The combined role of WRKY and MYB TFs in the regulation of stilbene synthase genes in grapevine
|
|
- Marylou Turner
- 5 years ago
- Views:
Transcription
1 The combined role of WRKY and MYB TFs in the regulation of stilbene synthase genes in grapevine Alessandro Vannozzi
2 Big data is like teenage sex: everyone talks about it, nobody really knows how to do it, everyone thinks everyone else (ad is doing it, so everyone claims they are doing it (Dan Ariely)
3 Top 150 organisms in Gene Expression Omnibus database Grapevine is the 4 th most studied plant species for large-scale gene expression analyses!!! 149 series / experiments 36 platforms (Chip Arrays, NGS etc ) 3590 samples
4 How can we use all this information?
5 The regulation of the stilbene biosynthetic pathway A case study: IDENTIFYING NOVEL REGULATORS OF THE STILBENE PATHWAY IN GRAPEVINE Höll et Vannozzi; 2013 The Plant Cell
6 Roles and regulation of stilbene biosynthesis
7 Stilbene biosynthesis Vannozzi et al. (2012). BMC Plant Biology
8 chr5 chr10 The chr14 grapevine chr16 STS gene family 13,6 Chr 5 Chr 10 Chr 14 Chr 16 Proposed PN X V1 ORF Chr Closest prediction 12X V1 nomenclature Location predicted Vv10s0042g00840 VvSTS Vv10s0042g00850 Unsure Vv10s0042g00860 VvSTS Vv10s0042g00870 No VvSTS Vv10s0042g00880 Vv10s0042g00890 Unsure VvSTS Vv10s0042g00910 Unsure VvSTS Vv10s0042g00920 Yes VvSTS Vv10s0042g ,2 Yes VvSTS Vv16s0100g00750 Yes VvSTS Vv16s0100g00760 Unsure VvSTS Vv16s0100g00770 Yes VvSTS Vv16s0100g00780 Yes VvSTS ,3 No VvSTS Vv16s0100g00800 Unsure VvSTS Vv16s0100g00810 Unsure VvSTS No VvSTS Vv16s0100g00830 Yes VvSTS Vv16s0100g00840 Yes VvSTS Vv16s0100g00850 Yes VvSTS Vv16s0100g00860 Yes VvSTS Vv16s0100g00880 Yes VvSTS20 VvSTS1 VvCHS3 14, Vv16s0100g00900 Yes VvSTS21 16 VvSTS Vv16s0100g ,4 Yes VvSTS22 16 VvSTS Vv16s0100g00920 Yes VvSTS23 VvSTS4 14, Vv16s0100g00930 Yes VvSTS24 16 VvSTS Vv16s0100g00940 Yes VvSTS25 16 VvSTS Vv16s0100g00950 Unsure VvSTS Vv16s0100g00960 No VvSTS Vv16s0100g00990 Yes VvSTS Vv16s0100g01000 Yes VvSTS Vv16s0100g01010 Yes VvSTS Vv16s0100g ,5 Yes VvSTS Vv16s0100g01030 Yes VvSTS Vv16s0100g01040 Yes VvSTS Vv16s0100g01060 No VvSTS No VvSTS Vv16s0100g01070 Yes VvSTS Vv16s0100g01100 Yes VvSTS Vv16s0100g01110 Yes VvSTS Vv16s0100g01110 VvCHS2 Yes VvSTS ,7 Vv16s0100g ,6 VvCHS1 Yes VvSTS No VvSTS Vv16s0100g01130 Yes VvSTS Vv16s0100g01140 Yes VvSTS Vv16s0100g01150 Yes VvSTS No VvSTS Vv16s0100g ,7 Yes VvSTS Vv16s0100g01170 Yes VvSTS Vv16s0100g01190 Yes VvSTS Vv16s0100g01200 Yes VvSTS7 VvSTS8 VvSTS9 VvSTS10 VvSTS11 VvSTS12 VvSTS13 VvSTS14 VvSTS15 VvSTS16 VvSTS17 VvSTS18 VvSTS19 VvSTS20 VvSTS21 VvSTS22 VvSTS23 VvSTS24 VvSTS25 VvSTS26 VvSTS27 VvSTS28 VvSTS29 VvSTS30 VvSTS31 VvSTS32 VvSTS33 VvSTS34 VvSTS35 VvSTS36 VvSTS37 VvSTS38 VvSTS39 VvSTS40 VvSTS41 VvSTS42 VvSTS43 VvSTS44 VvSTS45 VvSTS46 VvSTS47 VvSTS48 1 Vannozzi et al BMC Plant Biol
9 The principle guilt-by-association genes involved in biologically related pathways or processes exhibit comparable expression dynamics across a wide range of experimental conditions.
10 Construction of a mutual-rank Gene Co-expression Network 29K NimbleGen 23 experiments, 359 conditions averaged from 914 NimbleGen arrays RNA-seq 21 experiments, 236 conditions averaged from 1353 replicates RMA-normalization of row intensity data mutual rank (MR) gene co-expression analysis VvSTS top 200 MR-ranked genes TF filtering based on Plant TFdb GCN network Row single/paired-end reads trimming/filtering Alignment vs 12X v1 PN40024 reference genome Estimation for FPKM transcript abundance mutual rank (MR) gene co-expression analysis VvSTS top 200 MR-ranked genes TF filtering based on Plant TFdb GCN network Merged GCN
11 Mutual Rank VS Pearson Correlation Coefficient Top 5 co-expressed list for gene A Rank PCC Locus Gene A Gene B Gene C Gene D Gene E Top 5 co-expressed list for gene B Rank PCC Locus Gene B Gene C Gene D Gene A Gene E Correlation rank is asymmetric: the rank of gene B from gene A is not the same as the rank of gene A from gene B!!!
