Erythropoietin preserves the endothelial differentiation potential of cardiac progenitor cells and attenuates heart failure during anti-cancer therapy
|
|
- Mariah Hoover
- 5 years ago
- Views:
Transcription
1 Erythropoietin preserves the endothelial differentiation potential of cardiac progenitor cells and attenuates heart failure during anti-cancer therapy Melanie Hoch Cardiology & Angiology MHH, Hannover
2 Situations where hearts are prone to develop failure include treatment concepts for human malignancies. The anthracyclin doxorubicin (DOX), has been used effectively to treat a broad range of cancers. Its clinical usage and efficacy, however, is limited by side effects, especially cardiomyopathy and heart failure (Ferreira et al., 28). Blocking STAT3 signaling by antisense, RNA interference (RNAi), peptides, and small molecular inhibitors appears successful in suppression of tumor cell growth and apoptosis making STAT3 an attractive molecular target for the development of novel cancer therapeutics (Alas and Bonavida, 23; Deng et al., 27). In turn, observations from our and other labs clearly show that downregulation of STAT3 pre-disposes the heart to failure (Hilfiker-Kleiner et al., 24; Hilfiker-Kleiner et al., 27; Jacoby et al., 23).
3 Early and late-onset of cardiomyopathy after cardiotoxic treatments Early-onset cardiotoxicity: Onset within one year after completion of treatment with a chronic dilated cardiomyopathy. Late-onset cardiotoxicity: Onset of progressive left ventricular dysfunction leading to irreversible congestive heart failure up to 15 years after treatment. Late-onset heart failure seems often triggered by events such as exercise, pregnancy, and acute viral infection. Frequency of cardiotoxic effects in survivors of childhood cancer: up to 57%.
4 Hypothesis for late-onset cardiomyopathy: Chemotherapy impairs the endogenous cardiac regeneration potential of the heart by altering the cardiac microenvironment. cardiomyocyte cardiac function cardiac remodeling paracrine factors cardiac vascularization cardiac microenvironment
5 count count Isolation of cardiac Sca-1 + progenitor cells (CPC) by the MACS system Male mice (age 3 to 4 months) Sca-1 + cells before selection post selection > 92% Sca-1 + FACS Characterization Marker Expression Marker Expression ckit 1% CD13 45% CD133 4% CD73 6% CD16 % CD29 13% FLK-1 % CD44 17% CD144 % CD9 28% CD34 % CD15 25% CD45 % CD31 3% No expression of hematopoietic or endothelial progenitors. Expression of mesenchymal markers CD13, CD73, CD29, CD44, and CD9 Sca-1-FITC RT-PCR Foxa2 Brachyury Oct4 Nanog Sox2 GAPDH Sca-1-FITC ES Flow CPC H 2 O CPC, but not the non-cpc cell fraction express nanog and brachyury. Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
6 Subpopulations of Sca-1 + CPC differentiate into vascular endothelial cells, pericytes/fibroblasts and adipocytes Endothelial cells Pericytes/Fibroblasts VE-Cadherin Cre tg/+ ; ROSA flox/+ CPC Cre+ 4W CPC Cre+ Flow Cre+ Sca-1/vimentin Sca-1/sm-α-actin Sca-1/NG2 VE-Cad GAPDH enos/dapi CPC fresh CPC 4W LV VE-Cadherin/DAPI (%) VE-Cadherin mrna VEGFR3/DAPI CPC fresh CPC 4W Adipocytes Oil Red IB4/DAPI FLK-1/DAPI VEGFR3/IB4/DAPI Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
7 count count CCR2 and R double-positive WT-CPC exert a high endothelial differentiation potential FACS Characterization 29% R + 28% CCR2 + Sca-1 + IB4/DAPI Sca-1 +/ R + /CCR2 + IB4/DAPI R-APC CCR2-APC Freshly isolated WT-CPC CCR2/DAPI Sca-1/DAPI R/DAPI Overlay Branching Points (%) 25 2 Sca-1 + Sca-1 + / R + /CCR2 + Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
8 Clonal analysis confirms that CCR2 and R double-positive CPC differentiate into vascular endothelial cells Clonal analysis Clone Sca-1 Nanog E-Cadherin VE-cadherin Endothelial Differentiation C C18 Nd C C C C27 Nd C Clonal analysis C25 in matrigel VE-Cadherin DAPI RT-PCR C25 C26 VE-Cadherin/DAPI VEGFR3 CCR2 R GAPDH Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
9 CPC express the CCR2 ligand but not R CCR2 CPC HEK 293 /DAPI /DAPI CPC Liver IgG/DAPI RT-PCR K CPC IgG RT-PCR L CPC GAPDH CPC bind in the cardiac microenvironment /Sca-1/DAPI /Sca-1/DAPI GAPDH Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
10 Activation of CCR2 is required for endothelial differentiation of CPC R CCR2 Impaired endothelial differentiation of CCR2-KO-CPC or WT-CPC with CCR2-Inhibitor control RS CCR2-KO (%) 15 Branching Points 1 5 n=3 independent isolations (each isolation: 1 mice) WT-CPC WT-CPC, RS CCR2-KO-CPC p<.5, p<.5 Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
