metabolism, Volume 7 Supplemental Data Short Article ATF4-Mediated Induction of 4E-BP1 Contributes to Pancreatic β Cell Survival under Endoplasmic Reticulum Stress Suguru Yamaguchi, Hisamitsu Ishihara,
More informationGene expression scaled by distance to the genome replication site. Ying et al. Supporting Information. Contents. Supplementary note I p.
Gene expression scaled by distance to the genome replication site Ying et al Supporting Information Contents Supplementary note I p. 2 Supplementary note II p. 3-5 Supplementary note III p. 5-7 Supplementary
More informationViral vaccines. Lec. 3 أ.د.فائزة عبد هللا مخلص
Lec. 3 أ.د.فائزة عبد هللا مخلص Viral vaccines 0bjectives 1-Define active immunity. 2-Describe the methods used for the preparation of attenuated live & killed virus vaccines. 3- Comparison of Characteristics
More informationEGFR shrna A: CCGGCGCAAGTGTAAGAAGTGCGAACTCGAGTTCGCACTTCTTACACTTGCG TTTTTG. EGFR shrna B: CCGGAGAATGTGGAATACCTAAGGCTCGAGCCTTAGGTATTCCACATTCTCTT TTTG
Supplementary Methods Sequence of oligonucleotides used for shrna targeting EGFR EGFR shrna were obtained from the Harvard RNAi consortium. The following oligonucleotides (forward primer) were used to
More informationIdentification of vaccine candidate antigens for a Babesia bovis transmission blocking vaccine
Identification of vaccine candidate antigens for a Babesia bovis transmission blocking vaccine Carlos E. Suarez Animal Disease Research Unit ARS-USDA Department of Veterinary Microbiology and Pathology
More informationNature Immunology: doi: /ni Supplementary Figure 1. Cellularity of leukocytes and their progenitors in naive wild-type and Spp1 / mice.
Supplementary Figure 1 Cellularity of leukocytes and their progenitors in naive wild-type and Spp1 / mice. (a, b) Gating strategies for differentiated cells including PMN (CD11b + Ly6G hi and CD11b + Ly6G
More informationSupplementary Figure 1. Expression of the inducible tper2 is proportional to Dox/Tet concentration in Rosa-DTG/Per2 Per2-luc/wt MEFs.
Supplementary Figure 1. Expression of the inducible tper2 is proportional to Dox/Tet concentration in Rosa-DTG/Per2 Per2-luc/wt MEFs. (a) Dose-responsive expression of tper2 by Dox. Note that there are
More informationSupplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells
Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells Immunofluorescence staining of H3K9me3 and 53BP1 in PH and HGADFN003 (HG003) cells at 24 h after γ-irradiation. Scale bar,
More information8 Suppression Analysis
Genetic Techniques for Biological Research Corinne A. Michels Copyright q 2002 John Wiley & Sons, Ltd ISBNs: 0-471-89921-6 (Hardback); 0-470-84662-3 (Electronic) 8 Suppression Analysis OVERVIEW Suppression
More informationThough sugars are important sources of carbon and energy for
Depletion of Glycolytic Intermediates Plays a Key Role in Glucose- Phosphate Stress in Escherichia coli Gregory R. Richards,* Maulik V. Patel, Chelsea R. Lloyd, Carin K. Vanderpool Department of Microbiology,
More informationa b G75 G60 Sw-2 Sw-1 Supplementary Figure 1. Structure predictions by I-TASSER Server.
