Near-infrared fluorescent proteins
|
|
- Rosalyn Garrison
- 5 years ago
- Views:
Transcription
1 nature methods Near-infrared fluorescent proteins Dmitry Shcherbo, Irina I Shemiakina, Anastasiya V Ryabova, Kathryn E Luker, Bradley T Schmidt, Ekaterina A Souslova, Tatiana V Gorodnicheva, Lydia Strukova, Konstantin M Shidlovskiy, Olga V Britanova, Andrey G Zaraisky, Konstantin A Lukyanov, Victor B Loschenov, Gary D Luker & Dmitriy M Chudakov Supplementary figures and text: Supplementary Figure 1 Supplementary Figure 2 Supplementary Figure 3 Supplementary Figure 4 Supplementary Figure 5 Supplementary Figure 6 Supplementary Figure 7 Transgenic zebrafish expressing Katushka in muscle cells. Comparison of cytotoxicity of selected fluorescent proteins in E. coli. Comparison of cytotoxicity of Katushka and Katushka-9-5 in HeLa cells. Alignment of the amino acid sequences of selected fluorescent proteins. Comparison of fluorescent properties of selected fluorescent proteins in bacterial streaks. Transient transfection of HeLa cells by eqfp650 and eqfp670. Katushka, eqfp650 and eqfp670 fluorescence and absorbance spectra.
2 Supplementary Figure 1. Transgenic zebrafish expressing Katushka in muscle cells. (a) White light image. (b) Overlay of white light and fluorescence images in a stereomicroscope.
3 mcherry Katushka Katushka 9-5 eqfp650 eqfp670 mneptune E2-Crimson IPTG induction estimated cytotoxicity no induction medium high low low low high low Supplementary Figure 2. Comparison of cytotoxicity of selected fluorescent proteins in E. coli. To compare protein cytotoxicity in prokaryotes, E. coli cells (XL1 Blue strain) were transformed with pqe30 vectors encoding corresponding fluorescent proteins. Equal portions of bacteria were inoculated on LB agar plates with or without 10 µg/ml IPTG to induce high promoter activity. Bacterial clones were photographed after overnight growth at 37 C. It should be noted that expression of fluorescent proteins in XL1 Blue strain from pqe30 vector produces sufficiently high expression levels without IPTG induction, due to the intense promoter leakage. Induction by IPTG further raises expression levels that become cytotoxic for growing E. coli, slowing the rate of bacterial growth and producing smaller colonies. For those proteins that demonstrate relatively high cytotoxicty at the given expression level, colony growth can be completely blocked. Estimated relative cytotoxicity in bacteria is shown in the lower row. Scale bar, 1 cm. 2
4 Supplementary Figure 3. Comparison of cytotoxicity of Katushka and Katushka-9-5 in HeLa cells. (a) Images obtained on days 3, 4 and 5 after transfection with Katushka or Katushka-9-5. Scale bar, 200 μm. (b) The same cells were analyzed by flow cytometry. Graphs show percentage and brightness of cells expressing Katushka or Katushka days after transfection. Columns show percentage of cells expressing Katushka or Katushka and 5 days after transfection, respectively. The same high numbers of living fluorescent cells were detected after five days of culturing by both fluorescence microscopy and flow cytometry. Standard deviations (n = 3 transfection experiments) are shown. 3