11 Hypothesis for late-onset cardiomyopathy: Blockade of cardiac STAT3 impairs the endogenous cardiac regeneration by altering the cardiac microenvironment. cardiomyocyte STAT3 paracrine factors cardiac function cardiac remodeling cardiac vascularization cardiac microenvironment
12 Cardiomyocyte-specific deficiency for STAT3 pre-disposes to heart failure in response to age-, pregnancy-, I/R- and doxorubicin-mediated stress Hilfiker-Kleiner, D et al., Circ Res 24 Hilfiker-Kleiner, D et al., Cell 27 Hilfiker-Kleiner, D et al., Circ Res 24 Negoro et al., CVR 2 Kunisada et al., PNAS 2 cardiomyocyte STAT3 paracrine factors cardiac function cardiac vascularization endothelial differentiation cardiac microenvironment human heart failure STAT3 ptyrstat3/stat3 Reduced expression and activation of STAT3 in the failing human heart (Podewski et al. Circ. 23)
13 Impaired endothelial differentiation of CPC from mice with a cardiomyocyte-specific STAT3 deletion (CKO) compared to CPC from WT hearts WT CKO Sca-1 + cells STAT3 WT-CPC Equal STAT3 protein levels in WT- and CKO-CPC WT CPC CKO STAT3 STAT3 CKO-CPC Actin Sca-1 + CPC from CKO mice displayed impaired endothelial differentiation in vitro Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
14 CCR2 Cy3 FL2-H: CCR2 Cy3 CCR2 Cy3 FL2-H: CCR2 Cy3 % of Max % of Max The impaired endothelial net formation of CKO-CPC was associated with a reduced CCR2 expression R CCR2 FACS Analysis WT- vs. CKO-CPC WT CCR2 CKO CCR R 1 8 CCR FL1-H: SCA1 FITC Sca-1 FITC FL1-H: SCA1 FITC Sca-1 FITC R Cy CCR2 Cy3 WT-CPC CKO-CPC Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
15 and with increased generation of antagonistic achieved by up-regulated MMP-12 expression MMP-12 Micro array analysis CKO-CPC Fold change compared to WT-CPC Cleavage Assay WT CKO r cl PF Addition of and MMP-12 inhibitor improves endothelial differentiation in CKO-CPC R. Dean et al. 28, Blood Impaired endothelial differentiation of MMP-12 Branching Points (%) Branching Points CKO-CPC CKO-CPC, CKO-CPC, +PF control rmmp-12 (%) WT-CPC WT-CPC, MMP-12 Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
16 expression was markedly reduced in CKO hearts. Is there a connection between low cardiac, blocked CCR2 signaling on CPCs and their impaired angiongenic potential? Impaired endothelial differentiation CKO-CPC Altered /CCR2/MMP-12 system in CKO-CPC MMP-12 paracrine factors? Cardiomyocyte STAT3- deficiency STAT3 cl. Micro array analysis of CKO hearts /Sca-1/DAPI Fold change compared to WT hearts Is a paracrine factor that acts in the cardiac microenvironment?
17 expression in normoxic hearts depends in part on STAT3 IHC of murine LV sections WT CKO Epo-TAg h Western Blot WT CKO EpoTAg h /α-actinin /α-actinin /α-actinin Actin IgG Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
18 Expression in cultivated cardiomyocytes depends on STAT3 IHC of NRCM α-actinin//dapi Western Blot NRCM C KO STAT3 Actin C: Control KO: STAT3-Knockdown Methylcellulose-Assay (CFU) RT-PCR Methylcellulose-Assay (CFU) neg. control pos. control NRCM scramble scramble sirna kidney NRCM supernatant heat-inactivated NRCM supernatant GAPDH sirna Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
19 R MMP-12 CCR2 cl. r to CKO-CPC cultures improved their endothelial differentiation WT-CPC control r CKO-CPC control r CKO-CPC control r qrt-pcr after 4 weeks MMP-12 (%) 2 (%) CKO-CPC CKO-CPC, repo (%) Branching Points WT-CPC WT-CPC, repo ## Sprouting (%) CKO-CPC CKO-CPC, repo (%) VE-Cadherin mrna Luciferase Activity of the promoter (%) n=3; p<.5 vs. CKO, p<.1 vs. WT; ## p<.5 vs. CKO Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211 control r TNF
20 r can not improve endothelial differentiation of CCR2-KO-CPC or of WT-CPC with blocked CCR2 suggesting that induces endothelial differentiation in CPCs via CCR2 signaling. R MMP-12 CCR2 cl. WT-CPC with CCR2-inhibitor CCR2-KO-CPC WT-CPC IB4/DAPI WT-CPC, RS IB4/DAPI (%) 12 Branching Points n.s. (%) 12 Branching Points WT-CPC, RS-12895, r IB4/DAPI WT-CPC WT-CPC, RS WT-CPC, RS r n.s. WT-CPC CCR2-KO CPC CCR2-KO CPC,r n=3; p<.5 vs. WT, p<.1 vs. WT Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
21 Reconstitution of by treatment with CERA Has the reduction of myocardial levels an effect on the myocardial vascularisation? Cardiomyocyte CPC R STAT3 CCR2 CPC Cardiac Vasculogenesis endothelial differentiation