a b G75 2 2 G60 Sw-2 Sw-1 Supplementary Figure 1. Structure predictions by I-TASSER Server. a. Overlay of top 10 models generated by I-TASSER illustrates the potential effect of 7 amino acid insertion
More informationTKB1 Competent Cells. Instruction Manual. Research Use Only. Not for Use in Diagnostic Procedures. Catalog # Revision B
TKB1 Competent Cells Instruction Manual Catalog #200134 Revision B Research Use Only. Not for Use in Diagnostic Procedures. 200134-12 LIMITED PRODUCT WARRANTY This warranty limits our liability to replacement
More informationSupplementary Figure 1. Supernatants electrophoresis from CD14+ and dendritic cells. Supernatants were resolved by SDS-PAGE and stained with
Supplementary Figure 1. Supernatants electrophoresis from CD14+ and dendritic cells. Supernatants were resolved by SDS-PAGE and stained with Coomassie brilliant blue. One µg/ml recombinant human (rh) apo-e
More informationIdentification of Functional Domains in the 14-Kilodalton Envelope Protein (A27L) of Vaccinia Virus
JOURNAL OF VIROLOGY, Nov. 1999, p. 9098 9109 Vol. 73, No. 11 0022-538X/99/$04.00 0 Copyright 1999, American Society for Microbiology. All Rights Reserved. Identification of Functional Domains in the 14-Kilodalton
More informationProblem Set 8 Key 1 of 8
7.06 2003 Problem Set 8 Key 1 of 8 7.06 2003 Problem Set 8 Key 1. As a bright MD/PhD, you are interested in questions about the control of cell number in the body. Recently, you've seen three patients
More informationSupplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or
Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or 3xflag-CagA expression vector were wounded using a pipette
More informationCHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000)
CHAPTER 4 RESULTS 4.1 Growth Characterization of C. vulgaris 4.1.1 Optical Density Growth study of Chlorella vulgaris based on optical density at 620 nm (OD 620 ) showed that all three replicates had similar
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Effect of HSP90 inhibition on expression of endogenous retroviruses. (a) Inducible shrna-mediated Hsp90 silencing in mouse ESCs. Immunoblots of total cell extract expressing the
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Mutational analysis of the SA2-Scc1 interaction in vitro and in human cells. (a) Autoradiograph (top) and Coomassie stained gel (bottom) of 35 S-labeled Myc-SA2 proteins (input)
More informationSupplementary Materials
Supplementary Materials Figure S1. MTT Cell viability assay. To measure the cytotoxic potential of the oxidative treatment, the MTT [3-(4,5-dimethylthiazol- 2-yl)-2,5-diphenyl tetrazolium bromide] assay
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationSupplementary. limb. bars
Figure 1. CD163 -/- mice exhibit a similar phenotype ass WT mice in the absence of ischemic injury. a, Laser Doppler analysiss with perfusion quantitation at baseline (n= =10 per group). b, Immunostaining
More informationSupplemental Figure S1.
53 kda- WT TPS29.2 (ethanol) TPS29.2 (water) Supplemental Figure S1. Inducible expression of E. coli otsa (TPS) in Arabidopsis. Immunoblot of leaf proteins (20 µg per lane) extracted from: (i) WT Col-0,
More informationUnderstanding Gallibacterium-Associated Peritonitis in the Commercial Egg-Laying Industry
Understanding Gallibacterium-Associated Peritonitis in the Commercial Egg-Laying Industry Timothy J. Johnson A, Lisa K. Nolan B, and Darrell W. Trampel C A University of Minnesota, Department of Veterinary
More informationSupplementary Table 1. Metabolic parameters in GFP and OGT-treated mice
Supplementary Table 1. Metabolic parameters in GFP and OGT-treated mice Fasted Refed GFP OGT GFP OGT Liver G6P (mmol/g) 0.03±0.01 0.04±0.02 0.60±0.04 0.42±0.10 A TGs (mg/g of liver) 20.08±5.17 16.29±0.8
More informationSelenoMet Dream TM Media Kit (MD12-506)
SelenoMet Dream TM Media Kit (MD12-506) For the Overnight Expression of Recombinant Proteins About the Kit: MD12-506 contains: (*each packet contains enough to make up 1L of media) Description For the
More informationNature Genetics: doi: /ng Supplementary Figure 1. Susceptibility of MTase-deficient E. coli K12 to sublethal ampicillin treatment.
Supplementary Figure 1 Susceptibility of MTase-deficient E. coli K12 to sublethal ampicillin treatment. (a,b) Wild-type (wt) or MTase-deficient E. coli BW25113 (a) or MG1655 (b) were grown in LB to an
More informationNature Immunology: doi: /ni Supplementary Figure 1
Supplementary Figure 1 NLRP12 is downregulated in biopsy samples from patients with active ulcerative colitis (UC). (a-g) NLRP12 expression in 7 UC mrna profiling studies deposited in NCBI GEO database.
More informationSupplementary Information
Supplementary Information Precursors of trnas are stabilized by methylguanosine cap structures Takayuki Ohira and Tsutomu Suzuki Department of Chemistry and Biotechnology, Graduate School of Engineering,
More informationSupplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.