12 Why mutual ranking instead of PCC? 1) Mathematical: smaller samples produce larger amplitude of correlation between any two genes 2) Biological: gene expression changes amongst developmental samples are far larger than those induced by abiotic stresses. Changes in gene expression amplitude decrease experimental noises that decrease any gene correlation. PCC rank distribution aligns in the diagonal indicating linear correspondence between the PCC ranks between different samples Obayashi & Kinoshita, DNA RESEARCH 2009, 16:
13 Construction of a mutual-rank Gene Co-expression Network 29K NimbleGen 23 experiments, 359 conditions averaged from 914 NimbleGen arrays RNA-seq 21 experiments, 236 conditions averaged from 1353 replicates RMA-normalization of row intensity data mutual rank (MR) gene co-expression analysis VvSTS top 200 MR-ranked genes TF filtering based on Plant TFdb GCN network Row single/paired-end reads trimming/filtering Alignment vs 12X v1 PN40024 reference genome Estimation for FPKM transcript abundance mutual rank (MR) gene co-expression analysis VvSTS top 200 MR-ranked genes TF filtering based on Plant TFdb GCN network Merged GCN
14 Why the top 200 ranking genes? 1) Based on the relationship of different k thresholds (100 1,000) to the distribution of PCC values for each member of the grapevine STS family in observed and random GCN Array NGS
15 Construction of a mutual-rank Gene Co-expression Network 29K NimbleGen 23 experiments, 359 conditions averaged from 914 NimbleGen arrays RNA-seq 21 experiments, 236 conditions averaged from 1353 replicates RMA-normalization of row intensity data mutual rank (MR) gene co-expression analysis VvSTS top 200 MR-ranked genes TF filtering based on Plant TFdb GCN network Row single/paired-end reads trimming/filtering Alignment vs 12X v1 PN40024 reference genome Estimation for FPKM transcript abundance mutual rank (MR) gene co-expression analysis VvSTS top 200 MR-ranked genes TF filtering based on Plant TFdb GCN network Merged GCN
16 Condition-independent STS-TF Gene Co-expression Network Top 200 MR genes Degree > 5 42VvSTSs and 30 TFs (564 edges)
17 VviMYB14 and VviMYB15 regulate two VviSTS genes Dual reporter luciferase assay VviMYB15 overexpression in hairy roots Höll et Vannozzi; 2013 The Plant Cell
18 Condition-independent STS-TF Gene Co.expression Network
19 Heat-map of VvSTSs and candidate TFs under stress conditions biotic abiotic
20 UV-C wound VvSTS and TFs expression under abiotic stresses
21 Single and combined effector Dual reporter luciferase assay VvWRKY24 effector increases the luciferase activity as much as VviMYB14 and VvMYB15 VvWRKY3 shows a combinatorial effect in association with VviMYB14 leading to a promoter induction higher than MYB14 alone. TF-TF interaction? W W Modified from Verweij et al The Plant Cell
22 luciferase fold change VvWRKY3 and VvWRKY53 regulate the VviMYB14 expression 9 TF-TF CGN WRKY03 WRKY24 WRKY43 WRKY53 MYB15 MYBA1 control WRKY03 WRKY24 WRKY43 WRKY53 MYB14 MYBA1 control VviMYB14 promoter VviMYB15 promoter
23 Conclusions We identify a number of TFs representing good candidates for further studies on the regulation of the stilbene pathway in grapevine including R2R3-MYBs, WRKYs, ERF and NAC genes and a bhlh gene. We confirmed the validity of the GCN guilt by association approach for inferring the biological function of genes (confirmed the role of VviMYB14 and VviMYB15 TFs). We identified a novel regulator, namely VvWRKY24 which appears to induce the promoter activity of at least one VvSTS gene in transfected grapevine cells. We described a combinatorial effect of VvWRKY3 and VviMYB14 in the regulation of the promoter of a VvSTS gene. Preliminary results suggest that VvWRKY3 (and VvWRKY53) could act upper level (regulatory circuitry?) in the STS regulation controlling the transcription of VviMYB14 TF. To test the interaction between VvWRKY3 (VvWRKY53) and VviMYB14 (and VviMYB15) proteins by Yeast-2-hybrid and BiFC assays. Confirm the role of WRKY3, VvWRKY24 and VvWRKY53 by functional assays in planta
24 Thanks to DAFNAE University of Padova Prof Margherita Lucchin Prof Gianni Barcaccia Dr Ibrahim Hmmam Petra Dona delle Rose COS University of Heidelberg Prof Jochen Bogs Dr Janine Höll Dr Stefan Czemmel CSIRO Plant Industry Adelaide SA Dr Ian Dry Dr Paul Boss Dr Angelica Jermakow CSIC-IRTA-UAB-UB Barcelona Dr Tomàs J. Matùs Australian National University Acton Dr Darren C.J. Wong
25 Thank you XII International Conference on GRAPEVINE BREEDING and GENETICS
26 Roles and regulation of stilbene biosynthesis
Patterns of Histone Methylation and Chromatin Organization in Grapevine Leaf. Rachel Schwope EPIGEN May 24-27, 2016
Patterns of Histone Methylation and Chromatin Organization in Grapevine Leaf Rachel Schwope EPIGEN May 24-27, 2016 What does H3K4 methylation do? Plant of interest: Vitis vinifera Culturally important
More informationJasmonate-mediated defence responses, unlike salicylate-mediated responses, are involved in the recovery of grapevine from bois noir disease