22 Treatment of CKO mice with the derivative CERA restored endothelial differentiation of CKO-CPC R MMP-12 CCR2 cl. Low-dose CERA (Continunous Erythropoiesis Receptor Activator) treatment over 3 weeks in vivo in a non-hematocrit influencing dosage (3 g/kgbw/week) 3 weeks in vivo treatment followed by 4 weeks of in vitro cultivation WT control CKO control qrt-pcr of freshly isolated CPC after 3 week in vivo treatment (%)15 MMP-12 (%) CPC WT CERA CKO CKO CERA 5 1 CKO-CPC, NaCl CKO-CPC, CERA n=3; p<.5 vs. WT-CPC Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
23 CERA improved capillary density and cardiac function without altering inflammatory status in CKO mice Capillary density (IHC WGA+IB4) CKO control CKO CERA CD45 staining CKO control CKO CERA Capillaries/Cardiomyocyte (%) CKO, NaCl CKO, CERA CD45 positive infiltrates (arb. unit) CKO, NaCl CKO, CERA Fractional Shortening (FS) n=5-8 animals; p<.5, p<.5 FS(%) basal NaCl CERA WT CKO Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
24 Hypothesis : DOX impairs the endogenous cardiac regeneration by altering the cardiac microenvironment in a similar way as KO of STAT3 since it is known that DOX down-regulates STAT3 in the heart (Kunisada et al. PNAS 2). DOX C,1,5 STAT3 WT DOX Actin (%) 12 protein Actin 8 4 We could confirm down-regulation of STAT3 by DOX and observed that DOX reduced also expression in cardiomyocytes in vitro and in vivo (Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211)
25 Treatment concept: Repetitive high dose of DOX (6 mg/kg/week for 3 weeks) induces high mortality associated with heart failure and reduced cardiac capillary density Survival curve Fractional Shortening (FS) Capillary density WT/NaCl, n=16 DOX/NaC, n=18 (%) WT NaCl DOX/NaCl (%) WT/NaCl DOX/NaCl days n=6 animals; p<.5, p<.5 Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
26 DOX treatment impairs endothelial differentiation of CPC which is associated with a marked down-regulation of cardiac expression R MMP-12 CCR2 DOX 3 weeks in vivo treatment followed by 4 weeks of in vitro cultivation cl. WT-mice/NaCl IB4/DAPI DOX-mice IB4/DAPI qrt-pcr of cultured CPC after 3 week in vivo treatment PCR (%) WT-CPC/NaCl (%) PCR MMP-12 DOX-CPC Branching points PCR VE-Cadherin (%) 2 (%) WT-CPC/NaCl DOX-CPC n=3 independent isolations (each isolation: 1 mice) p<.5, p<.5 Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
27 Co-treatment with the derivative CERA improved endothelial differentiation and restored expression in CPC from DOX treated mice 3 weeks in vivo treatment followed by 4 weeks of in vitro cultivation qrt-pcr of cultured CPC after 3 week in vivo treatment WT-mice/NaCl DOX-mice/NaCl DOX-mice/CERA IB4/DAPI IB4/DAPI IB4/DAPI (%)15 PCR (%) 15 PCR MMP Branching points (%) PCR VE-Cadherin (%) WT-CPC/NaCl DOX-CPC/NaCl DOX/CERA WT-CPC/NaCl DOX-CPC/NaCl DOX/CERA n=3 independent isolations (each isolation: 1 mice) p<.5, p<.5 Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
28 and it prevented decrease in cardiac capillary density and function and improved survival in DOX treated mice Survival curve Fractional Shortening (FS) Capillary density WT/NaCl, n=16 DOX/NaC, n=18 DOX/CERA, n=17 ## (%) WGA/IB4/DAPI WT NaCl DOX/NaCl DOX/CERA (%) WT/NaCl DOX/NaCl DOX/CERA n=6 animals; p<.5, p<.5 Hoch,..., Hilfiker-Kleiner, Cell Stem Cell 211
29 Summary The endothelial regeneration potential of CPCs is altered in hearts exposed to anti-tumor therapy regimes involving DOX or reduction in STAT3. Alterations in the cardiac microenvironment are responsible for modifications of the autocrine /CCR2 system that is needed for endothelial differentiation of CPC. is a component of the cardiac microenvironment that is disturbed by DOX and cardiomyocyte STAT3 reduction. treatment improves endothelial differentiation of CPCs via activation of CCR2, preserves the cardiac vasculature and prevents heart failure in mice harboring a cardiac STAT3 deficiency or obtaining DOX treatment.
30 Conclusion Schneider, editiorial, Cell Stem Cell 211 Diseased hearts display an altered cardiac micorenvironment that affects the regeneration potential of progenitor cells. Exogenous (hematocrit-inactive) may help to restore the cardiac microenvironment thereby improving cardiac regeneration during anti-tumor drug therapy and may be even in a more general way to improve regenerative strategies of the heart involving cell therapeutic approaches.