5 avgfp MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTG-KLPVPWPT DsRed MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI E2-Crimson MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGVGEGKPYEGTQTAKLQVTKGGPLPFAWDI eqfp578 MSELIKENMHMKLYMEGTVNNHHFKCTSEGERKPYEGTQTMKIKVVEGGPLPFAFDI mneptune MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTGRIKVVEGGPLPFAFDI Katushka MGEDSVLITENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDI Katushka-9-5 MGEDSELISENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDI eqfp650 MGEDSELISENMHMKLYMEGTVNGHHFKCTSEGEGKPYEGTQTAKIKVVEGGPLPFAFDI eqfp670 MGEDSELISENMHTKLYMEGTVNGHHFKCTSEGEGKPYEGTQTCKIKVVEGGPLPFAFDI avgfp LVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT DsRed LSPQFQYGSKVYVKHPADIP--DYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGC E2-Crimson LSPQFFYGSKAYIKHPADIP--DYLKQSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGT eqfp578 LATSFMYGSKTFINHTQGIP--DLFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC mneptune LATCFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGC Katushka LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC Katushka-9-5 LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC eqfp650 LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC eqfp670 LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC avgfp LVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQL DsRed FIYKVKFIGVNFPSDGPVMQKKTM-GWEASTERLYPR--DGVLKGEIHKALKLKDGGHYL E2-Crimson LIYHVKFIGVNFPSDGPVMQKKTL-GWEPSTERNYPR--DGVLKGENHMALKLKGGGHYL eqfp578 IIYNVKINGVNFPSNGSVMQKKTL-GWEANTEMLYPA--DGGLRGHSQMALKLVGGGYLH mneptune LIYNVKIRGVNFPSNGPVMQKKTL-GWEASTETLYPA--DGGLEGRCDMALKLVGGGHLI Katushka LIYNVKINGVNFPSNGPVMQKKTL-GWEASTEMLYPA--DSGLRGHSQMALKLVGGGYLH Katushka-9-5 LIYNVKINGVNFPSNGPVMQKKTL-GWEASTEMLYPA--DSGLRGHSQMALKLVGGGYLH eqfp650 LIYNVKINGVNFPSNGPVMQKKTL-GWEASTEMLYPA--DSGLRGHSQMALKLVGGGYLH eqfp670 LIYNVKINGVNFPSNGPVMQKKTL-GWEANTEMLYPA--DSGLRGHNQMALKLVGGGYLH avgfp ADHYQQNTPIGD-GPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK DsRed VEFKSIYMAKKP---VQLPGYYYVDSKLDITSH-NEDYTIVEQYERTEGRHHLFL E2-Crimson CEFKSIYMAKKP---VKLPGYHYVDYKLDITSH-NEDYTVVEQYERAEARHHLFQ eqfp578 CSFKTTYRSKKPAKNLKMPGFHFVDHRLERIKE-ADKETYVEQHEMAVAKYCDLPSKLGHR mneptune CNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKE-ADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK Katushka CSLKTTYRSKKPAKNLKMPGFYFVDRRLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS Katushka-9-5 CSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS eqfp650 CSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS eqfp670 CSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS Supplementary Figure 4. Alignment of the amino acid sequences of selected fluorescent proteins. Structurally important regions are highlighted in gray, beta-strands are shown with arrows, and alpha-helices are shown with ribbons. Chromophore-forming residues are underlined. The differences between Katushka and Katushka-9-5 are shown in green. Note that Glu6 was inherited from the wild-type eqfp578. Substitutions that resulted in the formation of eqfp650 and eqfp670 are shown in red (directed changes) or in blue (random mutations). Mutation of Met44 in E2-Crimson and mneptune is shown yellow. Overall alignment numbering follows that of Aequorea victoria GFP (avgfp). 4
6 Supplementary Figure 5. Comparison of fluorescent properties of selected fluorescent proteins in bacterial streaks. Streaks of E. coli transformed with a corresponding fluorescent protein were imaged with a fluorescent stereomicroscope using various filter sets or under 635 nm diodes after overnight growth at 37 C. Note that relatively low brightness of mneptune is characteristic for bacterial cells only. In eukaryotic cells, both mneptune and Neptune demonstrate high brightness 48 h after transfection (see Fig. 1b of the main text). 5
7 eqfp650 eqfp670 Supplementary Figure 6. Transient transfection of HeLa cells by eqfp650 and eqfp670. HeLa cells transiently transfected with eqfp650 or eqfp670 were visualized using widefield Leica AFLX 6000 microscope, 63x objective, after 3 days of incubation. Scale bars, 10 μm. 6