More informationCharacterization of the DNA-mediated Oxidation of Dps, a Bacterial Ferritin
SUPPORTING INFORMATION Characterization of the DNA-mediated Oxidation of Dps, a Bacterial Ferritin Anna R. Arnold, Andy Zhou, and Jacqueline K. Barton Division of Chemistry and Chemical Engineering, California
More information100 mm Sucrose. +Berberine +Quinine
8 mm Sucrose Probability (%) 7 6 5 4 3 Wild-type Gr32a / 2 +Caffeine +Berberine +Quinine +Denatonium Supplementary Figure 1: Detection of sucrose and bitter compounds is not affected in Gr32a / flies.
More informations u p p l e m e n ta ry i n f o r m at i o n
Figure S1 Characterization of tet-off inducible cell lines expressing GFPprogerin and GFP-wt lamin A. a, Western blot analysis of GFP-progerin- or GFP-wt lamin A- expressing cells before induction (0d)
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Jewell et al., http://www.jcb.org/cgi/content/full/jcb.201007176/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. IR Munc18c association is independent of IRS-1. (A and
More informationSoluble ADAM33 initiates airway remodeling to promote susceptibility for. Elizabeth R. Davies, Joanne F.C. Kelly, Peter H. Howarth, David I Wilson,
Revised Suppl. Data: Soluble ADAM33 1 Soluble ADAM33 initiates airway remodeling to promote susceptibility for allergic asthma in early life Elizabeth R. Davies, Joanne F.C. Kelly, Peter H. Howarth, David
More informationFigure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.
Figure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.129-Gt(ROSA)26Sor tm1(cre/ert2)tyj /J mice. To induce deletion of the Pten locus,
More informationSupplementary Figures. T Cell Factor-1 initiates T helper 2 fate by inducing GATA-3 and repressing Interferon-γ
Supplementary Figures T Cell Factor-1 initiates T helper 2 fate by inducing GATA-3 and repressing Interferon-γ Qing Yu, Archna Sharma, Sun Young Oh, Hyung-Geun Moon, M. Zulfiquer Hossain, Theresa M. Salay,
More informationFigure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei.
Figure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei. (B) The standard curve for lysine concentrations versus OD600 values
More informationModule 4: Effect of Alcohol on Worms
Module 4: Effect of Alcohol on Worms Michael Dunn Capuchino High School Gregory Chin, Ph.D. BABEC Introduction Alcohol is a drug that affects the nervous system of many animals. The type of alcohol that
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationEXPERIMENT 26: Detection of DNA-binding Proteins using an Electrophoretic Mobility Shift Assay Gel shift
EXPERIMENT 26: Detection of DNA-binding Proteins using an Electrophoretic Mobility Shift Assay Gel shift Remember to use sterile conditions (tips, tubes, etc.) throughout this experiment Day 1: Biotinylation
More informationCloning and Expression of a Subfamily 1.4 Lipase from Bacillus licheniformis IBRL-CHS2
Tropical Life Sciences Research, 27(Supp. 1), 145 150, 2016 Cloning and Expression of a Subfamily 1.4 Lipase from Bacillus licheniformis IBRL-CHS2 1 Nidyaletchmy Subba Reddy, 1 Rashidah Abdul Rahim *,
More informationCourse Title Form Hours subject
Course Title Form Hours subject Types, and structure of chromosomes L 1 Histology Karyotyping and staining of human chromosomes L 2 Histology Chromosomal anomalies L 2 Histology Sex chromosomes L 1 Histology
More informationA Yersinia-Secreted Effector Protein Promotes Virulence by Preventing Inflammasome Recognition of the Type III Secretion System
Cell Host & Microbe, Volume 7 Supplemental Information A Yersinia-Secreted Effector Protein Promotes Virulence by Preventing Inflammasome Recognition of the Type III Secretion System Igor E. Brodsky, Noah
More informationLentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression.
Supplementary Figure 1 Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. a, Design for lentiviral combinatorial mirna expression and sensor constructs.
More informationExosomes function in antigen presentation during an in vivo Mycobacterium tuberculosis infection
Exosomes function in antigen presentation during an in vivo Mycobacterium tuberculosis infection Victoria L. Smith, Yong Cheng, Barry R. Bryant and Jeffrey S. Schorey Supplementary Figure 1: Unprocessed
More information