31 Acknowledgements Hannover Medical School Molecular Cardiology D. Hilfiker-Kleiner B. Stapel P. Fischer A. Haghikia S. Erschow Molecular Biology K. Schuster-Gossler A. Gossler University of Louvain Medical School Experimental and Clinical Research Institute B. Sekkali J.-L. Balligand Haematology, Haemostasis, Oncology and Stem cell transplantation M. Scherr M. Eder University Paris F. Favret MPI Bad Nauheim T. Braun
Induction of myocardial regeneration to attenuate cardiotoxicity
Induction of myocardial regeneration to attenuate cardiotoxicity Denise Hilfiker-Kleiner Kardiologie & Angiologie MHH, Hannover I have nothing to declare. Situations where hearts are prone to develop failure
More informationErythropoietin Preserves the Endothelial Differentiation Capacity of Cardiac Progenitor Cells and Reduces Heart Failure during Anticancer Therapies
Article Erythropoietin Preserves the Endothelial Differentiation Capacity of Cardiac Progenitor Cells and Reduces Heart Failure during Anticancer Therapies Melanie Hoch, 1,8 Philipp Fischer, 1,8 Britta
More informationSupplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained
Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained with MitoTracker (red), then were immunostained with
More informationBromocriptine for the treatment of PPCM A multicenter, randomized study. Results and Implication
Bromocriptine for the treatment of PPCM A multicenter, randomized study Results and Implication Denise Hilfiker-Kleiner Kardiologie & Angiologie MHH, Hannover Funding by DFG Excellence Cluster REBIRTH
More informationProlactin and its cleaved 16-kDa subform. enhance myocardial injury after ischemia/reperfusion
Prolactin and its cleaved 16-kDa subform enhance myocardial injury after ischemia/reperfusion Hatice Yamac, Denise Hilfiker-Kleiner Department of Cardiology & Angiology Hannover, Medical School There is
More informationPeripartum Cardiomyopathy
Peripartum Cardiomyopathy Denise Hilfiker-Kleiner Kardiologie & Angiologie MHH, Hannover Nothing to disclose Peri- or Postpartum Cardiomyopathy Peri- or postpartum cardiomyopathy (PPCM) is a disorder of
More informationEuropean Society of Cardiology Congress DONOR AGE NEGATIVELY INFLUENCES THE CYTOPROTECTIVE PARACRINE EFFECTS EXERTED BY HUMAN MESENCHYMAL STEM CELLS
European Society of Cardiology Congress 28 Aug - 01 Sep 2009, Stockholm - Sweden DONOR AGE NEGATIVELY INFLUENCES THE CYTOPROTECTIVE PARACRINE EFFECTS EXERTED BY HUMAN MESENCHYMAL STEM CELLS Massimiliano
More informationc Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.
a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8
More informationUpdate on mechanisms of peripartum cardiomyopathy: New Heart Failure Association working group position statement
Update on mechanisms of peripartum cardiomyopathy: New Heart Failure Association working group position statement Denise Hilfiker-Kleiner Kardiologie & Angiologie MHH, Hannover I have nothing to declare.
More informationE10.5 E18.5 P2 10w 83w NF1 HF1. Sham ISO. Bmi1. H3K9me3. Lung weight (g)
Myociyte cross-sectional Relative mrna levels Relative levels Relative mrna levels Supplementary Figures and Legends a 8 6 4 2 Ezh2 E1.5 E18.5 P2 1w 83w b Ezh2 p16 amhc b-actin P2 43w kd 37 86 16 wt mouse
More informationControl. csarnt -/- Cre, f/f
ody weight (g) A re,f/f re x f/f f/+ re, f/+ re,f/+ f/f x f/f f/+ cs -/- re, f/f re f/f re, f/f Normal chow Tamoxifen Tamoxifen Tamoxifen W 4W re f/f re, re/ff f/f re f/f re, re/ff f/f Normal chow Tamoxifen
More informationX P. Supplementary Figure 1. Nature Medicine: doi: /nm Nilotinib LSK LT-HSC. Cytoplasm. Cytoplasm. Nucleus. Nucleus
a b c Supplementary Figure 1 c-kit-apc-eflu780 Lin-FITC Flt3-Linc-Kit-APC-eflu780 LSK Sca-1-PE-Cy7 d e f CD48-APC LT-HSC CD150-PerCP-cy5.5 g h i j Cytoplasm RCC1 X Exp 5 mir 126 SPRED1 SPRED1 RAN P SPRED1
More informationResident cardiac stem cells: how to find and use them
Resident cardiac stem cells: how to find and use them G. Hasenfuß Cardiology and Pneumology Heart Research Center Göttingen Georg-August-University Göttingen Definition: Stem cell Selfrenewal Stem cell
More informationUpdate on peripartum cardiomyopathy: Pathophysiology
Update on peripartum cardiomyopathy: Pathophysiology I HAVE NOTHING TO DISCLOSE Denise Hilfiker-Kleiner Kardiologie & Angiologie MHH, Hannover Peri- or Postpartum Cardiomyopathy Peri- or postpartum cardiomyopathy
More informationE. Cervio, P. Danieli, C. Ciuffreda, F. Pisano, M. Roccio, M. Gnecchi. The authors have no financial disclosures to declare
16 th ISCT Annual Meeting SOLUBLE FACTORS RELEASED BY HUMAN MESENCHYMAL STEM CELLS OF FETAL ORIGIN LEAD TO CARDIOMYOCYTE PROTECTION THROUGH THE INHIBITION OF PRO-APOPTOTIC SIGNALING E. Cervio, P. Danieli,
More informationThe Role of Rac Signaling in The Perivascular Niche
The Role of Rac Signaling in The Perivascular Niche Felicia Ciuculescu Diaspora and Higher Education and Research Perspectives in Personalized Medicine- from Concept to Clinical Application Center for
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationTable S1. Primer sequences used for qrt-pcr. CACCATTGGCAATGAGCGGTTC AGGTCTTTGCGGATGTCCACGT ACTB AAGTCCATGTGCTGGCAGCACT ATCACCACTCCGAAGTCCGTCT LCOR
Table S1. Primer sequences used for qrt-pcr. ACTB LCOR KLF6 CTBP1 CDKN1A CDH1 ATF3 PLAU MMP9 TFPI2 CACCATTGGCAATGAGCGGTTC AGGTCTTTGCGGATGTCCACGT AAGTCCATGTGCTGGCAGCACT ATCACCACTCCGAAGTCCGTCT CGGCTGCAGGAAAGTTTACA
More informationSupplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin
More informationSupplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.