Paolacci et al. BMC Plant Biology (2017) 17:118 DOI 10.1186/s12870-017-1069-4 RESEARCH ARTICLE Open Access Jasmonate-mediated defence responses, unlike salicylate-mediated responses, are involved in the
More informationEXPression ANalyzer and DisplayER
EXPression ANalyzer and DisplayER Tom Hait Aviv Steiner Igor Ulitsky Chaim Linhart Amos Tanay Seagull Shavit Rani Elkon Adi Maron-Katz Dorit Sagir Eyal David Roded Sharan Israel Steinfeld Yossi Shiloh
More informationAnalysis of Massively Parallel Sequencing Data Application of Illumina Sequencing to the Genetics of Human Cancers
Analysis of Massively Parallel Sequencing Data Application of Illumina Sequencing to the Genetics of Human Cancers Gordon Blackshields Senior Bioinformatician Source BioScience 1 To Cancer Genetics Studies
More informationHeintzman, ND, Stuart, RK, Hon, G, Fu, Y, Ching, CW, Hawkins, RD, Barrera, LO, Van Calcar, S, Qu, C, Ching, KA, Wang, W, Weng, Z, Green, RD,
Heintzman, ND, Stuart, RK, Hon, G, Fu, Y, Ching, CW, Hawkins, RD, Barrera, LO, Van Calcar, S, Qu, C, Ching, KA, Wang, W, Weng, Z, Green, RD, Crawford, GE, Ren, B (2007) Distinct and predictive chromatin
More informationgenomics for systems biology / ISB2020 RNA sequencing (RNA-seq)
RNA sequencing (RNA-seq) Module Outline MO 13-Mar-2017 RNA sequencing: Introduction 1 WE 15-Mar-2017 RNA sequencing: Introduction 2 MO 20-Mar-2017 Paper: PMID 25954002: Human genomics. The human transcriptome
More informationNicotine biosynthesis pathway: beyond tobacco
Nicotine biosynthesis pathway: beyond tobacco Masataka Kajikawa, Nicolas Sierro, Haruhiko Kawaguchi, Nicolas Bakaher, Nikolai V Ivanov, Takashi Hashimoto, Tsubasa Shoji Nicotiana tabacum Cultivated as
More informationBreast cancer. Risk factors you cannot change include: Treatment Plan Selection. Inferring Transcriptional Module from Breast Cancer Profile Data
Breast cancer Inferring Transcriptional Module from Breast Cancer Profile Data Breast Cancer and Targeted Therapy Microarray Profile Data Inferring Transcriptional Module Methods CSC 177 Data Warehousing
More informationSudin Bhattacharya Institute for Integrative Toxicology
Beyond the AHRE: the Role of Epigenomics in Gene Regulation by the AHR (or, Varied Applications of Computational Modeling in Toxicology and Ingredient Safety) Sudin Bhattacharya Institute for Integrative
More informationRASA: Robust Alternative Splicing Analysis for Human Transcriptome Arrays
Supplementary Materials RASA: Robust Alternative Splicing Analysis for Human Transcriptome Arrays Junhee Seok 1*, Weihong Xu 2, Ronald W. Davis 2, Wenzhong Xiao 2,3* 1 School of Electrical Engineering,
More informationSupplemental Figure 1. Small RNA size distribution from different soybean tissues.
Supplemental Figure 1. Small RNA size distribution from different soybean tissues. The size of small RNAs was plotted versus frequency (percentage) among total sequences (A, C, E and G) or distinct sequences
More informationMBios 478: Systems Biology and Bayesian Networks, 27 [Dr. Wyrick] Slide #1. Lecture 27: Systems Biology and Bayesian Networks
MBios 478: Systems Biology and Bayesian Networks, 27 [Dr. Wyrick] Slide #1 Lecture 27: Systems Biology and Bayesian Networks Systems Biology and Regulatory Networks o Definitions o Network motifs o Examples
More informationExperimental Design For Microarray Experiments. Robert Gentleman, Denise Scholtens Arden Miller, Sandrine Dudoit
Experimental Design For Microarray Experiments Robert Gentleman, Denise Scholtens Arden Miller, Sandrine Dudoit Copyright 2002 Complexity of Genomic data the functioning of cells is a complex and highly
More informationHigh coverage in planta RNA sequencing identifies Fusarium oxysporum effectors and Medicago truncatularesistancemechanisms
High coverage in planta RNA sequencing identifies Fusarium oxysporum effectors and Medicago truncatularesistancemechanisms Louise Thatcher Gagan Garg, Angela Williams, Judith Lichtenzveig and Karam Singh
More informationBroad H3K4me3 is associated with increased transcription elongation and enhancer activity at tumor suppressor genes
Broad H3K4me3 is associated with increased transcription elongation and enhancer activity at tumor suppressor genes Kaifu Chen 1,2,3,4,5,10, Zhong Chen 6,10, Dayong Wu 6, Lili Zhang 7, Xueqiu Lin 1,2,8,
More informationYingying Wei George Wu Hongkai Ji
Stat Biosci (2013) 5:156 178 DOI 10.1007/s12561-012-9066-5 Global Mapping of Transcription Factor Binding Sites by Sequencing Chromatin Surrogates: a Perspective on Experimental Design, Data Analysis,
More informationSupplementary Figures
Supplementary Figures a miel1-2 (SALK_41369).1kb miel1-1 (SALK_978) b TUB MIEL1 Supplementary Figure 1. MIEL1 expression in miel1 mutant and S:MIEL1-MYC transgenic plants. (a) Mapping of the T-DNA insertion
More informationNature Genetics: doi: /ng Supplementary Figure 1. Assessment of sample purity and quality.