8 A. 1,0 eqfp650 eqfp670 Katushka Fluorescence, a.u. 0,8 0,6 0,4 0, Wavelength, nm B. 1,0 0,8 eqfp650 eqfp670 Katushka Absorbance, a.u. 0,6 0,4 0, Wavelength, nm Supplementary Figure 7. Katushka, eqfp650 and eqfp670 fluorescence and absorbance spectra. (a) Excitation (solid lines) and emission (dashed lines) spectra. (b) Absorbance spectra. 7
ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES
ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES Ruslan I. Dmitriev, Alexander V. Zhdanov, Greg Jasionek, Dmitri B. Papkovsky Biochemistry Department, University
More informationSupplementary Information
Electronic Supplementary Material (ESI) for Analyst. This journal is The Royal Society of Chemistry 2018 Supplementary Information Spying on Protein Interactions in Living Cells with Reconstituted Scarlet
More informationBiology Open (2014) 000, 1 10 doi: /bio
(2014) 000, 1 10 doi:10.1242/bio.201410041 Supplementary Material Michael Brauchle et al. doi: 10.1242/bio.201410041 Fig. S1. Alignment of GFP, sfgfp, egfp, eyfp, mcherry and mruby2. Sequence-based alignment
More informationNature Methods: doi: /nmeth.4257
Supplementary Figure 1 Screen for polypeptides that affect cellular actin filaments. (a) Table summarizing results from all polypeptides tested. Source shows organism, gene, and amino acid numbers used.
More informationO. Repeat the measurement in all relevant modes used in your experiments (e.g. settings for orbital averaging).
Before You Begin Read through this entire protocol sheet carefully before you start your experiment and prepare any materials you may need. This year, in order to improve reproducibility, we are requiring
More informationChapter 3. Expression of α5-megfp in Mouse Cortical Neurons. on the β subunit. Signal sequences in the M3-M4 loop of β nachrs bind protein factors to
22 Chapter 3 Expression of α5-megfp in Mouse Cortical Neurons Subcellular localization of the neuronal nachr subtypes α4β2 and α4β4 depends on the β subunit. Signal sequences in the M3-M4 loop of β nachrs
More informationSupplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.
Supplementary Information Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Various concentrations of Ent, DHBA or ABAH were pre-incubated for 10 min with LPO (50
More informationSupporting Information For
Supporting Information For MicroRNA-Catalyzed Cancer Therapeutics Based on DNA-Programmed Nanoparticle Complex Xucheng Luo, 1 Zhi Li, 1 Ganglin Wang, 1 Xuewen He, 2,3 Xiaoqin Shen, 1 Quanhong Sun, 1 Li
More informationNature Medicine: doi: /nm.4322
1 2 3 4 5 6 7 8 9 10 11 Supplementary Figure 1. Predicted RNA structure of 3 UTR and sequence alignment of deleted nucleotides. (a) Predicted RNA secondary structure of ZIKV 3 UTR. The stem-loop structure
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Lu et al., http://www.jcb.org/cgi/content/full/jcb.201012063/dc1 Figure S1. Kinetics of nuclear envelope assembly, recruitment of Nup133
More informationDevelopment of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells
Supporting Information for Development of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells Sasa Zhu, Weiying Lin,* Lin Yuan State Key Laboratory of Chemo/Biosensing
More informationSUPPLEMENTARY INFORMATION
Figure S1 Induction of non-apoptotic death of SV40-transformed and primary DKO MEFs, and DKO thymocytes. (A-F) STS-induced non-apoptotic death of DKO MEF. (A, B) Reduced viability of DKO MEFs after exposure
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10962 Supplementary Figure 1. Expression of AvrAC-FLAG in protoplasts. Total protein extracted from protoplasts described in Fig. 1a was subjected to anti-flag immunoblot to detect AvrAC-FLAG
More informationSupplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) .
Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) The inhibitory effects of new antibodies (Mab17 and Mab18). They were investigated in in vitro fertilization
More informationB16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small
More informationA far-red fluorescent protein evolved from a cyanobacterial phycobiliprotein
SUPPLEMENTARY INFORMATION A far-red fluorescent protein evolved from a cyanobacterial phycobiliprotein Erik A. Rodriguez, Geraldine N. Tran, Larry A. Gross, Jessica L. Crisp, Xiaokun Shu, John Y. Lin,
More informationA. Generation and characterization of Ras-expressing autophagycompetent
Supplemental Material Supplemental Figure Legends Fig. S1 A. Generation and characterization of Ras-expressing autophagycompetent and -deficient cell lines. HA-tagged H-ras V12 was stably expressed in
More informationgenome edited transient transfection, CMV promoter
Supplementary Figure 1. In the absence of new protein translation, overexpressed caveolin-1-gfp is degraded faster than caveolin-1-gfp expressed from the endogenous caveolin 1 locus % loss of total caveolin-1-gfp
More informationGraphene Quantum Dots-Band-Aids Used for Wound Disinfection
Supporting information Graphene Quantum Dots-Band-Aids Used for Wound Disinfection Hanjun Sun, Nan Gao, Kai Dong, Jinsong Ren, and Xiaogang Qu* Laboratory of Chemical Biology, Division of Biological Inorganic
More informationFigure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei.
Figure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei. (B) The standard curve for lysine concentrations versus OD600 values
More informationklp-18 (RNAi) Control. supplementary information. starting strain: AV335 [emb-27(g48); GFP::histone; GFP::tubulin] bleach
DOI: 10.1038/ncb1891 A. starting strain: AV335 [emb-27(g48); GFP::histone; GFP::tubulin] bleach embryos let hatch overnight transfer to RNAi plates; incubate 5 days at 15 C RNAi food L1 worms adult worms
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7
More informationSupplementary Information. Supplementary Figure 1
Supplementary Information Supplementary Figure 1 1 Supplementary Figure 1. Functional assay of the hcas9-2a-mcherry construct (a) Gene correction of a mutant EGFP reporter cell line mediated by hcas9 or
More informationSUPPLEMENTARY FIGURE S1: nlp-22 is expressed in the RIA interneurons and is secreted. (a) An animal expressing both the RIA specific reporter
1 SUPPLEMENTARY FIGURE S1: nlp-22 is expressed in the RIA interneurons and is secreted. (a) An animal expressing both the RIA specific reporter Pglr-3:mCherry (red) and Pnlp-22:gfp (green) shows co-localization
More informationFigure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR
Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR and LRRK2 WD40 GST fusion proteins (5 µg) were loaded
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationNature Protocols: doi: /nprot Supplementary Figure 1. Fluorescent titration of probe CPDSA.
Supplementary Figure 1 Fluorescent titration of probe CPDSA. Fluorescent titration of probe CPDSA (10 um) upon addition of GSH in HEPES (10 mm, ph = 7.4) containing 10% DMSO. Each spectrum was recorded
More informationSupplementary figure legends
Supplementary figure legends Supplementary Figure 1. Exposure of CRT occurs independently from the apoptosisassociated loss of the mitochondrial membrane potential (MMP). (A) HeLa cells treated with MTX
More informationSupplemental Data. Hiruma et al. Plant Cell. (2010) /tpc Col-0. pen2-1
A Ch B Col-0 Cg pen2-1 Supplemental Figure 1. Trypan Blue Staining of Leaves Inoculated with Adapted and Nonadapted Colletotrichum Species.(A) Conidial suspensions of C. higginsianum MAFF305635 (Ch) were
More informationSupplementary Figure-1. SDS PAGE analysis of purified designed carbonic anhydrase enzymes. M1-M4 shown in lanes 1-4, respectively, with molecular
Supplementary Figure-1. SDS PAGE analysis of purified designed carbonic anhydrase enzymes. M1-M4 shown in lanes 1-4, respectively, with molecular weight markers (M). Supplementary Figure-2. Overlay of
More informationEPI TIR-FM min
a 15 b EPI 45 75 min TIR-FM c min Supplementary figure 1. Fluorescence microscopy of Gag- GFP. HeLa cells were transfected with Gag and Gag-GFP and imaged at 5-6 hpt. a, Images of a single cell observed
More informationbio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM.