More informationMonoclonal antibody targeting of N-cadherin inhibits prostate cancer growth, metastasis and castration resistance
Monoclonal antibody targeting of N-cadherin inhibits prostate cancer growth, metastasis and castration resistance Tanaka H, Kono E, Tran CP, Miyazaki H, Yamashiro J, Shimomura T, Ladan F, Wada R, Huang
More informationKidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI
a e Na V 1.5 Ad-LacZ Ad- 110KD b Scn5a/ (relative to Ad-LacZ) f 150 100 50 0 p = 0.65 Ad-LacZ Ad- c Heart Lung Kidney Spleen 110KD d fl/fl c -/- DAPI 20 µm Na v 1.5 250KD fl/fl Rabbit IgG DAPI fl/fl Mouse
More informationNature Genetics: doi: /ng Supplementary Figure 1
Supplementary Figure 1 MSI2 interactors are associated with the riboproteome and are functionally relevant. (a) Coomassie blue staining of FLAG-MSI2 immunoprecipitated complexes. (b) GO analysis of MSI2-interacting
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11095 Supplementary Table 1. Summary of the binding between Angptls and various Igdomain containing receptors as determined by flow cytometry analysis. The results were summarized from
More informationNature Immunology: doi: /ni Supplementary Figure 1. Huwe1 has high expression in HSCs and is necessary for quiescence.
Supplementary Figure 1 Huwe1 has high expression in HSCs and is necessary for quiescence. (a) Heat map visualizing expression of genes with a known function in ubiquitin-mediated proteolysis (KEGG: Ubiquitin
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationSupplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationSupplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation
Neuron, Volume 100 Supplemental Information Menin Deficiency Leads to Depressive-like Behaviors in Mice by Modulating Astrocyte-Mediated Neuroinflammation Lige Leng, Kai Zhuang, Zeyue Liu, Changquan Huang,
More informationInternational Graduate Research Programme in Cardiovascular Science
1 International Graduate Research Programme in Cardiovascular Science This work has been supported by the European Community s Sixth Framework Programme under grant agreement n LSHM-CT-2005-01883 EUGeneHeart.
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12215 Supplementary Figure 1. The effects of full and dissociated GR agonists in supporting BFU-E self-renewal divisions. BFU-Es were cultured in self-renewal medium with indicated GR
More informationFigure S1 Genetic or pharmacologic COX-2 inhibition led to increased kidney
SUPPLEMENTAL FIGURE LEGENDS Figure S1 Genetic or pharmacologic COX-2 inhibition led to increased kidney macrophage infiltration. Wild type or COX-2 -/- mice (2 months old, C57/Bl6 background) were treated
More informationSUPPLEMENTARY INFORMATION
a c e doi:10.1038/nature10407 b d f Supplementary Figure 1. SERCA2a complex analysis. (a) Two-dimensional SDS-PAGE gels of SERCA2a complexes. A silver-stained SDSPAGE gel is shown, which reveals a 12 kda
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1. Generation of a conditional allele of the Kindlin-2 gene. (A) A restriction map of the relevant genomic region of Kindlin-2 (top), the targeting construct
More informationTitle of file for HTML: Supplementary Information Description: Supplementary Figures and Supplementary Table
Title of file for HTML: Supplementary Information Description: Supplementary Figures and Supplementary Table Title of file for HTML: Peer Review File Description: Innate Scavenger Receptor-A regulates
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationUncovering the mechanisms of wound healing and fibrosis
Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:
More informationExosomes secreted by Human Cardiac Progenitors contain mirna with cardioprotective and proangiogenic activities
Exosomes secreted by Human Cardiac Progenitors contain mirna with cardioprotective and proangiogenic activities Elisabetta Cervio, PhD Molecular Cardiology Laboratory Cardiocentro Ticino, Lugano, CH International
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2638 Figure S1 Morphological characteristics of fetal testes and ovaries from 6.5-20 developmental weeks. Representative images of Hematoxylin and Eosin staining of testes and ovaries over
