Near-infrared fluorescent proteins

Size: px
Start display at page:

Download "Near-infrared fluorescent proteins"

Transcription

1 nature methods Near-infrared fluorescent proteins Dmitry Shcherbo, Irina I Shemiakina, Anastasiya V Ryabova, Kathryn E Luker, Bradley T Schmidt, Ekaterina A Souslova, Tatiana V Gorodnicheva, Lydia Strukova, Konstantin M Shidlovskiy, Olga V Britanova, Andrey G Zaraisky, Konstantin A Lukyanov, Victor B Loschenov, Gary D Luker & Dmitriy M Chudakov Supplementary figures and text: Supplementary Figure 1 Supplementary Figure 2 Supplementary Figure 3 Supplementary Figure 4 Supplementary Figure 5 Supplementary Figure 6 Supplementary Figure 7 Transgenic zebrafish expressing Katushka in muscle cells. Comparison of cytotoxicity of selected fluorescent proteins in E. coli. Comparison of cytotoxicity of Katushka and Katushka-9-5 in HeLa cells. Alignment of the amino acid sequences of selected fluorescent proteins. Comparison of fluorescent properties of selected fluorescent proteins in bacterial streaks. Transient transfection of HeLa cells by eqfp650 and eqfp670. Katushka, eqfp650 and eqfp670 fluorescence and absorbance spectra.

2 Supplementary Figure 1. Transgenic zebrafish expressing Katushka in muscle cells. (a) White light image. (b) Overlay of white light and fluorescence images in a stereomicroscope.

3 mcherry Katushka Katushka 9-5 eqfp650 eqfp670 mneptune E2-Crimson IPTG induction estimated cytotoxicity no induction medium high low low low high low Supplementary Figure 2. Comparison of cytotoxicity of selected fluorescent proteins in E. coli. To compare protein cytotoxicity in prokaryotes, E. coli cells (XL1 Blue strain) were transformed with pqe30 vectors encoding corresponding fluorescent proteins. Equal portions of bacteria were inoculated on LB agar plates with or without 10 µg/ml IPTG to induce high promoter activity. Bacterial clones were photographed after overnight growth at 37 C. It should be noted that expression of fluorescent proteins in XL1 Blue strain from pqe30 vector produces sufficiently high expression levels without IPTG induction, due to the intense promoter leakage. Induction by IPTG further raises expression levels that become cytotoxic for growing E. coli, slowing the rate of bacterial growth and producing smaller colonies. For those proteins that demonstrate relatively high cytotoxicty at the given expression level, colony growth can be completely blocked. Estimated relative cytotoxicity in bacteria is shown in the lower row. Scale bar, 1 cm. 2

4 Supplementary Figure 3. Comparison of cytotoxicity of Katushka and Katushka-9-5 in HeLa cells. (a) Images obtained on days 3, 4 and 5 after transfection with Katushka or Katushka-9-5. Scale bar, 200 μm. (b) The same cells were analyzed by flow cytometry. Graphs show percentage and brightness of cells expressing Katushka or Katushka days after transfection. Columns show percentage of cells expressing Katushka or Katushka and 5 days after transfection, respectively. The same high numbers of living fluorescent cells were detected after five days of culturing by both fluorescence microscopy and flow cytometry. Standard deviations (n = 3 transfection experiments) are shown. 3