Supplementary Figure 1 Assessment of sample purity and quality. (a) Hematoxylin and eosin staining of formaldehyde-fixed, paraffin-embedded sections from a human testis biopsy collected concurrently with
More informationGene expression analysis. Roadmap. Microarray technology: how it work Applications: what can we do with it Preprocessing: Classification Clustering
Gene expression analysis Roadmap Microarray technology: how it work Applications: what can we do with it Preprocessing: Image processing Data normalization Classification Clustering Biclustering 1 Gene
More informationUser Guide. Association analysis. Input
User Guide TFEA.ChIP is a tool to estimate transcription factor enrichment in a set of differentially expressed genes using data from ChIP-Seq experiments performed in different tissues and conditions.
More informationGene-microRNA network module analysis for ovarian cancer
Gene-microRNA network module analysis for ovarian cancer Shuqin Zhang School of Mathematical Sciences Fudan University Oct. 4, 2016 Outline Introduction Materials and Methods Results Conclusions Introduction
More informationGene regulatory networks for lignin biosynthesis in switchgrass (Panicum virgatum)
Plant Biotechnology Journal (219) 17, pp. 58 593 doi: 1.1111/pbi.13 Gene regulatory networks for lignin biosynthesis in switchgrass (Panicum virgatum) Xiaolan Rao 1,2, Xin Chen 3, Hui Shen 1,2,, Qin Ma
More informationIdentification of loci and genes responsible for sodium and chloride exclusion in rootstocks for use in marker assisted selection
Identification of loci and genes responsible for sodium and chloride exclusion in rootstocks for use in marker assisted selection Jake Dunlevy, Deidre Blackmore, Everard Edwards, Rob Walker and Mandy Walker
More informationDNA Sequence Bioinformatics Analysis with the Galaxy Platform
DNA Sequence Bioinformatics Analysis with the Galaxy Platform University of São Paulo, Brazil 28 July - 1 August 2014 Dave Clements Johns Hopkins University Robson Francisco de Souza University of São
More informationNature Immunology: doi: /ni Supplementary Figure 1. Transcriptional program of the TE and MP CD8 + T cell subsets.
Supplementary Figure 1 Transcriptional program of the TE and MP CD8 + T cell subsets. (a) Comparison of gene expression of TE and MP CD8 + T cell subsets by microarray. Genes that are 1.5-fold upregulated
More informationSUPPLEMENTARY FIGURES: Supplementary Figure 1
SUPPLEMENTARY FIGURES: Supplementary Figure 1 Supplementary Figure 1. Glioblastoma 5hmC quantified by paired BS and oxbs treated DNA hybridized to Infinium DNA methylation arrays. Workflow depicts analytic
More informationTranscriptome Analysis
Transcriptome Analysis Data Preprocessing Sample Preparation Illumina Sequencing Demultiplexing Raw FastQ Reference Genome (fasta) Reference Annotation (GTF) Reference Genome Analysis Tophat Accepted hits
More informationSupplementary Figure S1. Gene expression analysis of epidermal marker genes and TP63.
Supplementary Figure Legends Supplementary Figure S1. Gene expression analysis of epidermal marker genes and TP63. A. Screenshot of the UCSC genome browser from normalized RNAPII and RNA-seq ChIP-seq data
More informationTable S1. Total and mapped reads produced for each ChIP-seq sample
Tale S1. Total and mapped reads produced for each ChIP-seq sample Sample Total Reads Mapped Reads Col- H3K27me3 rep1 125662 1334323 (85.76%) Col- H3K27me3 rep2 9176437 7986731 (87.4%) atmi1a//c H3K27m3
More informationUsing Bayesian Networks to Analyze Expression Data. Xu Siwei, s Muhammad Ali Faisal, s Tejal Joshi, s
Using Bayesian Networks to Analyze Expression Data Xu Siwei, s0789023 Muhammad Ali Faisal, s0677834 Tejal Joshi, s0677858 Outline Introduction Bayesian Networks Equivalence Classes Applying to Expression
More informationInternational Journal of Innovative Research in Computer and Communication Engineering. (An ISO 3297: 2007 Certified Organization)
Reconstruction of Gene Regulatory Network to Identify Prognostic Molecular Markers of the Reactive Stroma of Breast and Prostate Cancer Using Information Theoretic Approach Prof. Shanthi Mahesh 1, Dr.
More informationSupplementary Figure 1 IL-27 IL
Tim-3 Supplementary Figure 1 Tc0 49.5 0.6 Tc1 63.5 0.84 Un 49.8 0.16 35.5 0.16 10 4 61.2 5.53 10 3 64.5 5.66 10 2 10 1 10 0 31 2.22 10 0 10 1 10 2 10 3 10 4 IL-10 28.2 1.69 IL-27 Supplementary Figure 1.