More informationType of file: PDF Size of file: 0 KB Title of file for HTML: Supplementary Information Description: Supplementary Figures
Type of file: PDF Size of file: 0 KB Title of file for HTML: Supplementary Information Description: Supplementary Figures Supplementary Figure 1 mir-128-3p is highly expressed in chemoresistant, metastatic
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationFigure SⅠ: Expression of mir-155, mir-122 and mir-196a in allografts compared with
Figure SⅠ: Expression of mir-155, mir-122 and mir-196a in allografts compared with isografts (control) at the 2nd week, 4th and 8th week by RT-PCR. At the advanced stage, the expression of these three
More informationDilated cardiomyopathy (DCM) represents a common
Alterations in Janus Kinase (JAK)-Signal Transducers and Activators of Transcription (STAT) Signaling in Patients With End-Stage Dilated Cardiomyopathy Edith K. Podewski, MD; Denise Hilfiker-Kleiner, PhD;
More informationSupplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin
Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin sections from sham-operated adult hearts (a and i) and
More informationRegulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair
Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Chapter 04 Boek 1_Gie.indb 55 21-05-2007 12:27:33 Chapter 04 Abstract Goal: TGF-b and IGF-I
More informationA Central Role of MG53 in Metabolic Syndrome. and Type-2 Diabetes
A Central Role of MG53 in Metabolic Syndrome and Type-2 Diabetes Yan Zhang, Chunmei Cao, Rui-Ping Xiao Institute of Molecular Medicine (IMM) Peking University, Beijing, China Accelerated Aging in China
More informationFigure S1. ERBB3 mrna levels are elevated in Luminal A breast cancers harboring ERBB3
Supplemental Figure Legends. Figure S1. ERBB3 mrna levels are elevated in Luminal A breast cancers harboring ERBB3 ErbB3 gene copy number gain. Supplemental Figure S1. ERBB3 mrna levels are elevated in
More informationSupplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated
Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate
More informationSupplementary Figure 1. mrna expression of chitinase and chitinase-like protein in splenic immune cells. Each splenic immune cell population was
Supplementary Figure 1. mrna expression of chitinase and chitinase-like protein in splenic immune cells. Each splenic immune cell population was sorted by FACS. Surface markers for sorting were CD11c +
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1. Differential expression of mirnas from the pri-mir-17-92a locus.
Supplementary Figure 1 Differential expression of mirnas from the pri-mir-17-92a locus. (a) The mir-17-92a expression unit in the third intron of the host mir-17hg transcript. (b,c) Impact of knockdown
More informationsequences of a styx mutant reveals a T to A transversion in the donor splice site of intron 5
sfigure 1 Styx mutant mice recapitulate the phenotype of SHIP -/- mice. (A) Analysis of the genomic sequences of a styx mutant reveals a T to A transversion in the donor splice site of intron 5 (GTAAC
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationSupplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous
Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous LRP5 in intact adult mouse ventricular myocytes (AMVMs)
More informationSupplementary Information
Supplementary Information Temozolomide suppresses MYC via activation of TAp63 to inhibit progression of human glioblastoma Tomohiro Yamaki, Yusuke Suenaga, Toshihiko Iuchi, Jennifer Alagu, Atsushi Takatori,
More informationENDOGENOUS CARDIAC STEM CELLS IN THE REGENERATION OF ACUTE AND CHRONIC ISCHEMIC MYOCARDIUM
ENDOGENOUS CARDIAC STEM CELLS IN THE REGENERATION OF ACUTE AND CHRONIC ISCHEMIC MYOCARDIUM Bernardo Nadal-Ginard, M.D., Ph.D. New York Medical College Angioplasty Summit 2004, Seoul 04/29/04 MYOCARDIAL
More informationSupplementary Figure 1. Efficiency of Mll4 deletion and its effect on T cell populations in the periphery. Nature Immunology: doi: /ni.