5 avgfp MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTG-KLPVPWPT DsRed MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI E2-Crimson MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGVGEGKPYEGTQTAKLQVTKGGPLPFAWDI eqfp578 MSELIKENMHMKLYMEGTVNNHHFKCTSEGERKPYEGTQTMKIKVVEGGPLPFAFDI mneptune MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTGRIKVVEGGPLPFAFDI Katushka MGEDSVLITENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDI Katushka-9-5 MGEDSELISENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDI eqfp650 MGEDSELISENMHMKLYMEGTVNGHHFKCTSEGEGKPYEGTQTAKIKVVEGGPLPFAFDI eqfp670 MGEDSELISENMHTKLYMEGTVNGHHFKCTSEGEGKPYEGTQTCKIKVVEGGPLPFAFDI avgfp LVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT DsRed LSPQFQYGSKVYVKHPADIP--DYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGC E2-Crimson LSPQFFYGSKAYIKHPADIP--DYLKQSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGT eqfp578 LATSFMYGSKTFINHTQGIP--DLFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC mneptune LATCFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGC Katushka LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC Katushka-9-5 LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC eqfp650 LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC eqfp670 LATSFMYGSKTFINHTQGIP--DFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGC avgfp LVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQL DsRed FIYKVKFIGVNFPSDGPVMQKKTM-GWEASTERLYPR--DGVLKGEIHKALKLKDGGHYL E2-Crimson LIYHVKFIGVNFPSDGPVMQKKTL-GWEPSTERNYPR--DGVLKGENHMALKLKGGGHYL eqfp578 IIYNVKINGVNFPSNGSVMQKKTL-GWEANTEMLYPA--DGGLRGHSQMALKLVGGGYLH mneptune LIYNVKIRGVNFPSNGPVMQKKTL-GWEASTETLYPA--DGGLEGRCDMALKLVGGGHLI Katushka LIYNVKINGVNFPSNGPVMQKKTL-GWEASTEMLYPA--DSGLRGHSQMALKLVGGGYLH Katushka-9-5 LIYNVKINGVNFPSNGPVMQKKTL-GWEASTEMLYPA--DSGLRGHSQMALKLVGGGYLH eqfp650 LIYNVKINGVNFPSNGPVMQKKTL-GWEASTEMLYPA--DSGLRGHSQMALKLVGGGYLH eqfp670 LIYNVKINGVNFPSNGPVMQKKTL-GWEANTEMLYPA--DSGLRGHNQMALKLVGGGYLH avgfp ADHYQQNTPIGD-GPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK DsRed VEFKSIYMAKKP---VQLPGYYYVDSKLDITSH-NEDYTIVEQYERTEGRHHLFL E2-Crimson CEFKSIYMAKKP---VKLPGYHYVDYKLDITSH-NEDYTVVEQYERAEARHHLFQ eqfp578 CSFKTTYRSKKPAKNLKMPGFHFVDHRLERIKE-ADKETYVEQHEMAVAKYCDLPSKLGHR mneptune CNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKE-ADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK Katushka CSLKTTYRSKKPAKNLKMPGFYFVDRRLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS Katushka-9-5 CSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS eqfp650 CSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS eqfp670 CSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKE-ADKETYVEQHEMAVARYCDLPSKLGHS Supplementary Figure 4. Alignment of the amino acid sequences of selected fluorescent proteins. Structurally important regions are highlighted in gray, beta-strands are shown with arrows, and alpha-helices are shown with ribbons. Chromophore-forming residues are underlined. The differences between Katushka and Katushka-9-5 are shown in green. Note that Glu6 was inherited from the wild-type eqfp578. Substitutions that resulted in the formation of eqfp650 and eqfp670 are shown in red (directed changes) or in blue (random mutations). Mutation of Met44 in E2-Crimson and mneptune is shown yellow. Overall alignment numbering follows that of Aequorea victoria GFP (avgfp). 4

6 Supplementary Figure 5. Comparison of fluorescent properties of selected fluorescent proteins in bacterial streaks. Streaks of E. coli transformed with a corresponding fluorescent protein were imaged with a fluorescent stereomicroscope using various filter sets or under 635 nm diodes after overnight growth at 37 C. Note that relatively low brightness of mneptune is characteristic for bacterial cells only. In eukaryotic cells, both mneptune and Neptune demonstrate high brightness 48 h after transfection (see Fig. 1b of the main text). 5

7 eqfp650 eqfp670 Supplementary Figure 6. Transient transfection of HeLa cells by eqfp650 and eqfp670. HeLa cells transiently transfected with eqfp650 or eqfp670 were visualized using widefield Leica AFLX 6000 microscope, 63x objective, after 3 days of incubation. Scale bars, 10 μm. 6

8 A. 1,0 eqfp650 eqfp670 Katushka Fluorescence, a.u. 0,8 0,6 0,4 0, Wavelength, nm B. 1,0 0,8 eqfp650 eqfp670 Katushka Absorbance, a.u. 0,6 0,4 0, Wavelength, nm Supplementary Figure 7. Katushka, eqfp650 and eqfp670 fluorescence and absorbance spectra. (a) Excitation (solid lines) and emission (dashed lines) spectra. (b) Absorbance spectra. 7

ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES

ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES Ruslan I. Dmitriev, Alexander V. Zhdanov, Greg Jasionek, Dmitri B. Papkovsky Biochemistry Department, University

More information

Supplementary Information

Supplementary Information Electronic Supplementary Material (ESI) for Analyst. This journal is The Royal Society of Chemistry 2018 Supplementary Information Spying on Protein Interactions in Living Cells with Reconstituted Scarlet

More information

Biology Open (2014) 000, 1 10 doi: /bio

Biology Open (2014) 000, 1 10 doi: /bio (2014) 000, 1 10 doi:10.1242/bio.201410041 Supplementary Material Michael Brauchle et al. doi: 10.1242/bio.201410041 Fig. S1. Alignment of GFP, sfgfp, egfp, eyfp, mcherry and mruby2. Sequence-based alignment

More information

Nature Methods: doi: /nmeth.4257

Nature Methods: doi: /nmeth.4257 Supplementary Figure 1 Screen for polypeptides that affect cellular actin filaments. (a) Table summarizing results from all polypeptides tested. Source shows organism, gene, and amino acid numbers used.