More informationA Practical Guide to Integrative Genomics by RNA-seq and ChIP-seq Analysis
A Practical Guide to Integrative Genomics by RNA-seq and ChIP-seq Analysis Jian Xu, Ph.D. Children s Research Institute, UTSW Introduction Outline Overview of genomic and next-gen sequencing technologies
More informationT. R. Golub, D. K. Slonim & Others 1999
T. R. Golub, D. K. Slonim & Others 1999 Big Picture in 1999 The Need for Cancer Classification Cancer classification very important for advances in cancer treatment. Cancers of Identical grade can have
More informationHigh-Throughput Sequencing Course
High-Throughput Sequencing Course Introduction Biostatistics and Bioinformatics Summer 2017 From Raw Unaligned Reads To Aligned Reads To Counts Differential Expression Differential Expression 3 2 1 0 1
More informationSUPPLEMENTARY INFORMATION
doi:.38/nature8975 SUPPLEMENTAL TEXT Unique association of HOTAIR with patient outcome To determine whether the expression of other HOX lincrnas in addition to HOTAIR can predict patient outcome, we measured
More informationGlutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots
Kan et al. BMC Genomics (2015) 16:731 DOI 10.1186/s12864-015-1892-7 RESEARCH ARTICLE Open Access Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress
More informationa) List of KMTs targeted in the shrna screen. The official symbol, KMT designation,
Supplementary Information Supplementary Figures Supplementary Figure 1. a) List of KMTs targeted in the shrna screen. The official symbol, KMT designation, gene ID and specifities are provided. Those highlighted
More informationRaymond Auerbach PhD Candidate, Yale University Gerstein and Snyder Labs August 30, 2012
Elucidating Transcriptional Regulation at Multiple Scales Using High-Throughput Sequencing, Data Integration, and Computational Methods Raymond Auerbach PhD Candidate, Yale University Gerstein and Snyder
More informationLectures 13: High throughput sequencing: Beyond the genome. Spring 2017 March 28, 2017
Lectures 13: High throughput sequencing: Beyond the genome Spring 2017 March 28, 2017 h@p://www.fejes.ca/2009/06/science- cartoons- 5- rna- seq.html Omics Transcriptome - the set of all mrnas present in
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Heatmap of GO terms for differentially expressed genes. The terms were hierarchically clustered using the GO term enrichment beta. Darker red, higher positive
More informationSynthetic microrna Reference Standards Genomics Research Group ABRF 2015
Synthetic microrna Reference Standards Genomics Research Group ABRF 2015 Don A. Baldwin, Ph.D. support@signalbiology.com Reference samples for Platform evaluation Protocol development Assay service improvement
More informationA putative MYB35 ortholog is a candidate for the sex-determining genes in Asparagus
Supplementary figures for: A putative MYB35 ortholog is a candidate for the sex-determining genes in Asparagus officinalis Daisuke Tsugama, Kohei Matsuyama, Mayui Ide, Masato Hayashi, Kaien Fujino, and
More informationPredictive Blood DNA Markers for Breast Cancer Xiang Zhang, Ph.D.
Predictive Blood DNA Markers for Breast Cancer Xiang Zhang, Ph.D. Department of Environmental Health University of Cincinnati Background Breast cancer (BCa) The second most common cancer among women in
More informationSubtilisin-like proteins and lipid signaling events: the missing links in grapevine resistance to P. viticola
Subtilisin-like proteins and lipid signaling events: the missing links in grapevine resistance to P. viticola Andreia Figueiredo, Joana Figueiredo, Gonçalo Laureano, Ana Rita Cavaco, Marisa Maia, Ana Rita
More informationLinlin Liu 1, Yingying Li 1, Guangbiao She 1, Xianchen Zhang 1, Brian Jordan 2, Qi Chen 1, Jian Zhao 1* and Xiaochun Wan 1*
Liu et al. BMC Plant Biology (2018) 18:233 https://doi.org/10.1186/s12870-018-1440-0 RESEARCH Open Access Metabolite profiling and transcriptomic analyses reveal an essential role of UVR8- mediated signal
More informationIn vitro DNase I foot printing. In vitro DNase I footprinting was performed as described
Supplemental Methods In vitro DNase I foot printing. In vitro DNase I footprinting was performed as described previously 1 2 using 32P-labeled 211 bp fragment from 3 HS1. Footprinting reaction mixes contained
More informationDepartment of Chemistry, Université de Montréal, C.P. 6128, Succursale centre-ville, Montréal, Québec, H3C 3J7, Canada.
Phosphoproteome dynamics of Saccharomyces cerevisiae under heat shock and cold stress Evgeny Kanshin 1,5, Peter Kubiniok 1,2,5, Yogitha Thattikota 1,3, Damien D Amours 1,3 and Pierre Thibault 1,2,4 * 1
More informationYue Wei 1, Rui Chen 2, Carlos E. Bueso-Ramos 3, Hui Yang 1, and Guillermo Garcia-Manero 1
Genome-wide CHIP-Seq Analysis of Histone Methylation Reveals Modulators of NF- B Signaling And the Histone Demethylase JMJD3 Implicated in Myelodysplastic Syndrome Yue Wei 1, Rui Chen 2, Carlos E. Bueso-Ramos
More informationStatistical Assessment of the Global Regulatory Role of Histone. Acetylation in Saccharomyces cerevisiae. (Support Information)
Statistical Assessment of the Global Regulatory Role of Histone Acetylation in Saccharomyces cerevisiae (Support Information) Authors: Guo-Cheng Yuan, Ping Ma, Wenxuan Zhong and Jun S. Liu Linear Relationship
More informationChIP-seq analysis. J. van Helden, M. Defrance, C. Herrmann, D. Puthier, N. Servant, M. Thomas-Chollier, O.Sand
ChIP-seq analysis J. van Helden, M. Defrance, C. Herrmann, D. Puthier, N. Servant, M. Thomas-Chollier, O.Sand Tuesday : quick introduction to ChIP-seq and peak-calling (Presentation + Practical session)
More informationGlobal variation in copy number in the human genome
Global variation in copy number in the human genome Redon et. al. Nature 444:444-454 (2006) 12.03.2007 Tarmo Puurand Study 270 individuals (HapMap collection) Affymetrix 500K Whole Genome TilePath (WGTP)
More informationNature Immunology: doi: /ni Supplementary Figure 1. Characteristics of SEs in T reg and T conv cells.