Supplementary Figure 1 Efficiency of Mll4 deletion and its effect on T cell populations in the periphery. Expression of Mll4 floxed alleles (16-19) in naive CD4 + T cells isolated from lymph nodes and
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationVEGFR2-Mediated Vascular Dilation as a Mechanism of VEGF-Induced Anemia and Bone Marrow Cell Mobilization
Cell Reports, Volume 9 Supplemental Information VEGFR2-Mediated Vascular Dilation as a Mechanism of VEGF-Induced Anemia and Bone Marrow Cell Mobilization Sharon Lim, Yin Zhang, Danfang Zhang, Fang Chen,
More informationSupporting Information
Supporting Information Chan et al. 1.173/pnas.9654916 A Patient B Xenograft C * remaining feature of normal lymph node * * * D lymphocytes Infiltrating transitional carcinoma cells E Enlarged axillary
More informationCardiotoxicities of Cancer in Childhood Cancer Survivors
Cardiotoxicities of Cancer in Childhood Cancer Survivors Steven E. Lipshultz, MD Department of Pediatrics Wayne State University School of Medicine Children s Hospital of Michigan Detroit, MI, USA Stages
More informationSupplemental Figure 1
Supplemental Figure 1 1a 1c PD-1 MFI fold change 6 5 4 3 2 1 IL-1α IL-2 IL-4 IL-6 IL-1 IL-12 IL-13 IL-15 IL-17 IL-18 IL-21 IL-23 IFN-α Mut Human PD-1 promoter SBE-D 5 -GTCTG- -1.2kb SBE-P -CAGAC- -1.kb
More informationSupplementary Figures
Supplementary Figures Supplementary Fig. 1. Galectin-3 is present within tumors. (A) mrna expression levels of Lgals3 (galectin-3) and Lgals8 (galectin-8) in the four classes of cell lines as determined
More informationCellular Physiology and Biochemistry
Original Paper 2015 The Author(s). 2015 Published The Author(s) by S. Karger AG, Basel Published online: November 27, 2015 www.karger.com/cpb Published by S. Karger AG, Basel 2194 1421-9778/15/0376-2194$39.50/0
More informationDECLARATION OF CONFLICT OF. No disclosure INTEREST
DECLARATION OF CONFLICT OF No disclosure INTEREST ESC Congress 2011 2011.8.28 Impaired vacuolar H + -ATPase function causes cardiomyocyte death with extensive vacuolation and impaired autophagic degradation
More informationHIF-inducible mir-191 promotes migration in breast cancer through complex regulation of TGFβ-signaling in hypoxic microenvironment.
HIF-inducible mir-9 promotes migration in breast cancer through complex regulation of TGFβ-signaling in hypoxic microenvironment. Neha Nagpal, Hafiz M Ahmad, Shibu Chameettachal3, Durai Sundar, Sourabh
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 EGFR inhibition activates signaling pathways (a-b) EGFR inhibition activates signaling pathways (a) U251EGFR cells were treated with erlotinib (1µM) for the indicated times followed
More informationSOPten flox/flox (KO) Pten flox/flox (WT) flox allele 6.0 kb. Pten. Actin. ! allele 2.3 kb. Supplementary Figure S1. Yanagi, et al.
s1 A Pten flox/flox () SOPten flox/flox () flox allele 6. kb B Pten flox/flox () SOPten flox/flox () Pten Actin! allele 2.3 kb Supplementary Figure S1. Yanagi, et al. A B BrdU BrdU positive cells ( ) 3
More informationSupplemental Information. Angiocrine Factors Deployed by Tumor Vascular. Niche Induce B Cell Lymphoma Invasiveness. and Chemoresistance
Cancer Cell, Volume 25 Supplemental Information Angiocrine Factors Deployed by Tumor Vascular Niche Induce B Cell Lymphoma Invasiveness and Chemoresistance Zhongwei Cao, Bi-Sen Ding, Peipei Guo, Sharrell
More informationSupplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.
More informationSupplementary Information
Supplementary Information GADD34-deficient mice develop obesity, nonalcoholic fatty liver disease, hepatic carcinoma and insulin resistance Naomi Nishio and Ken-ichi Isobe Department of Immunology, Nagoya
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/2/1/ra81/dc1 Supplementary Materials for Delivery of MicroRNA-126 by Apoptotic Bodies Induces CXCL12- Dependent Vascular Protection Alma Zernecke,* Kiril Bidzhekov,
More informationClinical Perspective: How Are We Doing From a Clinician s Point of View
Clinical Perspective: How Are We Doing From a Clinician s Point of View Steven E. Lipshultz, MD Department of Pediatrics University of Miami Miller School of Medicine Holtz Children s Hospital of the University
More informationCardiotoxicity from Chemotherapy : From Early Predictors to Therapeutics
Cardiotoxicity from Chemotherapy : From Early Predictors to Therapeutics Richard Sheppard MD FRCPC Director of Heart Failure Research Heart Function Clinic Jewish General hospital Objectives 1. Discuss
More informationSupplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic
Supplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic B cells from WT Nfat2 +/+, TCL1 Nfat2 +/+ and TCL1 Nfat2
More informationPRESENT
SYSU-CHINA@iGEM PRESENT ipscs SafeGuard Fang Yiming He Dawei Zhao Yuchen Chen Haoqi Sun Mengyi Possibility of Regeneration 3 Promising Prospect in Medical Application 4 (http://www2.estrellamountain.edu/)
More informationSupplementary Figure 1. Validation of astrocytes. Primary astrocytes were
Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were separated from the glial cultures using a mild trypsinization protocol. Anti-glial fibrillary acidic protein (GFAP) immunofluorescent
More informationEndothelial Injury and Repair as a Working Paradigm