bio-mof-1 Transmittance bio-mof-1 DMASM DMASMI 2000 1500 1000 500 Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. Intensity (a.u.) bio-mof-1 DMASM as
More informationFigure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow
SUPPLEMENTARY DATA Supplementary Figure Legends Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow cytometry analysis of PMVs labelled with annexin-v-pe (Guava technologies)
More informationRapid parallel measurements of macroautophagy and mitophagy in
Supplemental Figures Rapid parallel measurements of macroautophagy and mitophagy in mammalian cells using a single fluorescent biosensor Sargsyan A, Cai J, Fandino LB, Labasky ME, Forostyan T, Colosimo
More informationSupplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization
Supplementary Information for A cancer-associated BRCA2 mutation reveals masked nuclear export signals controlling localization Anand D Jeyasekharan 1, Yang Liu 1, Hiroyoshi Hattori 1,3, Venkat Pisupati
More informationSupplementary Material
Supplementary Material Materials and methods Enzyme assay The enzymatic activity of -glucosidase toward salicin was measured with the Miller method (Miller, 1959) using glucose as the standard. A total
More informationSupplementary Figures
Inhibition of Pulmonary Anti Bacterial Defense by IFN γ During Recovery from Influenza Infection By Keer Sun and Dennis W. Metzger Supplementary Figures d a Ly6G Percentage survival f 1 75 5 1 25 1 5 1
More informationProlonged mitotic arrest induces a caspase-dependent DNA damage
SUPPLEMENTARY INFORMATION Prolonged mitotic arrest induces a caspase-dependent DNA damage response at telomeres that determines cell survival Karolina O. Hain, Didier J. Colin, Shubhra Rastogi, Lindsey
More informationNature Genetics: doi: /ng Supplementary Figure 1. HOX fusions enhance self-renewal capacity.
Supplementary Figure 1 HOX fusions enhance self-renewal capacity. Mouse bone marrow was transduced with a retrovirus carrying one of three HOX fusion genes or the empty mcherry reporter construct as described
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Mutational analysis of the SA2-Scc1 interaction in vitro and in human cells. (a) Autoradiograph (top) and Coomassie stained gel (bottom) of 35 S-labeled Myc-SA2 proteins (input)
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/3/114/ra23/dc1 Supplementary Materials for Regulation of Zap70 Expression During Thymocyte Development Enables Temporal Separation of CD4 and CD8 Repertoire Selection
More informationTitle: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis
Scientific Reports Supplementary information Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis Authors: Ikuhiko
More informationAPOLs with low ph dependence can kill all African trypanosomes
SUPPLEMENTARY INFORMATION Letters DOI: 1.138/s41564-17-34-1 In the format provided by the authors and unedited. APOLs with low ph dependence can kill all African trypanosomes Frédéric Fontaine 1, Laurence
More informationSupplementary information
Supplementary information 1 Supplementary Figure 1. CALM regulates autophagy. (a). Quantification of LC3 levels in the experiment described in Figure 1A. Data are mean +/- SD (n > 3 experiments for each
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Krenn et al., http://www.jcb.org/cgi/content/full/jcb.201110013/dc1 Figure S1. Levels of expressed proteins and demonstration that C-terminal
More informationCathepsin K Activity Assay Kit
Cathepsin K Activity Assay Kit Catalog Number KA0769 100 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials
More informationInterlab Study - Cloning and measuring of GFP and RFP
Interlab Study - Cloning and measuring of GFP and RFP The following constructs are build for further GFP and RFP measurement: I2020 GFP construct 0 K823005 + E0240 GFP construct I K823012 + E0240 GFP construct
More informationNature Neuroscience: doi: /nn Supplementary Figure 1. Large-scale calcium imaging in vivo.