Supplementary Figure 1 Characteristics of SEs in T reg and T conv cells. (a) Patterns of indicated transcription factor-binding at SEs and surrounding regions in T reg and T conv cells. Average normalized
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Effect of HSP90 inhibition on expression of endogenous retroviruses. (a) Inducible shrna-mediated Hsp90 silencing in mouse ESCs. Immunoblots of total cell extract expressing the
More informationHao D. H., Ma W. G., Sheng Y. L., Zhang J. B., Jin Y. F., Yang H. Q., Li Z. G., Wang S. S., GONG Ming*
Comparison of transcriptomes and gene expression profiles of two chilling- and drought-tolerant and intolerant Nicotiana tabacum varieties under low temperature and drought stress Hao D. H., Ma W. G.,
More informationBIMM 143. RNA sequencing overview. Genome Informatics II. Barry Grant. Lecture In vivo. In vitro.
RNA sequencing overview BIMM 143 Genome Informatics II Lecture 14 Barry Grant http://thegrantlab.org/bimm143 In vivo In vitro In silico ( control) Goal: RNA quantification, transcript discovery, variant
More informationGenome-wide Association Studies (GWAS) Pasieka, Science Photo Library
Lecture 5 Genome-wide Association Studies (GWAS) Pasieka, Science Photo Library Chi-squared test to evaluate whether the odds ratio is different from 1. Corrected for multiple testing Source: wikipedia.org
More informationRNA-Seq Atlas of Glycine max: A guide to the Soybean Transcriptome
RNA-Seq Atlas of Glycine max: A guide to the Soybean Transcriptome How do novel structures or functions evolve? A more relevant example Symbiosis and Nitrogen Fixation Limpens & Bisseling (23) Curr. Opin.
More informationPUBLISHED VERSION. Originally published at: PERMISSIONS
PUBLISHED VERSION Darren CJ Wong, Crystal Sweetman, Damian P Drew, and Christopher M Ford VTCdb: a gene co-expression database for the crop species Vitis vinifera (grapevine) BMC Genomics, 2013; 14(1):1-17
More informationNature Structural & Molecular Biology: doi: /nsmb.2419
Supplementary Figure 1 Mapped sequence reads and nucleosome occupancies. (a) Distribution of sequencing reads on the mouse reference genome for chromosome 14 as an example. The number of reads in a 1 Mb
More informationResearch Article Identifying Liver Cancer-Related Enhancer SNPs by Integrating GWAS and Histone Modification ChIP-seq Data
BioMed Volume 2016, Article ID 2395341, 6 pages http://dx.doi.org/10.1155/2016/2395341 Research Article Identifying Liver Cancer-Related Enhancer SNPs by Integrating GWAS and Histone Modification ChIP-seq
More informationcis-regulatory enrichment analysis in human, mouse and fly
cis-regulatory enrichment analysis in human, mouse and fly Zeynep Kalender Atak, PhD Laboratory of Computational Biology VIB-KU Leuven Center for Brain & Disease Research Laboratory of Computational Biology
More informationComputational aspects of ChIP-seq. John Marioni Research Group Leader European Bioinformatics Institute European Molecular Biology Laboratory
Computational aspects of ChIP-seq John Marioni Research Group Leader European Bioinformatics Institute European Molecular Biology Laboratory ChIP-seq Using highthroughput sequencing to investigate DNA
More informationSingle SNP/Gene Analysis. Typical Results of GWAS Analysis (Single SNP Approach) Typical Results of GWAS Analysis (Single SNP Approach)
High-Throughput Sequencing Course Gene-Set Analysis Biostatistics and Bioinformatics Summer 28 Section Introduction What is Gene Set Analysis? Many names for gene set analysis: Pathway analysis Gene set
More informationHost-Induced Gene Silencing in the Fusarium-Wheat interaction. Wanxin Chen and Patrick Schweizer
Host-Induced Gene Silencing in the Fusarium-Wheat interaction Wanxin Chen and Patrick Schweizer What is Host-Induced Gene Silencing (HIGS)? Fungus Bgh Trujillo et al. (2004) MPMI HIGS: HI reduced GAME
More informationFig. S1. Validation of ChIP-seq binding sites by single gene ChIP-PCR Fig. S2. Transactivation potential of PPAR
Fig. S1. Validation of ChIP-seq binding sites by single gene ChIP-PCR ChIP-PCR was performed on PPARγ and RXR-enriched chromatin harvested during adipocyte differentiation at day and day 6 as described
More informationSupplementary Figure 1: High-throughput profiling of survival after exposure to - radiation. (a) Cells were plated in at least 7 wells in a 384-well
Supplementary Figure 1: High-throughput profiling of survival after exposure to - radiation. (a) Cells were plated in at least 7 wells in a 384-well plate at cell densities ranging from 25-225 cells in
More informationP. Tang ( 鄧致剛 ); PJ Huang ( 黄栢榕 ) g( ); g ( ) Bioinformatics Center, Chang Gung University.