Endothelial Injury and Repair as a Working Paradigm A. Linke ESC Meeting 2010 UNIVERSITÄTLEIPZIG H ERZZEN TRUM Physiology of Endothelial Function: Regulation of Vascular Tone L-Arg. L-Arg. Agonists Shear
More information5K ALDEFLUOR-positive/ CXCR1-negative. 5K ALDEFLUOR-positive/ CXCR1-positive BAAA BAAA CXCR1-APC BAAA BAAA CXCR1-APC
A +DEAB -DEAB K ALDEFLUOR-positive/ CXCR-negative BAAA BAAA CXCR-APC B +DEAB -DEAB K ALDEFLUOR-positive/ CXCR-positive BAAA BAAA CXCR-APC C Supplemental Figure. Tumorigenicity of the ALDEFLUOR-positive/CXCR-positive
More informationGenetic ablation of Acp1 (Lmptp) in mice prevents heart failure
Genetic ablation of Acp1 (Lmptp) in mice prevents heart failure Coralie Poizat, Ph.D. Director, Cardiovascular Research Program KFSHRC-Riyadh Saudi Heart Failure Working Group Jeddah, 5 December 2015 Cardiovascular
More informationRemodeling the failing heart: : the biology and future treatment options
Remodeling the failing heart: : the biology and future treatment options J-L Balligand (UCL-Brussels, BE) jl.balligand@uclouvain.be Myocardial remodeling: definitions phenotypic plasticity : remodeling
More informationhemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and
More informationBmi-1 regulates stem cell-like properties of gastric cancer cells via modulating mirnas
Wang et al. Journal of Hematology & Oncology (2016) 9:90 DOI 10.1186/s13045-016-0323-9 RESEARCH Bmi-1 regulates stem cell-like properties of gastric cancer cells via modulating mirnas Open Access Xiaofeng
More informationReduction of metastatic and angiogenic potency of malignant cancer by Eupatorium. fortunei via suppression of MMP-9 activity and VEGF production
Supplementary Information Reduction of metastatic and angiogenic potency of malignant cancer by Eupatorium fortunei via suppression of MMP-9 activity and VEGF production Aeyung Kim, Minju Im, Nam-Hui Yim
More informationJournal Club Semmler Lorenz
Beer et al. 2015 - Analysis of the Secretome of Apoptotic Peripheral Blood Mononuclear Cells: Impact of Released Proteins and Exosomes for Tissue Regeneration Journal Club 13.11.2017 1 Introduction to
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationDr. Hany M. Abo-Haded
BY Dr. Hany M. Abo-Haded Pediatric Cardiology Unit, Mansoura Universty Children Hospital, Mansoura, Egypt Co-authors: Dina S El-Agamy and Mohamed A Elkablawy Background Doxorubicin (DOX) is an anthracycline
More informationF-actin VWF Vinculin. F-actin. Vinculin VWF
a F-actin VWF Vinculin b F-actin VWF Vinculin Supplementary Fig. 1. WPBs in HUVECs are located along stress fibers and at focal adhesions. (a) Immunofluorescence images of f-actin (cyan), VWF (yellow),
More informationHow does Exercise Work at the Cellular/Molecular Level
How does Exercise Work at the Cellular/Molecular Level Volker Adams, PhD ESC, Paris 28. Aug. 211 UNIVERSITÄT LEIPZIG H E R Z Z E N T R U M Nothing to disclose Survival Exercise Training in Patients With
More informationMouse model of human Barth syndrome
Mouse model of human Barth syndrome Zaza Khuchua, PhD Cincinnati Children s Research Foundation Cincinnati, OH, USA Barry J. Byrne, MD, PhD University of Florida Department of Pediatrics Gainesville, FL,
More informationBNP mrna expression in DR and DS rat left ventricles (n = 5). (C) Plasma norepinephrine
Kanazawa, et al. Supplementary figure legends Supplementary Figure 1 DS rats had congestive heart failure. (A) DR and DS rat hearts. (B) QRT-PCR analysis of BNP mrna expression in DR and DS rat left ventricles
More informationAnalysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats
Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Summary of Doctoral Thesis Hidenori Yasuda Graduate School of Veterinary
More informationTransduction of lentivirus to human primary CD4+ T cells
Transduction of lentivirus to human primary CD4 + T cells Human primary CD4 T cells were stimulated with anti-cd3/cd28 antibodies (10 µl/2 5 10^6 cells of Dynabeads CD3/CD28 T cell expander, Invitrogen)
More informationTargeting tumour associated macrophages in anti-cancer therapies. Annamaria Gal Seminar Series on Drug Discovery Budapest 5 January 2018
Targeting tumour associated macrophages in anti-cancer therapies Annamaria Gal Seminar Series on Drug Discovery Budapest 5 January 2018 Macrophages: Professional phagocytes of the myeloid lineage APC,
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES 1 Supplementary Figure 1, Adult hippocampal QNPs and TAPs uniformly express REST a-b) Confocal images of adult hippocampal mouse sections showing GFAP (green), Sox2 (red), and REST
More informationSupplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence
Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β
More informationC57BL/6 Mice are More Appropriate. than BALB/C Mice in Inducing Dilated Cardiomyopathy with Short-Term Doxorubicin Treatment
Original Article C57BL/6 Mice are More Appropriate Acta Cardiol Sin 2012;28:236 240 Heart Failure & Cardiomyopathy C57BL/6 Mice are More Appropriate than BALB/C Mice in Inducing Dilated Cardiomyopathy
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationExpanded View Figures
MO reports PR3 dephosphorylates TZ Xian-o Lv et al xpanded View igures igure V1. PR3 dephosphorylates and inactivates YP/TZ., Overexpression of tight junction proteins Pals1 () or LIN7 () has no effect
More information