More information

O. Repeat the measurement in all relevant modes used in your experiments (e.g. settings for orbital averaging).

O. Repeat the measurement in all relevant modes used in your experiments (e.g. settings for orbital averaging). Before You Begin Read through this entire protocol sheet carefully before you start your experiment and prepare any materials you may need. This year, in order to improve reproducibility, we are requiring

More information

Chapter 3. Expression of α5-megfp in Mouse Cortical Neurons. on the β subunit. Signal sequences in the M3-M4 loop of β nachrs bind protein factors to

Chapter 3. Expression of α5-megfp in Mouse Cortical Neurons. on the β subunit. Signal sequences in the M3-M4 loop of β nachrs bind protein factors to 22 Chapter 3 Expression of α5-megfp in Mouse Cortical Neurons Subcellular localization of the neuronal nachr subtypes α4β2 and α4β4 depends on the β subunit. Signal sequences in the M3-M4 loop of β nachrs

More information

Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.

Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Supplementary Information Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Various concentrations of Ent, DHBA or ABAH were pre-incubated for 10 min with LPO (50

More information

Supporting Information For

Supporting Information For Supporting Information For MicroRNA-Catalyzed Cancer Therapeutics Based on DNA-Programmed Nanoparticle Complex Xucheng Luo, 1 Zhi Li, 1 Ganglin Wang, 1 Xuewen He, 2,3 Xiaoqin Shen, 1 Quanhong Sun, 1 Li

More information

Nature Medicine: doi: /nm.4322

Nature Medicine: doi: /nm.4322 1 2 3 4 5 6 7 8 9 10 11 Supplementary Figure 1. Predicted RNA structure of 3 UTR and sequence alignment of deleted nucleotides. (a) Predicted RNA secondary structure of ZIKV 3 UTR. The stem-loop structure

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Lu et al., http://www.jcb.org/cgi/content/full/jcb.201012063/dc1 Figure S1. Kinetics of nuclear envelope assembly, recruitment of Nup133

More information

Development of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells

Development of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells Supporting Information for Development of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells Sasa Zhu, Weiying Lin,* Lin Yuan State Key Laboratory of Chemo/Biosensing

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1 Induction of non-apoptotic death of SV40-transformed and primary DKO MEFs, and DKO thymocytes. (A-F) STS-induced non-apoptotic death of DKO MEF. (A, B) Reduced viability of DKO MEFs after exposure

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10962 Supplementary Figure 1. Expression of AvrAC-FLAG in protoplasts. Total protein extracted from protoplasts described in Fig. 1a was subjected to anti-flag immunoblot to detect AvrAC-FLAG

More information

Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) .

Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) . Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) The inhibitory effects of new antibodies (Mab17 and Mab18). They were investigated in in vitro fertilization

More information

B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer

B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small

More information

A far-red fluorescent protein evolved from a cyanobacterial phycobiliprotein

A far-red fluorescent protein evolved from a cyanobacterial phycobiliprotein SUPPLEMENTARY INFORMATION A far-red fluorescent protein evolved from a cyanobacterial phycobiliprotein Erik A. Rodriguez, Geraldine N. Tran, Larry A. Gross, Jessica L. Crisp, Xiaokun Shu, John Y. Lin,

More information

A. Generation and characterization of Ras-expressing autophagycompetent

A. Generation and characterization of Ras-expressing autophagycompetent Supplemental Material Supplemental Figure Legends Fig. S1 A. Generation and characterization of Ras-expressing autophagycompetent and -deficient cell lines. HA-tagged H-ras V12 was stably expressed in

More information

genome edited transient transfection, CMV promoter

genome edited transient transfection, CMV promoter Supplementary Figure 1. In the absence of new protein translation, overexpressed caveolin-1-gfp is degraded faster than caveolin-1-gfp expressed from the endogenous caveolin 1 locus % loss of total caveolin-1-gfp

More information

Graphene Quantum Dots-Band-Aids Used for Wound Disinfection

Graphene Quantum Dots-Band-Aids Used for Wound Disinfection Supporting information Graphene Quantum Dots-Band-Aids Used for Wound Disinfection Hanjun Sun, Nan Gao, Kai Dong, Jinsong Ren, and Xiaogang Qu* Laboratory of Chemical Biology, Division of Biological Inorganic

More information

Figure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei.