Databases and Tools for High Throughput Sequencing Analysis P. Tang ( 鄧致剛 ); PJ Huang ( 黄栢榕 ) g( ); g ( ) Bioinformatics Center, Chang Gung University. HTseq Platforms Applications on Biomedical Sciences
More informationPeak-calling for ChIP-seq and ATAC-seq
Peak-calling for ChIP-seq and ATAC-seq Shamith Samarajiwa CRUK Autumn School in Bioinformatics 2017 University of Cambridge Overview Peak-calling: identify enriched (signal) regions in ChIP-seq or ATAC-seq
More informationAN UNUSUAL VIRUS IN TREES WITH CITRUS BLIGHT RON BRLANSKY UNIVERSITY OF FLORIDA, CREC
AN UNUSUAL VIRUS IN TREES WITH CITRUS BLIGHT RON BRLANSKY UNIVERSITY OF FLORIDA, CREC CITRUS BLIGHT KNOWN IN FLORIDA FOR OVER 100 YEARS; FIRST DESCRIBED IN 1874 PROBLEM IN FLORIDA IN THE 1970 S WITH INCREASE
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationSupplementary Figure 1
Supplementary Figure 1 Asymmetrical function of 5p and 3p arms of mir-181 and mir-30 families and mir-142 and mir-154. (a) Control experiments using mirna sensor vector and empty pri-mirna overexpression
More informationSupplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the
Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student
More informationSupplementary information for: Community detection for networks with. unipartite and bipartite structure. Chang Chang 1, 2, Chao Tang 2
Supplementary information for: Community detection for networks with unipartite and bipartite structure Chang Chang 1, 2, Chao Tang 2 1 School of Life Sciences, Peking University, Beiing 100871, China
More informationThe common colorectal cancer predisposition SNP rs at chromosome 8q24 confers potential to enhanced Wnt signaling
SUPPLEMENTARY INFORMATION The common colorectal cancer predisposition SNP rs6983267 at chromosome 8q24 confers potential to enhanced Wnt signaling Sari Tuupanen 1, Mikko Turunen 2, Rainer Lehtonen 1, Outi
More informationAdvance Your Genomic Research Using Targeted Resequencing with SeqCap EZ Library
Advance Your Genomic Research Using Targeted Resequencing with SeqCap EZ Library Marilou Wijdicks International Product Manager Research For Life Science Research Only. Not for Use in Diagnostic Procedures.
More informationComputational Analysis of UHT Sequences Histone modifications, CAGE, RNA-Seq
Computational Analysis of UHT Sequences Histone modifications, CAGE, RNA-Seq Philipp Bucher Wednesday January 21, 2009 SIB graduate school course EPFL, Lausanne ChIP-seq against histone variants: Biological
More informationSupplemental Figure 1. Genes showing ectopic H3K9 dimethylation in this study are DNA hypermethylated in Lister et al. study.
mc mc mc mc SUP mc mc Supplemental Figure. Genes showing ectopic HK9 dimethylation in this study are DNA hypermethylated in Lister et al. study. Representative views of genes that gain HK9m marks in their
More informationSomatic and Germinal Transgenesis for Assessing Thyroid Hormone Disrupting Activity in Amphibians
Somatic and Germinal Transgenesis for Assessing Thyroid Hormone Disrupting Activity in Amphibians Barbara Demeneix Muséum National d Histoire Naturelle, France Thank you. First of all I would like to thank
More informationA specific allele of MYB14 in grapevine correlates with high stilbene inducibility triggered by Al 3+ and UV-C radiation
https://doi.org/.7/s99-8-37-9 ORIGINAL ARTICLE A specific allele of MYB in grapevine correlates with high stilbene inducibility triggered by Al 3+ and UV-C radiation Ru Bai Yangyang Luo Lixin Wang Jing
More information15. Supplementary Figure 9. Predicted gene module expression changes at 24hpi during HIV
Supplementary Information Table of content 1. Supplementary Table 1. Summary of RNAseq data and mapping statistics 2. Supplementary Table 2. Biological functions enriched in 12 hpi DE genes, derived from
More informationTECHNICAL DATA SHEET. AMD Ritmed All Gauze Sponges Items # A2120 to A8800
Intended Use May be used for one or more of the following purposes: cleansing wounds or skin, absorbing biological fluids or support organs and tissue during surgical procedures Characteristic Description
More informationRESEARCHER S NAME: Làszlò Tora RESEARCHER S ORGANISATION: Institut de Génétique et de Biologie Moléculaire et Cellulaire (IGBMC)
Thursday 5 November EU-India PARTNERING EVENT Theme: Health RESEARCHER S NAME: Làszlò Tora RESEARCHER S ORGANISATION: Institut de Génétique et de Biologie Moléculaire et Cellulaire (IGBMC) CNRS, INSERM,
More informationProtein allergenicity potential: What makes a protein an allergen?