Supplementary Figure 1 Large-scale calcium imaging in vivo. (a) Schematic illustration of the in vivo camera imaging set-up for large-scale calcium imaging. (b) High-magnification two-photon image from
More informationLate assembly of the Vibrio cholerae cell division machinery postpones
2 Late assembly of the Vibrio cholerae cell division machinery postpones septation to the last % of the cell cycle 3 4 Elisa Galli, Evelyne Paly and François-Xavier Barre,# 5 6 7 Institute for Integrative
More information- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml)
Supplementary Table ST1: The dynamic effect of LPS on IL-6 production in monocytes and THP-1 cells after GdA treatment. Monocytes, THP-1 cells and macrophages (5x10 5 ) were incubated with 10 μg/ml of
More informationSupplementary Figure 1: Imaging T-ALL progression and growth in transplanted
Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted rag2e450fs fish. Monoclonal T-ALLs were serially passaged in strain fish and then used as donors (left panel). Cells were transplanted
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Choi YL, Soda M, Yamashita Y, et al. EML4-ALK mutations in
More informationSupplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T
More informationREPRINT WITH PERMISSION ONLY
Modern f luorescent proteins: from chromophore formation to novel intracellular applications Olesya V. Stepanenko, 1 Olga V. Stepanenko, 1 Daria M. Shcherbakova, 2 Irina M. Kuznetsova, 1 Кonstantin К.
More informationSupplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random
S1 Supplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random Conical Tilt (RCT) reconstruction (left: -50,right:
More informationSupplementary Information. Tissue-wide immunity against Leishmania. through collective production of nitric oxide
Supplementary Information Tissue-wide immunity against Leishmania through collective production of nitric oxide Romain Olekhnovitch, Bernhard Ryffel, Andreas J. Müller and Philippe Bousso Supplementary
More informationGene expression scaled by distance to the genome replication site. Ying et al. Supporting Information. Contents. Supplementary note I p.
Gene expression scaled by distance to the genome replication site Ying et al Supporting Information Contents Supplementary note I p. 2 Supplementary note II p. 3-5 Supplementary note III p. 5-7 Supplementary
More informationProblem Set 8 Key 1 of 8
7.06 2003 Problem Set 8 Key 1 of 8 7.06 2003 Problem Set 8 Key 1. As a bright MD/PhD, you are interested in questions about the control of cell number in the body. Recently, you've seen three patients
More informationFile name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description:
File name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description: Supplementary Figure 1. Schematic of Ras biochemical coupled assay.
More informationph and Reduction Dual Responsive Polyurethane Triblock Copolymers for Efficient Intracellular Drug Delivery
Supporting Information ph and Reduction Dual Responsive Polyurethane Triblock Copolymers for Efficient Intracellular Drug Delivery Shuangjiang Yu a, Chaoliang He* a, Jianxun Ding a,b, Yilong Cheng a,b,
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1 SNARE Probes for FRET/2pFLIM Analysis Used in the Present Study. mturquoise (mtq) and Venus (Ven) are in blue and yellow, respectively. The soluble N-ethylmaleimide-sensitive
More informationSupplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were
Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were isolated from wild type (PKC-θ- WT) or PKC-θ null (PKC-θ-KO)
More informationA highly selective AIE fluorogen for lipid droplet imaging in live cells and green algae
Electronic Supporting Information highly selective IE fluorogen for lipid droplet imaging in live cells and green algae Erjing Wang, ab Engui Zhao, ab Yuning Hong, ab Jacky W. Y. Lam, ab and en Zhong Tang*
More informationSuperior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum...1. Trademarks: HiLyte Fluor (AnaSpec, Inc.)
Table of Contents Fluor TM Labeling Dyes Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum....1 Fluor TM 405 Dye, an Excellent Alternative to Alexa Fluor 405 & DyLight 405....2 Fluor
More informationd e f Spatiotemporal quantification of subcellular ATP levels in a single HeLa cell during changes in morphology Supplementary Information
Ca 2+ level (a. u.) Area (a. u.) Normalized distance Normalized distance Center Edge Center Edge Relative ATP level Relative ATP level Supplementary Information Spatiotemporal quantification of subcellular
More informationRescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al
Supplementary Material Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Figure 1. AICAR improves P23H rod opsin
More informationNature Biotechnology: doi: /nbt.3828
Supplementary Figure 1 Development of a FRET-based MCS. (a) Linker and MA2 modification are indicated by single letter amino acid code. indicates deletion of amino acids and N or C indicate the terminus
More informationOptimization of the Fuse-It-mRNA Protocol for L929 Cells in the µ-plate 24 Well
Optimization of the Fuse-It-mRNA Protocol for L929 Cells in the µ-plate 24 Well 1. General Information... 1 2. Background... 1 3. Material and Equipment Required... 2 4. Experimental Procedure and Results...
More informationElectronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection
Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 2014 Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic
More informationSupplementary Material
Supplementary Material accompanying the manuscript Interleukin 37 is a fundamental inhibitor of innate immunity Marcel F Nold, Claudia A Nold-Petry, Jarod A Zepp, Brent E Palmer, Philip Bufler & Charles
More informationF-actin VWF Vinculin. F-actin. Vinculin VWF
a F-actin VWF Vinculin b F-actin VWF Vinculin Supplementary Fig. 1. WPBs in HUVECs are located along stress fibers and at focal adhesions. (a) Immunofluorescence images of f-actin (cyan), VWF (yellow),
More informationPre-made Reporter Lentivirus for JAK-STAT Signaling Pathway
Pre-made Reporter for JAK-STAT Signaling Pathway Cat# Product Name Amounts LVP937-P or: LVP937-P-PBS ISRE-GFP (Puro) LVP938-P or: LVP938-P-PBS ISRE-RFP (Puro) LVP939-P or: LVP939-P-PBS ISRE-Luc (Puro)
More informationSupporting Information
Supporting Information Toward High-Efficient Red Emissive Carbon Dots: Facile Preparation, Unique Properties, and Applications as Multifunctional Theranostic Agents Shan Sun,, Ling Zhang, Kai Jiang, Aiguo
More informationLentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression.
Supplementary Figure 1 Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. a, Design for lentiviral combinatorial mirna expression and sensor constructs.
More informationreads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced to express
Supplementary Figure 1. VapC-mt4 cleaves trna Ala2 in E. coli. Histograms representing the fold change in reads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced
More informationIntravital Microscopic Interrogation of Peripheral Taste Sensation
Supplementary Information Intravital Microscopic Interrogation of Peripheral Taste Sensation Myunghwan Choi 1, Woei Ming Lee 1,2, and Seok-Hyun Yun 1 * 1 Harvard Medical School and Wellman Center for Photomedicine,
More informationSupplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis
Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis of PD-L1 in ovarian cancer cells. (c) Western blot analysis
More informationSupplementary information - Table (1), Figures (12), and Videos (5)
Supplementary information - Table (1), Figures (12), and Videos (5) A soft, transparent, freely accessible cranial window for chronic imaging and electrophysiology Chaejeong Heo 1, Hyejin Park 1, 2, Yong-Tae
More informationGel-assisted formation of giant unilamellar vesicles
Gel-assisted formation of giant unilamellar vesicles Andreas Weinberger 1, Feng-Ching Tsai 2, Gijsje H. Koenderink 2, Thais F. Schmidt 3, Rosângela Itri 4, Wolfgang Meier 5, Tatiana Schmatko 1, André Schröder
More informationNature Medicine: doi: /nm.2109
HIV 1 Infects Multipotent Progenitor Cells Causing Cell Death and Establishing Latent Cellular Reservoirs Christoph C. Carter, Adewunmi Onafuwa Nuga, Lucy A. M c Namara, James Riddell IV, Dale Bixby, Michael
More informationMicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells
MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on
More informationSupporting Information
Supporting Information Cancer Cell Membrane-Biomimetic Nanoprobes with Two-Photon Excitation and Near-Infrared Emission for Intravital Tumor Fluorescence Imaging Yanlin Lv 1,2,, Ming Liu 3,4,, Yong Zhang
More information(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/6/283/ra57/dc1 Supplementary Materials for JNK3 Couples the Neuronal Stress Response to Inhibition of Secretory Trafficking Guang Yang,* Xun Zhou, Jingyan Zhu,
More informationSupplementary information. The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic. Spindle Orientation