Figure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei. Figure S1. Standard curves for amino acid bioassays. (A) The standard curve for leucine concentration versus OD600 values for L. casei. (B) The standard curve for lysine concentrations versus OD600 values

More information

klp-18 (RNAi) Control. supplementary information. starting strain: AV335 [emb-27(g48); GFP::histone; GFP::tubulin] bleach

klp-18 (RNAi) Control. supplementary information. starting strain: AV335 [emb-27(g48); GFP::histone; GFP::tubulin] bleach DOI: 10.1038/ncb1891 A. starting strain: AV335 [emb-27(g48); GFP::histone; GFP::tubulin] bleach embryos let hatch overnight transfer to RNAi plates; incubate 5 days at 15 C RNAi food L1 worms adult worms

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7

More information

Supplementary Information. Supplementary Figure 1

Supplementary Information. Supplementary Figure 1 Supplementary Information Supplementary Figure 1 1 Supplementary Figure 1. Functional assay of the hcas9-2a-mcherry construct (a) Gene correction of a mutant EGFP reporter cell line mediated by hcas9 or

More information

SUPPLEMENTARY FIGURE S1: nlp-22 is expressed in the RIA interneurons and is secreted. (a) An animal expressing both the RIA specific reporter

SUPPLEMENTARY FIGURE S1: nlp-22 is expressed in the RIA interneurons and is secreted. (a) An animal expressing both the RIA specific reporter 1 SUPPLEMENTARY FIGURE S1: nlp-22 is expressed in the RIA interneurons and is secreted. (a) An animal expressing both the RIA specific reporter Pglr-3:mCherry (red) and Pnlp-22:gfp (green) shows co-localization

More information

Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR

Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR and LRRK2 WD40 GST fusion proteins (5 µg) were loaded

More information

SUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods

SUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang

More information

Nature Protocols: doi: /nprot Supplementary Figure 1. Fluorescent titration of probe CPDSA.

Nature Protocols: doi: /nprot Supplementary Figure 1. Fluorescent titration of probe CPDSA. Supplementary Figure 1 Fluorescent titration of probe CPDSA. Fluorescent titration of probe CPDSA (10 um) upon addition of GSH in HEPES (10 mm, ph = 7.4) containing 10% DMSO. Each spectrum was recorded

More information

Supplementary figure legends

Supplementary figure legends Supplementary figure legends Supplementary Figure 1. Exposure of CRT occurs independently from the apoptosisassociated loss of the mitochondrial membrane potential (MMP). (A) HeLa cells treated with MTX

More information

Supplemental Data. Hiruma et al. Plant Cell. (2010) /tpc Col-0. pen2-1

Supplemental Data. Hiruma et al. Plant Cell. (2010) /tpc Col-0. pen2-1 A Ch B Col-0 Cg pen2-1 Supplemental Figure 1. Trypan Blue Staining of Leaves Inoculated with Adapted and Nonadapted Colletotrichum Species.(A) Conidial suspensions of C. higginsianum MAFF305635 (Ch) were

More information

Supplementary Figure-1. SDS PAGE analysis of purified designed carbonic anhydrase enzymes. M1-M4 shown in lanes 1-4, respectively, with molecular

Supplementary Figure-1. SDS PAGE analysis of purified designed carbonic anhydrase enzymes. M1-M4 shown in lanes 1-4, respectively, with molecular Supplementary Figure-1. SDS PAGE analysis of purified designed carbonic anhydrase enzymes. M1-M4 shown in lanes 1-4, respectively, with molecular weight markers (M). Supplementary Figure-2. Overlay of

More information

EPI TIR-FM min

EPI TIR-FM min a 15 b EPI 45 75 min TIR-FM c min Supplementary figure 1. Fluorescence microscopy of Gag- GFP. HeLa cells were transfected with Gag and Gag-GFP and imaged at 5-6 hpt. a, Images of a single cell observed

More information

bio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM.

bio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. bio-mof-1 Transmittance bio-mof-1 DMASM DMASMI 2000 1500 1000 500 Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. Intensity (a.u.) bio-mof-1 DMASM as

More information

Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow

Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow SUPPLEMENTARY DATA Supplementary Figure Legends Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow cytometry analysis of PMVs labelled with annexin-v-pe (Guava technologies)