Protein Sequence Allergenic Potential Big Data MGVFNYETETTSVIPAARLFKAFILDGDNLF PKVAPQAISSVENIEGNGGPGTIKKISFPEG FPFKYVKDRVDEVDHTNFKYNYSVIEGGPI GDTLEKISNEIKIVATPDGGSILKISNKYHTK GDHEVKAEQVKASKEMGETLLRAVESYLL
More informationDNA-seq Bioinformatics Analysis: Copy Number Variation
DNA-seq Bioinformatics Analysis: Copy Number Variation Elodie Girard elodie.girard@curie.fr U900 institut Curie, INSERM, Mines ParisTech, PSL Research University Paris, France NGS Applications 5C HiC DNA-seq
More informationMachine Learning! Robert Stengel! Robotics and Intelligent Systems MAE 345,! Princeton University, 2017
Machine Learning! Robert Stengel! Robotics and Intelligent Systems MAE 345,! Princeton University, 2017 A.K.A. Artificial Intelligence Unsupervised learning! Cluster analysis Patterns, Clumps, and Joining
More informationNature Genetics: doi: /ng Supplementary Figure 1. Somatic coding mutations identified by WES/WGS for 83 ATL cases.
Supplementary Figure 1 Somatic coding mutations identified by WES/WGS for 83 ATL cases. (a) The percentage of targeted bases covered by at least 2, 10, 20 and 30 sequencing reads (top) and average read
More informationAssociation mapping (qualitative) Association scan, quantitative. Office hours Wednesday 3-4pm 304A Stanley Hall. Association scan, qualitative
Association mapping (qualitative) Office hours Wednesday 3-4pm 304A Stanley Hall Fig. 11.26 Association scan, qualitative Association scan, quantitative osteoarthritis controls χ 2 test C s G s 141 47
More informationEgr-1 regulates RTA transcription through a cooperative involvement of transcriptional regulators
/, 2017, Vol. 8, (No. 53), pp: 91425-91444 Egr-1 regulates RTA transcription through a cooperative involvement of transcriptional regulators Roni Sarkar 1 and Subhash C. Verma 1 1 Department of Microbiology
More informationMultiplex target enrichment using DNA indexing for ultra-high throughput variant detection
Multiplex target enrichment using DNA indexing for ultra-high throughput variant detection Dr Elaine Kenny Neuropsychiatric Genetics Research Group Institute of Molecular Medicine Trinity College Dublin
More informationSSM signature genes are highly expressed in residual scar tissues after preoperative radiotherapy of rectal cancer.
Supplementary Figure 1 SSM signature genes are highly expressed in residual scar tissues after preoperative radiotherapy of rectal cancer. Scatter plots comparing expression profiles of matched pretreatment
More informationPatnaik SK, et al. MicroRNAs to accurately histotype NSCLC biopsies
Patnaik SK, et al. MicroRNAs to accurately histotype NSCLC biopsies. 2014. Supplemental Digital Content 1. Appendix 1. External data-sets used for associating microrna expression with lung squamous cell
More informationInferring Biological Meaning from Cap Analysis Gene Expression Data
Inferring Biological Meaning from Cap Analysis Gene Expression Data HRYSOULA PAPADAKIS 1. Introduction This project is inspired by the recent development of the Cap analysis gene expression (CAGE) method,
More informationSelective depletion of abundant RNAs to enable transcriptome analysis of lowinput and highly-degraded RNA from FFPE breast cancer samples
DNA CLONING DNA AMPLIFICATION & PCR EPIGENETICS RNA ANALYSIS Selective depletion of abundant RNAs to enable transcriptome analysis of lowinput and highly-degraded RNA from FFPE breast cancer samples LIBRARY
More informationLecture 8 Understanding Transcription RNA-seq analysis. Foundations of Computational Systems Biology David K. Gifford
Lecture 8 Understanding Transcription RNA-seq analysis Foundations of Computational Systems Biology David K. Gifford 1 Lecture 8 RNA-seq Analysis RNA-seq principles How can we characterize mrna isoform
More information7SK ChIRP-seq is specifically RNA dependent and conserved between mice and humans.
Supplementary Figure 1 7SK ChIRP-seq is specifically RNA dependent and conserved between mice and humans. Regions targeted by the Even and Odd ChIRP probes mapped to a secondary structure model 56 of the
More informationRosa Caiazzo, PhD. The 3 rd Plant Genomics Congress May 2015 London, UK
A systems biology approach to investigate the mechanisms that promote ripening and regulate post-harvest fruit withering in the cherry-like tomato landrace pomodorino del piennolo del Vesuvio Rosa Caiazzo,
More informationJ. A. Mayfield et al. FIGURE S1. Methionine Salvage. Methylthioadenosine. Methionine. AdoMet. Folate Biosynthesis. Methylation SAH.
FIGURE S1 Methionine Salvage Methionine Methylthioadenosine AdoMet Folate Biosynthesis Methylation SAH Homocysteine Homocystine CBS Cystathionine Cysteine Glutathione Figure S1 Biochemical pathway of relevant
More informationChIP-seq hands-on. Iros Barozzi, Campus IFOM-IEO (Milan) Saverio Minucci, Gioacchino Natoli Labs
ChIP-seq hands-on Iros Barozzi, Campus IFOM-IEO (Milan) Saverio Minucci, Gioacchino Natoli Labs Main goals Becoming familiar with essential tools and formats Visualizing and contextualizing raw data Understand
More informationSupplementary information
Supplementary information High fat diet-induced changes of mouse hepatic transcription and enhancer activity can be reversed by subsequent weight loss Majken Siersbæk, Lyuba Varticovski, Shutong Yang,
More information