Supplementary information The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic Spindle Orientation Running title: Dynein LICs distribute mitotic functions. Sagar Mahale a, d, *, Megha
More informationEffects of UBL5 knockdown on cell cycle distribution and sister chromatid cohesion
Supplementary Figure S1. Effects of UBL5 knockdown on cell cycle distribution and sister chromatid cohesion A. Representative examples of flow cytometry profiles of HeLa cells transfected with indicated
More informationSupplementary Data. Different volumes of ethanol or calcium solution were slowly added through one of four
Supplementary Data METHODS Liposome preparation Different volumes of ethanol or calcium solution were slowly added through one of four methods: Method I, no ethanol or calcium solution; Method II, exactly
More information293T cells were transfected with indicated expression vectors and the whole-cell extracts were subjected
SUPPLEMENTARY INFORMATION Supplementary Figure 1. Formation of a complex between Slo1 and CRL4A CRBN E3 ligase. (a) HEK 293T cells were transfected with indicated expression vectors and the whole-cell
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3076 Supplementary Figure 1 btrcp targets Cep68 for degradation during mitosis. a) Cep68 immunofluorescence in interphase and metaphase. U-2OS cells were transfected with control sirna
More informationSupporting Information
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2018 Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 2016. Supporting Information
More informationLuminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the
More informationFluorescence Microscopy
Fluorescence Microscopy Imaging Organelles Mitochondria Lysosomes Nuclei Endoplasmic Reticulum Plasma Membrane F-Actin AAT Bioquest Introduction: Organelle-Selective Stains Organelles are tiny, specialized
More informationSupplementary table 1
Supplementary table 1 S. pombe strain list Fig. 1A JX38 h + ade6-m216 nda3-km311 PX476 PW775 PX545 PX546 h- ade6-m216 sgo2::ura4 + nda3-km311 h 9 mad2::ura4 + nda3-km311 h + ade6-m21 nda3-km311 rad21 +
More informationSUPPLEMENTARY INFORMATION
Figure S1. Cleavage of uniquitin AAA -CPP TAT in vitro and in cells. a, b. In vitro two-dimensional 1 H- 15 N correlation spectrum of ubiquitin AAA -CPP TAT before (a) and after (b) Yeast Ubiquitin Hydrolase
More informationSUPPLEMENTAL EXPERIMENTAL PROCEDURES
SUPPLEMENTAL EXPERIMENTAL PROCEDURES Crystal violet assay Cells were seeded in 24-well plates and cultured in media supplemented with % FBS for 7 days. Media were then removed, plates were briefly washed
More informationBMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented
Supplemental Materials Figure S1. Cultured BMDCs express CD11c BMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented with 15 ng/ml GM-CSF. Media was changed and fresh
More informationA novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo
Supporting Information A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo Yiming Li, a,b Hanbao Chong, a Xiangming Meng,* a Shuxin Wang, a Manzhou Zhu a and Qingxiang
More informationQuantification of intracellular payload release from
Quantification of intracellular payload release from polymersome nanoparticles Edoardo Scarpa 1,2, Joanne L. Bailey 2, Agnieszka A. Janeczek 1,2, Patrick S. Stumpf 1,2, Alexander H. Johnston 2, Richard
More informationPre-made Lentiviral Particles for Fluorescent Proteins
Pre-made Lentiviral Particles for Fluorescent Proteins Catalog# Product Name Amounts Fluorescent proteins expressed under sucmv promoter: LVP001 LVP001-PBS LVP002 LVP002-PBS LVP011 LVP011-PBS LVP012 LVP012-PBS
More informationSupplementary Information
Supplementary Information Archaeal Elp3 catalyzes trna wobble uridine modification at C5 via a radical mechanism Kiruthika Selvadurai, Pei Wang, Joseph Seimetz & Raven H Huang* Department of Biochemistry,
More information