More information

Rapid parallel measurements of macroautophagy and mitophagy in

Rapid parallel measurements of macroautophagy and mitophagy in Supplemental Figures Rapid parallel measurements of macroautophagy and mitophagy in mammalian cells using a single fluorescent biosensor Sargsyan A, Cai J, Fandino LB, Labasky ME, Forostyan T, Colosimo

More information

Supplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization

Supplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization Supplementary Information for A cancer-associated BRCA2 mutation reveals masked nuclear export signals controlling localization Anand D Jeyasekharan 1, Yang Liu 1, Hiroyoshi Hattori 1,3, Venkat Pisupati

More information

Supplementary Material

Supplementary Material Supplementary Material Materials and methods Enzyme assay The enzymatic activity of -glucosidase toward salicin was measured with the Miller method (Miller, 1959) using glucose as the standard. A total

More information

Supplementary Figures

Supplementary Figures Inhibition of Pulmonary Anti Bacterial Defense by IFN γ During Recovery from Influenza Infection By Keer Sun and Dennis W. Metzger Supplementary Figures d a Ly6G Percentage survival f 1 75 5 1 25 1 5 1

More information

Prolonged mitotic arrest induces a caspase-dependent DNA damage

Prolonged mitotic arrest induces a caspase-dependent DNA damage SUPPLEMENTARY INFORMATION Prolonged mitotic arrest induces a caspase-dependent DNA damage response at telomeres that determines cell survival Karolina O. Hain, Didier J. Colin, Shubhra Rastogi, Lindsey

More information

Nature Genetics: doi: /ng Supplementary Figure 1. HOX fusions enhance self-renewal capacity.

Nature Genetics: doi: /ng Supplementary Figure 1. HOX fusions enhance self-renewal capacity. Supplementary Figure 1 HOX fusions enhance self-renewal capacity. Mouse bone marrow was transduced with a retrovirus carrying one of three HOX fusion genes or the empty mcherry reporter construct as described

More information

Nature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1

Nature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1 Supplementary Figure 1 Mutational analysis of the SA2-Scc1 interaction in vitro and in human cells. (a) Autoradiograph (top) and Coomassie stained gel (bottom) of 35 S-labeled Myc-SA2 proteins (input)

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/3/114/ra23/dc1 Supplementary Materials for Regulation of Zap70 Expression During Thymocyte Development Enables Temporal Separation of CD4 and CD8 Repertoire Selection

More information

Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis

Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis Scientific Reports Supplementary information Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis Authors: Ikuhiko

More information

APOLs with low ph dependence can kill all African trypanosomes

APOLs with low ph dependence can kill all African trypanosomes SUPPLEMENTARY INFORMATION Letters DOI: 1.138/s41564-17-34-1 In the format provided by the authors and unedited. APOLs with low ph dependence can kill all African trypanosomes Frédéric Fontaine 1, Laurence

More information

Supplementary information

Supplementary information Supplementary information 1 Supplementary Figure 1. CALM regulates autophagy. (a). Quantification of LC3 levels in the experiment described in Figure 1A. Data are mean +/- SD (n > 3 experiments for each

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Krenn et al., http://www.jcb.org/cgi/content/full/jcb.201110013/dc1 Figure S1. Levels of expressed proteins and demonstration that C-terminal

More information

Cathepsin K Activity Assay Kit

Cathepsin K Activity Assay Kit Cathepsin K Activity Assay Kit Catalog Number KA0769 100 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials

More information

Interlab Study - Cloning and measuring of GFP and RFP

Interlab Study - Cloning and measuring of GFP and RFP Interlab Study - Cloning and measuring of GFP and RFP The following constructs are build for further GFP and RFP measurement: I2020 GFP construct 0 K823005 + E0240 GFP construct I K823012 + E0240 GFP construct

More information

Nature Neuroscience: doi: /nn Supplementary Figure 1. Large-scale calcium imaging in vivo.

Nature Neuroscience: doi: /nn Supplementary Figure 1. Large-scale calcium imaging in vivo. Supplementary Figure 1 Large-scale calcium imaging in vivo. (a) Schematic illustration of the in vivo camera imaging set-up for large-scale calcium imaging. (b) High-magnification two-photon image from

More information

Late assembly of the Vibrio cholerae cell division machinery postpones

Late assembly of the Vibrio cholerae cell division machinery postpones 2 Late assembly of the Vibrio cholerae cell division machinery postpones septation to the last % of the cell cycle 3 4 Elisa Galli, Evelyne Paly and François-Xavier Barre,# 5 6 7 Institute for Integrative

More information

- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml)

- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml) Supplementary Table ST1: The dynamic effect of LPS on IL-6 production in monocytes and THP-1 cells after GdA treatment. Monocytes, THP-1 cells and macrophages (5x10 5 ) were incubated with 10 μg/ml of

More information

Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted

Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted rag2e450fs fish. Monoclonal T-ALLs were serially passaged in strain fish and then used as donors (left panel). Cells were transplanted

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Choi YL, Soda M, Yamashita Y, et al. EML4-ALK mutations in

More information

Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.

Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T

More information

REPRINT WITH PERMISSION ONLY

REPRINT WITH PERMISSION ONLY Modern f luorescent proteins: from chromophore formation to novel intracellular applications Olesya V. Stepanenko, 1 Olga V. Stepanenko, 1 Daria M. Shcherbakova, 2 Irina M. Kuznetsova, 1 Кonstantin К.

More information

Supplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random

Supplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random S1 Supplementary Figure 1 (previous page). EM analysis of full-length GCGR. (a) Exemplary tilt pair images of the GCGR mab23 complex acquired for Random Conical Tilt (RCT) reconstruction (left: -50,right:

More information

Supplementary Information. Tissue-wide immunity against Leishmania. through collective production of nitric oxide

Supplementary Information. Tissue-wide immunity against Leishmania. through collective production of nitric oxide Supplementary Information Tissue-wide immunity against Leishmania through collective production of nitric oxide Romain Olekhnovitch, Bernhard Ryffel, Andreas J. Müller and Philippe Bousso Supplementary

More information

Gene expression scaled by distance to the genome replication site. Ying et al. Supporting Information. Contents. Supplementary note I p.

Gene expression scaled by distance to the genome replication site. Ying et al. Supporting Information. Contents. Supplementary note I p. Gene expression scaled by distance to the genome replication site Ying et al Supporting Information Contents Supplementary note I p. 2 Supplementary note II p. 3-5 Supplementary note III p. 5-7 Supplementary

More information

Problem Set 8 Key 1 of 8

Problem Set 8 Key 1 of 8 7.06 2003 Problem Set 8 Key 1 of 8 7.06 2003 Problem Set 8 Key 1. As a bright MD/PhD, you are interested in questions about the control of cell number in the body. Recently, you've seen three patients

More information

File name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description:

File name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description: File name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description: Supplementary Figure 1. Schematic of Ras biochemical coupled assay.

More information

ph and Reduction Dual Responsive Polyurethane Triblock Copolymers for Efficient Intracellular Drug Delivery

ph and Reduction Dual Responsive Polyurethane Triblock Copolymers for Efficient Intracellular Drug Delivery Supporting Information ph and Reduction Dual Responsive Polyurethane Triblock Copolymers for Efficient Intracellular Drug Delivery Shuangjiang Yu a, Chaoliang He* a, Jianxun Ding a,b, Yilong Cheng a,b,

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Supplementary Figure 1 SNARE Probes for FRET/2pFLIM Analysis Used in the Present Study. mturquoise (mtq) and Venus (Ven) are in blue and yellow, respectively. The soluble N-ethylmaleimide-sensitive

More information

Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were

Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were isolated from wild type (PKC-θ- WT) or PKC-θ null (PKC-θ-KO)

More information

A highly selective AIE fluorogen for lipid droplet imaging in live cells and green algae

A highly selective AIE fluorogen for lipid droplet imaging in live cells and green algae Electronic Supporting Information highly selective IE fluorogen for lipid droplet imaging in live cells and green algae Erjing Wang, ab Engui Zhao, ab Yuning Hong, ab Jacky W. Y. Lam, ab and en Zhong Tang*

More information

Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum...1. Trademarks: HiLyte Fluor (AnaSpec, Inc.)

Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum...1. Trademarks: HiLyte Fluor (AnaSpec, Inc.) Table of Contents Fluor TM Labeling Dyes Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum....1 Fluor TM 405 Dye, an Excellent Alternative to Alexa Fluor 405 & DyLight 405....2 Fluor

More information

d e f Spatiotemporal quantification of subcellular ATP levels in a single HeLa cell during changes in morphology Supplementary Information

d e f Spatiotemporal quantification of subcellular ATP levels in a single HeLa cell during changes in morphology Supplementary Information Ca 2+ level (a. u.) Area (a. u.) Normalized distance Normalized distance Center Edge Center Edge Relative ATP level Relative ATP level Supplementary Information Spatiotemporal quantification of subcellular

More information

Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al

Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Material Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Figure 1. AICAR improves P23H rod opsin

More information

Nature Biotechnology: doi: /nbt.3828

Nature Biotechnology: doi: /nbt.3828 Supplementary Figure 1 Development of a FRET-based MCS. (a) Linker and MA2 modification are indicated by single letter amino acid code. indicates deletion of amino acids and N or C indicate the terminus

More information

Optimization of the Fuse-It-mRNA Protocol for L929 Cells in the µ-plate 24 Well

Optimization of the Fuse-It-mRNA Protocol for L929 Cells in the µ-plate 24 Well Optimization of the Fuse-It-mRNA Protocol for L929 Cells in the µ-plate 24 Well 1. General Information... 1 2. Background... 1 3. Material and Equipment Required... 2 4. Experimental Procedure and Results...

More information

Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection

Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 2014 Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic

More information

Supplementary Material

Supplementary Material Supplementary Material accompanying the manuscript Interleukin 37 is a fundamental inhibitor of innate immunity Marcel F Nold, Claudia A Nold-Petry, Jarod A Zepp, Brent E Palmer, Philip Bufler & Charles

More information

F-actin VWF Vinculin. F-actin. Vinculin VWF

F-actin VWF Vinculin. F-actin. Vinculin VWF a F-actin VWF Vinculin b F-actin VWF Vinculin Supplementary Fig. 1. WPBs in HUVECs are located along stress fibers and at focal adhesions. (a) Immunofluorescence images of f-actin (cyan), VWF (yellow),

More information

Pre-made Reporter Lentivirus for JAK-STAT Signaling Pathway

Pre-made Reporter Lentivirus for JAK-STAT Signaling Pathway Pre-made Reporter for JAK-STAT Signaling Pathway Cat# Product Name Amounts LVP937-P or: LVP937-P-PBS ISRE-GFP (Puro) LVP938-P or: LVP938-P-PBS ISRE-RFP (Puro) LVP939-P or: LVP939-P-PBS ISRE-Luc (Puro)

More information

Supporting Information

Supporting Information Supporting Information Toward High-Efficient Red Emissive Carbon Dots: Facile Preparation, Unique Properties, and Applications as Multifunctional Theranostic Agents Shan Sun,, Ling Zhang, Kai Jiang, Aiguo

More information

Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression.

Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. Supplementary Figure 1 Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. a, Design for lentiviral combinatorial mirna expression and sensor constructs.

More information

reads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced to express

reads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced to express Supplementary Figure 1. VapC-mt4 cleaves trna Ala2 in E. coli. Histograms representing the fold change in reads observed in trnas from the analysis of RNAs carrying a 5 -OH ends isolated from cells induced

More information

Intravital Microscopic Interrogation of Peripheral Taste Sensation

Intravital Microscopic Interrogation of Peripheral Taste Sensation Supplementary Information Intravital Microscopic Interrogation of Peripheral Taste Sensation Myunghwan Choi 1, Woei Ming Lee 1,2, and Seok-Hyun Yun 1 * 1 Harvard Medical School and Wellman Center for Photomedicine,

More information

Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis

Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis of PD-L1 in ovarian cancer cells. (c) Western blot analysis

More information

Supplementary information - Table (1), Figures (12), and Videos (5)

Supplementary information - Table (1), Figures (12), and Videos (5) Supplementary information - Table (1), Figures (12), and Videos (5) A soft, transparent, freely accessible cranial window for chronic imaging and electrophysiology Chaejeong Heo 1, Hyejin Park 1, 2, Yong-Tae

More information

Gel-assisted formation of giant unilamellar vesicles

Gel-assisted formation of giant unilamellar vesicles Gel-assisted formation of giant unilamellar vesicles Andreas Weinberger 1, Feng-Ching Tsai 2, Gijsje H. Koenderink 2, Thais F. Schmidt 3, Rosângela Itri 4, Wolfgang Meier 5, Tatiana Schmatko 1, André Schröder

More information

Nature Medicine: doi: /nm.2109

Nature Medicine: doi: /nm.2109 HIV 1 Infects Multipotent Progenitor Cells Causing Cell Death and Establishing Latent Cellular Reservoirs Christoph C. Carter, Adewunmi Onafuwa Nuga, Lucy A. M c Namara, James Riddell IV, Dale Bixby, Michael

More information

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on

More information

Supporting Information

Supporting Information Supporting Information Cancer Cell Membrane-Biomimetic Nanoprobes with Two-Photon Excitation and Near-Infrared Emission for Intravital Tumor Fluorescence Imaging Yanlin Lv 1,2,, Ming Liu 3,4,, Yong Zhang

More information

(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable

(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/6/283/ra57/dc1 Supplementary Materials for JNK3 Couples the Neuronal Stress Response to Inhibition of Secretory Trafficking Guang Yang,* Xun Zhou, Jingyan Zhu,

More information

Supplementary information. The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic. Spindle Orientation

Supplementary information. The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic. Spindle Orientation Supplementary information The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic Spindle Orientation Running title: Dynein LICs distribute mitotic functions. Sagar Mahale a, d, *, Megha

More information

Effects of UBL5 knockdown on cell cycle distribution and sister chromatid cohesion

Effects of UBL5 knockdown on cell cycle distribution and sister chromatid cohesion Supplementary Figure S1. Effects of UBL5 knockdown on cell cycle distribution and sister chromatid cohesion A. Representative examples of flow cytometry profiles of HeLa cells transfected with indicated

More information

Supplementary Data. Different volumes of ethanol or calcium solution were slowly added through one of four

Supplementary Data. Different volumes of ethanol or calcium solution were slowly added through one of four Supplementary Data METHODS Liposome preparation Different volumes of ethanol or calcium solution were slowly added through one of four methods: Method I, no ethanol or calcium solution; Method II, exactly

More information

293T cells were transfected with indicated expression vectors and the whole-cell extracts were subjected

293T cells were transfected with indicated expression vectors and the whole-cell extracts were subjected SUPPLEMENTARY INFORMATION Supplementary Figure 1. Formation of a complex between Slo1 and CRL4A CRBN E3 ligase. (a) HEK 293T cells were transfected with indicated expression vectors and the whole-cell

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3076 Supplementary Figure 1 btrcp targets Cep68 for degradation during mitosis. a) Cep68 immunofluorescence in interphase and metaphase. U-2OS cells were transfected with control sirna

More information

Supporting Information

Supporting Information Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2018 Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 2016. Supporting Information

More information

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the

More information

Fluorescence Microscopy

Fluorescence Microscopy Fluorescence Microscopy Imaging Organelles Mitochondria Lysosomes Nuclei Endoplasmic Reticulum Plasma Membrane F-Actin AAT Bioquest Introduction: Organelle-Selective Stains Organelles are tiny, specialized

More information

Supplementary table 1

Supplementary table 1 Supplementary table 1 S. pombe strain list Fig. 1A JX38 h + ade6-m216 nda3-km311 PX476 PW775 PX545 PX546 h- ade6-m216 sgo2::ura4 + nda3-km311 h 9 mad2::ura4 + nda3-km311 h + ade6-m21 nda3-km311 rad21 +

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1. Cleavage of uniquitin AAA -CPP TAT in vitro and in cells. a, b. In vitro two-dimensional 1 H- 15 N correlation spectrum of ubiquitin AAA -CPP TAT before (a) and after (b) Yeast Ubiquitin Hydrolase

More information

SUPPLEMENTAL EXPERIMENTAL PROCEDURES

SUPPLEMENTAL EXPERIMENTAL PROCEDURES SUPPLEMENTAL EXPERIMENTAL PROCEDURES Crystal violet assay Cells were seeded in 24-well plates and cultured in media supplemented with % FBS for 7 days. Media were then removed, plates were briefly washed

More information

BMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented

BMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented Supplemental Materials Figure S1. Cultured BMDCs express CD11c BMDCs were generated in vitro from bone marrow cells cultured in 10 % RPMI supplemented with 15 ng/ml GM-CSF. Media was changed and fresh

More information

A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo

A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo Supporting Information A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo Yiming Li, a,b Hanbao Chong, a Xiangming Meng,* a Shuxin Wang, a Manzhou Zhu a and Qingxiang

More information

Quantification of intracellular payload release from

Quantification of intracellular payload release from Quantification of intracellular payload release from polymersome nanoparticles Edoardo Scarpa 1,2, Joanne L. Bailey 2, Agnieszka A. Janeczek 1,2, Patrick S. Stumpf 1,2, Alexander H. Johnston 2, Richard

More information

Pre-made Lentiviral Particles for Fluorescent Proteins

Pre-made Lentiviral Particles for Fluorescent Proteins Pre-made Lentiviral Particles for Fluorescent Proteins Catalog# Product Name Amounts Fluorescent proteins expressed under sucmv promoter: LVP001 LVP001-PBS LVP002 LVP002-PBS LVP011 LVP011-PBS LVP012 LVP012-PBS

More information

Supplementary Information

Supplementary Information Supplementary Information Archaeal Elp3 catalyzes trna wobble uridine modification at C5 via a radical mechanism Kiruthika Selvadurai, Pei Wang, Joseph Seimetz & Raven H Huang* Department of Biochemistry,

More information